(data stored in ACNUC13479 zone)

SWISSPROT: TPS11_ARATH

ID   TPS11_ARATH             Reviewed;         862 AA.
AC   Q9ZV48; Q94B44;
DT   18-MAR-2008, integrated into UniProtKB/Swiss-Prot.
DT   01-MAY-1999, sequence version 1.
DT   30-AUG-2017, entry version 99.
DE   RecName: Full=Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 11;
DE            EC=2.4.1.15;
DE   AltName: Full=Trehalose-6-phosphate synthase 11;
DE            Short=AtTPS11;
GN   Name=TPS11; Synonyms=TPSB; OrderedLocusNames=At2g18700;
GN   ORFNames=MSF3.8;
OS   Arabidopsis thaliana (Mouse-ear cress).
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae;
OC   Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae;
OC   Arabidopsis.
OX   NCBI_TaxID=3702;
RN   [1]
RP   NUCLEOTIDE SEQUENCE [MRNA], AND TISSUE SPECIFICITY.
RC   STRAIN=cv. Landsberg erecta;
RX   PubMed=11520870; DOI=10.1093/jexbot/52.362.1817;
RA   Vogel G., Fiehn O., Jean-Richard-dit-Bressel L., Boller T.,
RA   Wiemken A., Aeschbacher R.A., Wingler A.;
RT   "Trehalose metabolism in Arabidopsis: occurrence of trehalose and
RT   molecular cloning and characterization of trehalose-6-phosphate
RT   synthase homologues.";
RL   J. Exp. Bot. 52:1817-1826(2001).
RN   [2]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
RC   STRAIN=cv. Columbia;
RX   PubMed=10617197; DOI=10.1038/45471;
RA   Lin X., Kaul S., Rounsley S.D., Shea T.P., Benito M.-I., Town C.D.,
RA   Fujii C.Y., Mason T.M., Bowman C.L., Barnstead M.E., Feldblyum T.V.,
RA   Buell C.R., Ketchum K.A., Lee J.J., Ronning C.M., Koo H.L.,
RA   Moffat K.S., Cronin L.A., Shen M., Pai G., Van Aken S., Umayam L.,
RA   Tallon L.J., Gill J.E., Adams M.D., Carrera A.J., Creasy T.H.,
RA   Goodman H.M., Somerville C.R., Copenhaver G.P., Preuss D.,
RA   Nierman W.C., White O., Eisen J.A., Salzberg S.L., Fraser C.M.,
RA   Venter J.C.;
RT   "Sequence and analysis of chromosome 2 of the plant Arabidopsis
RT   thaliana.";
RL   Nature 402:761-768(1999).
RN   [3]
RP   GENOME REANNOTATION.
RC   STRAIN=cv. Columbia;
RG   The Arabidopsis Information Portal (Araport);
RL   Submitted (MAY-2016) to the EMBL/GenBank/DDBJ databases.
RN   [4]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 588-778 (ISOFORM 2).
RC   STRAIN=cv. Columbia;
RX   PubMed=11910074; DOI=10.1126/science.1071006;
RA   Seki M., Narusaka M., Kamiya A., Ishida J., Satou M., Sakurai T.,
RA   Nakajima M., Enju A., Akiyama K., Oono Y., Muramatsu M.,
RA   Hayashizaki Y., Kawai J., Carninci P., Itoh M., Ishii Y., Arakawa T.,
RA   Shibata K., Shinagawa A., Shinozaki K.;
RT   "Functional annotation of a full-length Arabidopsis cDNA collection.";
RL   Science 296:141-145(2002).
RN   [5]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 589-862 (ISOFORM 2).
RC   STRAIN=cv. Columbia;
RX   PubMed=14593172; DOI=10.1126/science.1088305;
RA   Yamada K., Lim J., Dale J.M., Chen H., Shinn P., Palm C.J.,
RA   Southwick A.M., Wu H.C., Kim C.J., Nguyen M., Pham P.K., Cheuk R.F.,
RA   Karlin-Newmann G., Liu S.X., Lam B., Sakano H., Wu T., Yu G.,
RA   Miranda M., Quach H.L., Tripp M., Chang C.H., Lee J.M., Toriumi M.J.,
RA   Chan M.M., Tang C.C., Onodera C.S., Deng J.M., Akiyama K., Ansari Y.,
RA   Arakawa T., Banh J., Banno F., Bowser L., Brooks S.Y., Carninci P.,
RA   Chao Q., Choy N., Enju A., Goldsmith A.D., Gurjal M., Hansen N.F.,
RA   Hayashizaki Y., Johnson-Hopson C., Hsuan V.W., Iida K., Karnes M.,
RA   Khan S., Koesema E., Ishida J., Jiang P.X., Jones T., Kawai J.,
RA   Kamiya A., Meyers C., Nakajima M., Narusaka M., Seki M., Sakurai T.,
RA   Satou M., Tamse R., Vaysberg M., Wallender E.K., Wong C., Yamamura Y.,
RA   Yuan S., Shinozaki K., Davis R.W., Theologis A., Ecker J.R.;
RT   "Empirical analysis of transcriptional activity in the Arabidopsis
RT   genome.";
RL   Science 302:842-846(2003).
