(data stored in SCRATCH zone)

EMBL: AB000617

ID   AB000617; SV 1; linear; genomic DNA; STD; PRO; 35000 BP.
XX
AC   AB000617;
XX
DT   15-SEP-1997 (Rel. 52, Created)
DT   14-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Bacillus subtilis genomic DNA, 22 to 25 degree region, complete cds.
XX
KW   LmrA; LmrB; NatA; NatB; RapJ; rapJ; Triacylglycerol lipase; YcbU; yccA;
KW   yccB; YccC; YccE; YccF; YccG; YccH; YccK; yccK; YcdA; YcdB; YcdC; YcdD;
KW   YcdF; YcdG; ycdG; YcdH; YcdI; YceA; YceB; YceC; YceD; yceD; YceE; yceE;
KW   YceF; YceG; yceG; YceH; yceH; YceI; yceI; YceJ; yceJ; YceK; yceK.
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-35000
RA   Yamane K.;
RT   ;
RL   Submitted (20-JAN-1997) to the INSDC.
RL   Kunio Yamane, University of Tsukuba, Institute of Biological Sciences;
RL   1-1-1 Ten-ohdai, Tsukuba, Ibaraki 305, Japan (Tel:0298-53-6680,
RL   Fax:0298-53-6680)
XX
RN   [2]
RA   Kumano M., Tamakoshi A., Yamane K.;
RT   "A 32 kb nucleotide sequence from the region of the lincomycin-resistance
RT   gene (22-25 degree) of the Bacillus subtilis chromosome and identification
RT   of the site of the lin-2 mutation";
RL   Unpublished.
XX
DR   MD5; 9091b62340fca5054870042b2d733347.
DR   EuropePMC; PMC91209; 10103239.
DR   RFAM; RF01690; Bacillaceae-1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..35000
FT                   /organism="Bacillus subtilis"
FT                   /map="22 to 25 degree"
FT                   /strain="168 trpC2"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   CDS_pept        592..1704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycbU"
FT                   /product="YcbU"
FT                   /note="homologue of class-V proteins of
FT                   pyridoxal-phosphate-dependent aminotransferase"
FT                   /db_xref="GOA:P42253"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42253"
FT                   /protein_id="BAA22227.1"
FT                   /translation="MEHLPEQYRQLFPTLQTHTMLASCSQSALAEPVSRAIQDYYDSLL
FT                   YKGTNWKEAIEKTEFARNEFAKLIGAEPDEVAIVPSVSDALVSVASYLTAFGKKHVVYT
FT                   DMDFPAVPHVWQAHSDYTVSVIPSIDGVLPLEQYETHISDETVLTCVPHVHYRDGYVQD
FT                   IKAIAEISQRKGSLLFVDAYQSAGHIPIDVKEWGVDMLAAGTRKYLLGIPGVAFLYVRK
FT                   ELADALKPKASAWFGRESGFDGAYAKVARRFQTGTPAFISVYAAAAALSLLNHIGVSHI
FT                   RDHVKTICADAVQYAAEKGLQLAAAQGGIQPGMVAIRDERASETAGLLKKKKVICAPRE
FT                   NVIRLAPHFYNTKEEMRHAIDEIAAKTIHK"
FT   CDS_pept        complement(1746..3185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yccA"
FT                   /product="LmrB"
FT                   /note="lincomycin-resistance protein, similar to
FT                   multidrug-resistant protein"
FT                   /note="lmrB gene"
FT                   /db_xref="GOA:O35018"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35018"
FT                   /protein_id="BAA22228.1"
FT                   /translation="MILETTAKASQQYKVMPIMISLLLAGFIGMFSETALNIALTDLMK
FT                   ELNITAATVQWLTTGYLLVLGILVPVSGLLLQWFTTRQLFTVSLIFSILGTFIAALAPS
FT                   FSFLLAARIVQALGTGLLLPLMFNTILVIFPPHKRGAAMGTIGLVIMFAPAIGPTFSGL
FT                   VLEHLNWHWIFWISLPFLVLALVFGIAYMQNVSETTKPKIDVLSIILSTIGFGGIVFGF
FT                   SNAGEGSGGWSSPTVIVSLIVGVVGLILFSIRQLTMKQPMMNLRAFKYPMFILGVIMVF
FT                   ICMMVILSSMLLLPMYLQGGLVLTAFASGLVLLPGGILNGFMSPVTGRLFDKYGPKWLV
FT                   IPGFVIVTVVLWFFSNVTTTSTAVLIIILHTCLMIGISMIMMPAQTNGLNQLPREFYPD
