(data stored in ACNUC7421 zone)

SWISSPROT: T3RE_SALTY

ID   T3RE_SALTY              Reviewed;         990 AA.
AC   P40815;
DT   01-FEB-1995, integrated into UniProtKB/Swiss-Prot.
DT   23-JAN-2002, sequence version 2.
DT   11-DEC-2019, entry version 119.
DE   RecName: Full=Type III restriction-modification system StyLTI enzyme res;
DE            EC=3.1.21.5;
GN   Name=res; OrderedLocusNames=STM0358;
OS   Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720).
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
OC   Enterobacteriaceae; Salmonella.
OX   NCBI_TaxID=99287;
RN   [1]
RP   NUCLEOTIDE SEQUENCE [GENOMIC DNA].
RC   STRAIN=LT7;
RX   PubMed=8387444; DOI=10.1016/0378-1119(93)90623-b;
RA   Dartois V., de Backer O., Colson C.;
RT   "Sequence of the Salmonella typhimurium StyLT1 restriction-modification
RT   genes: homologies with EcoP1 and EcoP15 type-III R-M systems and presence
RT   of helicase domains.";
RL   Gene 127:105-110(1993).
RN   [2]
RP   NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
RC   STRAIN=LT2 / SGSC1412 / ATCC 700720;
RX   PubMed=11677609; DOI=10.1038/35101614;
RA   McClelland M., Sanderson K.E., Spieth J., Clifton S.W., Latreille P.,
RA   Courtney L., Porwollik S., Ali J., Dante M., Du F., Hou S., Layman D.,
RA   Leonard S., Nguyen C., Scott K., Holmes A., Grewal N., Mulvaney E.,
RA   Ryan E., Sun H., Florea L., Miller W., Stoneking T., Nhan M., Waterston R.,
RA   Wilson R.K.;
RT   "Complete genome sequence of Salmonella enterica serovar Typhimurium LT2.";
RL   Nature 413:852-856(2001).
CC   -!- FUNCTION: Cleaves DNA some 25 base-pairs downstream from the
CC       recognition site. May also act as a helicase involved in unwinding DNA
CC       at the cleavage site. Protein only required for restriction but needs
CC       the presence of the modification enzyme.
CC   -!- CATALYTIC ACTIVITY:
CC       Reaction=Endonucleolytic cleavage of DNA to give specific double-
CC         stranded fragments with terminal 5'-phosphates.; EC=3.1.21.5;
CC   -!- COFACTOR:
CC       Name=Mg(2+); Xref=ChEBI:CHEBI:18420;
CC   -!- SUBUNIT: Contains two different subunits: res and mod.
CC   -!- SIMILARITY: Belongs to the type III restriction-modification system res
CC       protein family. {ECO:0000305}.
DR   EMBL; M90544; -; NOT_ANNOTATED_CDS; Genomic_DNA.
DR   EMBL; AE006468; AAL19312.1; -; Genomic_DNA.
DR   PIR; JN0658; JN0658.
DR   RefSeq; NP_459353.3; NC_003197.2.
DR   RefSeq; WP_001651666.1; NC_003197.2.
DR   SMR; P40815; -.
DR   REBASE; 1788; StyLTI.
DR   REBASE; 231845; Sen4024ORF3354P.
DR   REBASE; 233832; Sen4839ORF3406P.
DR   PaxDb; P40815; -.
DR   PRIDE; P40815; -.
DR   EnsemblBacteria; AAL19312; AAL19312; STM0358.
DR   GeneID; 1251877; -.
DR   KEGG; stm:STM0358; -.
DR   eggNOG; ENOG4105D8D; Bacteria.
DR   eggNOG; COG3587; LUCA.
DR   KO; K01156; -.
DR   OMA; ELWQTIN; -.
DR   BioCyc; SENT99287:STM0358-MONOMER; -.
DR   PRO; PR:P40815; -.
DR   Proteomes; UP000001014; Chromosome.
DR   GO; GO:0005524; F:ATP binding; IEA:UniProtKB-KW.
DR   GO; GO:0003677; F:DNA binding; IEA:InterPro.
DR   GO; GO:0004386; F:helicase activity; IEA:UniProtKB-KW.