RN   [6]
RP   GENE FAMILY, AND NOMENCLATURE.
RX   PubMed=11701378; DOI=10.1016/S1360-1385(01)02125-2;
RA   Leyman B., Van Dijck P., Thevelein J.M.;
RT   "An unexpected plethora of trehalose biosynthesis genes in Arabidopsis
RT   thaliana.";
RL   Trends Plant Sci. 6:510-513(2001).
CC   -!- CATALYTIC ACTIVITY: UDP-glucose + D-glucose 6-phosphate = UDP +
CC       alpha,alpha-trehalose 6-phosphate.
CC   -!- ALTERNATIVE PRODUCTS:
CC       Event=Alternative splicing; Named isoforms=2;
CC       Name=1;
CC         IsoId=Q9ZV48-1; Sequence=Displayed;
CC         Note=Derived from EST data. No experimental confirmation
CC         available.;
CC       Name=2;
CC         IsoId=Q9ZV48-2; Sequence=VSP_032378;
CC   -!- TISSUE SPECIFICITY: Expressed in leaves, roots, stems and flowers.
CC       {ECO:0000269|PubMed:11520870}.
CC   -!- SIMILARITY: In the N-terminal section; belongs to the
CC       glycosyltransferase 20 family. {ECO:0000305}.
CC   -!- SIMILARITY: In the C-terminal section; belongs to the trehalose
CC       phosphatase family. {ECO:0000305}.
CC   -!- SEQUENCE CAUTION:
CC       Sequence=AAK68805.1; Type=Erroneous initiation; Evidence={ECO:0000305};
DR   EMBL; AC005724; AAD08939.1; -; Genomic_DNA.
DR   EMBL; CP002685; AEC06795.1; -; Genomic_DNA.
DR   EMBL; AV822913; -; NOT_ANNOTATED_CDS; mRNA.
DR   EMBL; AY042865; AAK68805.1; ALT_INIT; mRNA.
DR   EMBL; AY081537; AAM10099.1; -; mRNA.
DR   PIR; E84567; E84567.
DR   RefSeq; NP_179460.1; NM_127426.3. [Q9ZV48-1]
DR   UniGene; At.25317; -.
DR   ProteinModelPortal; Q9ZV48; -.
DR   SMR; Q9ZV48; -.
DR   STRING; 3702.AT2G18700.1; -.
DR   CAZy; GT20; Glycosyltransferase Family 20.
DR   PaxDb; Q9ZV48; -.
DR   PRIDE; Q9ZV48; -.
DR   EnsemblPlants; AT2G18700.1; AT2G18700.1; AT2G18700. [Q9ZV48-1]
DR   GeneID; 816385; -.
DR   Gramene; AT2G18700.1; AT2G18700.1; AT2G18700.
DR   KEGG; ath:AT2G18700; -.
DR   Araport; AT2G18700; -.
DR   TAIR; locus:2054027; AT2G18700.
DR   eggNOG; KOG1050; Eukaryota.
DR   eggNOG; COG0380; LUCA.
DR   eggNOG; COG1877; LUCA.
DR   HOGENOM; HOG000191476; -.
DR   InParanoid; Q9ZV48; -.
DR   KO; K16055; -.
DR   OMA; SQREGMN; -.
DR   OrthoDB; EOG093601RY; -.
DR   PhylomeDB; Q9ZV48; -.
DR   PRO; PR:Q9ZV48; -.
DR   Proteomes; UP000006548; Chromosome 2.
DR   Genevisible; Q9ZV48; AT.
DR   GO; GO:0005829; C:cytosol; IDA:TAIR.
DR   GO; GO:0005739; C:mitochondrion; IDA:TAIR.