FT                   GTAIMNTLQQMAGAIGTAVAVSIMAAGQHDYMSTVKNPADPAVIPQALTAGVQHAFVFA
FT                   MIVAIIGLIGAFFMKRVKVDH"
FT   CDS_pept        complement(3225..3791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yccB"
FT                   /product="LmrA"
FT                   /note="lmrA gene"
FT                   /note="probable repressor of lincomycin-resistance operon"
FT                   /db_xref="GOA:O34619"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34619"
FT                   /protein_id="BAA22229.1"
FT                   /translation="MSYGDSREKILSAATRLFQLQGYYGTGLNQIIKESGAPKGSLYYH
FT                   FPGGKEQLAIEAVNEMKEYIRQKIADCMEACTDPAEGIQAFLKELSCQFSCTEDIEGLP
FT                   VGLLAAETSLKSEPLREACHEAYKEWASVYEEKLRQTGCSESRAKEASTVVNAMIEGGI
FT                   LLSLTAKNSTPLLHISSCIPDLLKR"
FT   CDS_pept        4008..5135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yccC"
FT                   /product="YccC"
FT                   /note="probable L-asparaginase precursor"
FT                   /db_xref="GOA:O34482"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34482"
FT                   /protein_id="BAA22230.1"
FT                   /translation="MKKQRMLVLFTALLFVFTGCSHSPETKESPKEKAQTQKVSSASAS
FT                   EKKDLPNIRILATGGTIAGADQSKTSTTEYKAGVVGVESLIEAVPEMKDIANVSGEQIV
FT                   NVGSTNIDNKILLKLAKRINHLLASDDVDGIVVTHGTDTLEETAYFLNLTVKSDKPVVI
FT                   VGSMRPSTAISADGPSNLYNAVKVAGAPEAKGKGTLVVLNDRIASARYVTKTNTTTTDT
FT                   FKSEEMGFVGTIADDIYFNNEITRKHTKDTDFSVSNLDELPQVDIIYGYQNDGSYLFDA
FT                   AVKAGAKGIVFAGSGNGSLSDAAEKGADSAVKKGVTVVRSTRTGNGVVTPNQDYAEKDL
FT                   LASNSLNPQKARMLLMLALTKTNDPQKIQAYFNEY"
FT   CDS_pept        5298..5936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipA"
FT                   /product="Triacylglycerol lipase"
FT                   /db_xref="GOA:P37957"
FT                   /db_xref="InterPro:IPR002918"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="PDB:1I6W"
FT                   /db_xref="PDB:1ISP"
FT                   /db_xref="PDB:1R4Z"
FT                   /db_xref="PDB:1R50"
FT                   /db_xref="PDB:1T2N"
FT                   /db_xref="PDB:1T4M"
FT                   /db_xref="PDB:2QXT"
FT                   /db_xref="PDB:2QXU"
FT                   /db_xref="PDB:3D2A"
FT                   /db_xref="PDB:3D2B"
FT                   /db_xref="PDB:3D2C"
FT                   /db_xref="PDB:3QMM"
FT                   /db_xref="PDB:3QZU"
FT                   /db_xref="PDB:5CRI"
FT                   /db_xref="PDB:5CT4"
FT                   /db_xref="PDB:5CT5"
FT                   /db_xref="PDB:5CT6"
FT                   /db_xref="PDB:5CT8"
FT                   /db_xref="PDB:5CT9"
FT                   /db_xref="PDB:5CTA"
FT                   /db_xref="PDB:5CUR"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37957"
FT                   /protein_id="BAA22231.1"
FT                   /translation="MKFVKRRIIALVTILMLSVTSLFALQPSAKAAEHNPVVMVHGIGG
FT                   ASFNFAGIKSYLVSQGWSRDKLYAVDFWDKTGTNYNNGPVLSRFVQKVLDETGAKKVDI
FT                   VAHSMGGANTLYYIKNLDGGNKVANVVTLGGANRLTTGKALPGTDPNQKILYTSIYSSA
FT                   DMIVMNYLSRLDGARNVQIHGVGHIGLLYSSQVNSLIKEGLNGGGQNTN"
FT   CDS_pept        6073..6318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yccE"
FT                   /product="YccE"
FT                   /db_xref="UniProtKB/TrEMBL:O24720"