DR   GO; GO:0015668; F:type III site-specific deoxyribonuclease activity; IEA:UniProtKB-EC.
DR   GO; GO:0009307; P:DNA restriction-modification system; IEA:UniProtKB-KW.
DR   InterPro; IPR006935; Helicase/UvrB_N.
DR   InterPro; IPR027417; P-loop_NTPase.
DR   InterPro; IPR014883; VRR_NUC.
DR   Pfam; PF04851; ResIII; 1.
DR   Pfam; PF08774; VRR_NUC; 1.
DR   SUPFAM; SSF52540; SSF52540; 2.
PE   3: Inferred from homology;
DR   PRODOM; P40815.
DR   SWISS-2DPAGE; P40815.
KW   ATP-binding; Endonuclease; Helicase; Hydrolase; Nuclease;
KW   Nucleotide-binding; Reference proteome; Restriction system.
FT   CHAIN           1..990
FT                   /note="Type III restriction-modification system StyLTI
FT                   enzyme res"
FT                   /id="PRO_0000077375"
FT   DOMAIN          884..970
FT                   /note="VRR-NUC"
FT   CONFLICT        17
FT                   /note="A -> R (in Ref. 1; M90544)"
FT                   /evidence="ECO:0000305"
FT   CONFLICT        293..298
FT                   /note="KLILRR -> EINPPT (in Ref. 1; M90544)"
FT                   /evidence="ECO:0000305"
FT   CONFLICT        350
FT                   /note="S -> T (in Ref. 1; M90544)"
FT                   /evidence="ECO:0000305"
FT   CONFLICT        420
FT                   /note="L -> V (in Ref. 1; M90544)"
FT                   /evidence="ECO:0000305"
FT   CONFLICT        464..465
FT                   /note="SG -> R (in Ref. 1; M90544)"
FT                   /evidence="ECO:0000305"
FT   CONFLICT        536..537
FT                   /note="GL -> AV (in Ref. 1; M90544)"
FT                   /evidence="ECO:0000305"
FT   CONFLICT        945..990
FT                   /note="DQVILDAQRKFFDMLRRQNINVEFAEATSAPAVFSTINGLIEGKAN -> IR
FT                   LFLMRNVNSSICCVGKISMSSLRKDQRAGGIFYDQWLD (in Ref. 1; M90544)"
FT                   /evidence="ECO:0000305"
SQ   SEQUENCE   990 AA;  113388 MW;  8E821E02A895D16E CRC64;
     MMNILLEELP HQEQALAAIL ASFTGIDHAQ ADHNHYANPL IKERYDDKAN IDVKMETGTG
     KTYVYTRLMY ELHQKYGLFK FVLVVPTPAI KEGARNFITS DYARQHFSQF YENTRMELCT
     INAGDFKVKS GRKNFPAQLL SFTDASRRDS HTIQVLLINA QMLNSASMTR DDYDQTLLGG
     LTSPVKGLQM TRPVVIIDEP HRFARDNKFY RAIQAIQPQM IVRFGATFPD IVEGKGKNKC
     VRKDYYRRQP QFDLNAVDSF NDGLVKGIDI YYPNLPEEQA NNRYIVDSVT AKKLILRRGS
     KIAEVGVGEN LADVDAGFEG SIEYAGSKML SNDLELEAGM ALVPGTFGAS YQELIIQDAI
     DKHFDTEQAN FLRSNEPENN APRIKTLSLF FIDSIKSYRD DEGWLKVTFE RLLKKKLTQL
     IDDYQRKTLP REVEYLSFLQ ATLASLHSDN QNVHAGYFGE DRGSGDEAIQ AEVDDILKNK
     EKLLSFSDHH GNWETRRFLF SKWTLREGWD NPNVFVIAKL RSSGSESSKI QEVGRGLRLP
     VDENGHRVHQ EEWPSRLSFL IGYDEKAFAS MLVDEINRDS KVQLNEQKLD EAMITLIVTE
     RQKVDPAFTE LRLLEDLDDK KLINRSNEFK PSVTLNGETK SGFAWLLEFY PELTQARVRA
     DRIRDNKPAS RLRVRLRKEN WEQLSSIWEQ FSRRYMLQFE RSGASLEQIA AEVLRDPALY
     IRQKPSQVQQ RLVSNEDNGR FEVAQREGEL AASEFMAGMK YGHFLKQLAL RTSLPVNVLH
     PVLMAMLRDV LHGDSRYLSE ISLDNMTRAL QTRINAHFAQ RHDYLPLDFQ ASTSVFDSTA
     RQFREEISAE IVGKNVDENA IDDPRSLYQI PPLRYDSVDP ELPLLKYDYP QQVSVFGKLP
     KRAIQIPKYT GGSTTPDFVY RIERQDADSV YLLVETKAEN MRVGDQVILD AQRKFFDMLR
     RQNINVEFAE ATSAPAVFST INGLIEGKAN
//

If you have problems or comments...

PBIL Back to PBIL home page