DR   GO; GO:0016791; F:phosphatase activity; IBA:GO_Central.
DR   GO; GO:0016757; F:transferase activity, transferring glycosyl groups; IEA:UniProtKB-KW.
DR   GO; GO:0005992; P:trehalose biosynthetic process; IBA:GO_Central.
DR   GO; GO:0070413; P:trehalose metabolism in response to stress; IBA:GO_Central.
DR   CDD; cd03788; GT1_TPS; 1.
DR   Gene3D; 3.40.50.1000; -; 1.
DR   InterPro; IPR001830; Glyco_trans_20.
DR   InterPro; IPR023214; HAD-like_dom.
DR   InterPro; IPR006379; HAD-SF_hydro_IIB.
DR   InterPro; IPR003337; Trehalose_PPase.
DR   Pfam; PF00982; Glyco_transf_20; 1.
DR   Pfam; PF02358; Trehalose_PPase; 1.
DR   SUPFAM; SSF56784; SSF56784; 1.
DR   TIGRFAMs; TIGR01484; HAD-SF-IIB; 1.
DR   TIGRFAMs; TIGR00685; T6PP; 1.
PE   2: Evidence at transcript level;
DR   PRODOM; Q9ZV48.
DR   SWISS-2DPAGE; Q9ZV48.
KW   Alternative splicing; Complete proteome; Glycosyltransferase;
KW   Phosphoprotein; Reference proteome; Transferase.
FT   CHAIN         1    862       Probable alpha,alpha-trehalose-phosphate
FT                                synthase [UDP-forming] 11.
FT                                /FTId=PRO_0000324832.
FT   REGION       50    538       Glycosyltransferase.
FT   MOD_RES       5      5       Phosphoserine.
FT                                {ECO:0000250|UniProtKB:O23617}.
FT   VAR_SEQ     654    654       T -> TRYFAKTLPFHHLPSHFCKVNTFLLLICNH (in
FT                                isoform 2). {ECO:0000303|PubMed:11910074,
FT                                ECO:0000303|PubMed:14593172}.
FT                                /FTId=VSP_032378.
SQ   SEQUENCE   862 AA;  98275 MW;  2D2808FBFA1D5B6A CRC64;
     MSPESWKDQL SLVSADDYRI MGRNRIPNAV TKLSGLETDD PNGGAWVTKP KRIVVSNQLP
     LRAHRDISSN KWCFEFDNDS LYLQLKDGFP PETEVVYVGS LNADVLPSEQ EDVSQFLLEK
     FQCVPTFLPS DLLNKYYHGF CKHYLWPIFH YLLPMTQAQG SLFDRSNWRA YTTVNKIFAD
     KIFEVLNPDD DYVWIHDYHL MILPTFLRNR FHRIKLGIFL HSPFPSSEIY RTLPVRDEIL
     KGFLNCDLVG FHTFDYARHF LSCCSRMLGL DYESKRGYIG LEYFGRTVSI KILPVGIHMG
     QIESIKASEK TAEKVKRLRE RFKGNIVMLG VDDLDMFKGI SLKFWAMGQL LEQNEELRGK
     VVLVQITNPA RSSGKDVQDV EKQINLIADE INSKFGRPGG YKPIVFINGP VSTLDKVAYY
     AISECVVVNA VRDGMNLVPY KYTVTRQGSP ALDAALGFGE DDVRKSVIIV SEFIGCSPSL
     SGAIRVNPWN IDAVTNAMSS AMTMSDKEKN LRHQKHHKYI SSHNVAYWAR SYDQDLQRAC
     KDHYNKRFWG VGFGLFFKVV ALDPNFRRLC GETIVPAYRR SSSRLILLDY DGTMMDQDTL
     DKRPSDDLIS LLNRLCDDPS NLVFIVSGRG KDPLSKWFDS CPNLGISAEH GYFTRWNSNS
     PWETSELPAD LSWKKIAKPV MNHYMEATDG SFIEEKESAM VWHHQEADHS FGSWQAKELL
     DHLESVLTNE PVVVKRGQHI VEVKPQGVSK GKVVEHLIAT MRNTKGKRPD FLLCIGDDRS
     DEDMFDSIVK HQDVSSIGLE EVFACTVGQK PSKAKYYLDD TPSVIKMLEW LASASDGSKH
     EQQKKQSKFT FQQPMGQCRK KA
//

If you have problems or comments...

PBIL Back to PBIL home page