FT                   /protein_id="BAA22232.1"
FT                   /translation="MHPRYQVTDNGLREGYFFICFVPHDLQPDDFFAQCALPICQRHQQ
FT                   RVHNQHQYGDNNDTGGPIAKRKSGCQNHCCGNDYIK"
FT   CDS_pept        6592..7668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yccF"
FT                   /product="YccF"
FT                   /db_xref="GOA:O34478"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR007889"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34478"
FT                   /protein_id="BAA22233.1"
FT                   /translation="MGKVKRNAPCPCGSGKKYKKCCGSKVVDFPAELAAKEAKQIQEDL
FT                   VEYAFTVHRESISGFINQHDFLSAMDRQTKDISVFNLGIWGIFFHPLAGEKTIFEEYLQ
FT                   KKGDSITRPKTREIVESWQSMTPALLLLKDLKEGIIHFEDVITAKQFEVEMDASNQDLP
FT                   PVGSLILGYPIHEAEKAEFFMQFTIFPVKRTEALISKVKKYADAAVKDGKTPEDFMKQE
FT                   FNNVLFALLAEKDEEPQAEKAEVSTVEWANDLEKETAAAIEEGMSGEEYPTELIPAVID
FT                   IWKTFCEKKSPVIRKPEAFAAAVEYYVNAISLNGASVSQAKLAKKYGVSASTISSRYKE
FT                   IESTLQDEADRFAQALSS"
FT   CDS_pept        complement(7708..8664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yccG"
FT                   /product="YccG"
FT                   /db_xref="GOA:P70954"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70954"
FT                   /protein_id="BAA22234.1"
FT                   /translation="MITLFQCLYLILFSFICYQGAAAFSHSTAASWLAAALGAAAAGLY
FT                   IWNTKRVWKHCSSGLCAWIAVIQVMSVGVVLIGTDIMPVLCVIAIFAGCEGLRIGQSAL
FT                   QARLSDQIDKLTQAEQHANQMLIDVRSRNHDTMKHITAIKSAQPKADTQAYIQNWADQY
FT                   SQYDRFLKGENAYVAGVLYDFLEKARASNVSVSLHMHTPLSSLPFSPADQVSLVGNILE
FT                   NALDSAAEAREKAEIKLETSLRSGLYVLTCENSTPGMDPKVLDTIYQSFGRSTKNGAHE
FT                   GMGTYIIQKLVKGAFGRLDFTYRHPIFRLEIKIPFQK"
FT   CDS_pept        complement(8677..9378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yccH"
FT                   /product="YccH"
FT                   /note="homologue of sensor/response regulator protein of
FT                   Staphylococcus aureus"
FT                   /db_xref="GOA:P70955"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70955"
FT                   /protein_id="BAA22235.1"
FT                   /translation="MVKVGLVDDYRVDLEKLEAIVSRMQDVEIVFSTDSAKEAYRRVKN
FT                   GDIDLLLADIEMPHMSGYELADLIKSHSLDVDVIFVTGHGGYAVHAFDLNVHDYIMKPY
FT                   YADRLAASFDRYLKKKTETSLNGRILIKQKSEMHVLQKKDIIFAERTGRSTTIVTTAEE
FT                   VQTYQTLNDIKGDLPEKDFLRSHRSFIINIHYIKHFSAYTKHSFTVSFEGTSKKAMITK
FT                   QQLDYFQNYYF"
FT   CDS_pept        9522..10262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="natA"
FT                   /product="NatA"
FT                   /note="homologue of ATP-binding transport protein (function
FT                   unknown) of Bacillus subtilis"
FT                   /db_xref="GOA:P46903"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46903"
FT                   /protein_id="BAA22236.1"
FT                   /translation="MITLTDCSRRFQDKKKVVKAVRDVSLTIEKGEVVGILGENGAGKT
FT                   TMLRMIASLLEPSQGVITVDGFDTVKQPAEVKQRIGVLFGGETGLYDRMTAKENLQYFG
FT                   RLYGLNRHEIKARIEDLSKRFGMRDYMNRRVGGFSKGMRQKVAIARALIHDPDIILFDE
FT                   PTTGLDITSSNIFREFIQQLKREQKTILFSSHIMEEVQALCDSVIMIHSGEVIYRGALE
FT                   SLYESERSEDLNYIFMSKLVRGIS"
FT   CDS_pept        10778..11419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="natB"
FT                   /product="NatB"
FT                   /note="function of NatB is not known, Integral membrane
FT                   protein"
FT                   /db_xref="GOA:Q7DLB6"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:Q7DLB6"
FT                   /protein_id="BAA22237.1"
FT                   /translation="MLSAILPMLILTSIVSGAMPIALDIMAGEKDRKSIEALLLTPVSR
FT                   NKVLVGKWLAVSTFGVASGVFALVFLILSTVLFTENLKTAFQLGDHMWSVIGASALIIV
FT                   LSALLISAMELFISIMSSSVKEAQSYMSLVVFLPVFPMFFIFSKAPNQFDLSYFLIPFL
FT                   NLHALFKQLLFGMVDPATILSTSGTIAVLIAIFFLLARACFLKDKWVLPK"
FT   CDS_pept        11555..12487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yccK"
FT                   /product="YccK"
FT                   /note="hypothetical YzaE protein (function unknown) in the
FT                   natB region of Bacillus subtilis, which belongs to the
FT                   aldo/keto reductase family 2"
FT                   /db_xref="GOA:P46905"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46905"
FT                   /protein_id="BAA22238.1"
FT                   /translation="MDQTRTLGKTKLKVKRIGFGANAVGGHNLFPNLNDETGKDLVRTA
FT                   LDGGVNFIDTAFIYGLGRSEELIGEVVQERGVRNELIIATKGAHKEVDGSIELDNSREF
FT                   LRSEVEKSLKRLKTDYIDLYYVHFPDGKTPLAEVAGTLKELKDEGKIKAIGASNLDYQQ
FT                   LQDFNADGYLEVFQAEYSLIQRDAEKELLPYCEKQGISFIPYFPLASGLLTGKFTQDTV
FT                   FDDFRKDKPQFQGETFIHNLKKVDKLKAVAEEKQADTAHVALAWLLTRPAIDAIIPGAK
FT                   RPEQLQDNLKTLNIELTEDEVNFISDIFK"
FT   CDS_pept        complement(12527..13591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycdA"
FT                   /product="YcdA"
FT                   /db_xref="GOA:O34538"
FT                   /db_xref="InterPro:IPR029050"
FT                   /db_xref="InterPro:IPR029051"
FT                   /db_xref="InterPro:IPR031343"
FT                   /db_xref="PDB:4R4G"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34538"
FT                   /protein_id="BAA22239.1"
FT                   /translation="MFQKKTYAVFLILLLMMFTAACSGSKTSAEKKESETEKSSDIAQV
FT                   KIKDVSYTLPSKYDKSTSDDQLVLKVNVAVKNTGKDPLNVDSMDFTLYQGDTKMSDTDP
FT                   EDYSEKLQGSTINADKSVEGNLFFVVDKGKQYELNYTPESYGDKKPKSVTFKIDGKDKK
FT                   ILATADKLQDSAKALSAYVDVLLFGKDNADFEKITGANKNEIVNDFNESAKDGYLSASG
FT                   LSSTYADSKALDNIVNGIKEGLSKNSSIQAKTTSISKDEAIVEATVKPVDASSLSDRIE
FT                   DKVKDYYSKNSSASYEEAVKYALQVYPEEFKKLGPASSEKTVEVKMKKNDIDQWQLDMD
FT                   DYRAAELVEAFIKE"
FT   CDS_pept        13919..15337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycdB"
FT                   /product="YcdB"
FT                   /note="similar to YcdC"
FT                   /db_xref="InterPro:IPR032599"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34621"
FT                   /protein_id="BAA22240.1"
FT                   /translation="MKGAAFVKKEGLKQKALEIGRVPTHLKLEIEDYGGDDKRAHFCWA
FT                   DPQDENTGIIVELGPDGELESLSRDIEPESGERLSEEKLEDIMRQFVETHHPGALSAFV
FT                   REENDRAYGDKVRFSYVQMEAGLPLPMSGFMADVSLSGEIVYFRYYGEAGSIIKPKRVA
FT                   DVEEALAFIKKDVEFDLLFEVLHRSVYKNGDDQPHLVYEPEGRAITVPADLVQEEQAVD
FT                   DDDDYREPESFPLPLFEGIREKADPDSMIGIENGFVKEREADLGDGRIGIVWRNPDDPV
FT                   YQPADKSMDSWFKGRTHQVLKTIYNKETGKLEGVMSFMEKKGPLTVTLAECEKIALRFL
FT                   FALFPNADQYFRIRYDEKDEEENAVAGFTFEAHCHGVPLRFGQIRICVSRQTGYITVYM
FT                   GPDIDPNKLATIDPVPAISVEQAKSIFWQHFKVELGWEREYGDDEEHSYRLVYKPVYPH
FT                   FIDAHTGEPVFSIW"
FT   CDS_pept        15524..16885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycdC"
FT                   /product="YcdC"
FT                   /note="similar to YcdB"
FT                   /db_xref="InterPro:IPR032599"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34772"
FT                   /protein_id="BAA22241.1"
FT                   /translation="MVNKQLKKKAQEIGNVPTHYELEIEDYDQKQKKYGQAYFIWKDPK
FT                   DPEKHITVELRNDGALLTFSTTVHSETDKKLPDAELKLTALQFAAANHPGTFMNFHFQG
FT                   KEERGQHIRFVYTKMELGLPIPNSGFLIDMTRSGQIVHFLYYGEGHKAEVPTEFVAKEK
FT                   VVSHYLNTMSFELMYDVIDGEQEPRLVYEPILPGYSYPADVDEIVPDQHIADERIENTA
FT                   PLPPLQNKEEVDIFALLGFTSDMQKVSERDFGEQIGSTWRRGAAPERKDLSIGSYFETR
FT                   NKNTIKMKTDKRTGKLKAALSFMDWRNNLQCSTEECQEIALQFLYALYPRAAEFFRVNP
FT                   VRIDERGRVRNHFSVWYKGVPLRFGAARIIVNPETGLIDAFMAPDIEPEQLEAINHRPD
FT                   VSAEEAKEAFLAAFDVKLEWQPDFTAGSDQHCKLVYKPVYPSYIDAHIRKKKRL"
FT   CDS_pept        complement(16893..17396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycdD"
FT                   /product="YcdD"
FT                   /note="homologue of ply gene product (phage lysin) of
FT                   bacteriophage A500"
FT                   /db_xref="GOA:O34360"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR039561"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34360"
FT                   /protein_id="BAA22242.1"
FT                   /translation="MNLPAKTFVILCILFLLDLCFSYIRHEWHSQNALQDMPVPSDLHP
FT                   IVKQNADALKAAAANKGIDVVITEGFRSFKEQDELYKQGRTKKGNIVTYARGGESYHNY
FT                   GLAIDFALQKKDGSIIWDMEYDGNQNGKSDWLEVVEIAKTLGFEWGGDWKRFKDYPHLE
FT                   MIPN"
FT   CDS_pept        17519..18640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rapJ"
FT                   /product="RapJ"
FT                   /note="a member protein of the response-regulator aspartate
FT                   phosphatase family"
FT                   /note="putative; ycdE gene"
FT                   /db_xref="GOA:O34327"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR040702"
FT                   /db_xref="PDB:4GYO"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34327"
FT                   /protein_id="BAA22243.1"
FT                   /translation="MRAKIPSEEVAVKLNEWYKLIRAFEADQAEALKQEIEYDLEDMEE
FT                   NQDLLLYFSLMEFRHRIMLDKLMPVKDSDTKPPFSDMLNEIESNQQKLTGLLEYYFYYF
FT                   RGMYEFKQKNFILAIDHYKHAEEKLEYVEDEIEKAEFLFKVAEVYYHIKQTYFSMNYAS
FT                   QALDIYTKYELYGRRRVQCEFIIAGNLTDVYHHEKALTHLCSALEHARQLEEAYMIAAA
FT                   YYNVGHCKYSLGDYKEAEGYFKTAAAIFEEHNFQQAVQAVFSLTHIYCKEGKYDKAVEA
FT                   YDRGIKSAAEWEDDMYLTKFRLIHELYLGSGDLNVLTECFDLLESRQLLADAEDLLHDT
FT                   AERFNQLEHYESAAFFYRRLMNIKKKLAEQRFQ"
FT   CDS_pept        18747..19523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycdF"
FT                   /product="YcdF"
FT                   /note="homologue of glucose-1-dehydrogenase of Bacillus
FT                   subtilis"
FT                   /db_xref="GOA:P80869"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P80869"
FT                   /protein_id="BAA22244.1"
FT                   /translation="MYKDLTGKTAIVTGSSKGIGKAIAERFGKEKMNVVVNYHSDPSGA
FT                   DETLEIIKQNGGKAVSVEADVSKEEGIQALLDTALEHFGTLDVMVNNSGFNGVEAMPHE
FT                   MSLEDWQRVIDVNVTGTFLGAKAALNHMMKNNIKGNVLNISSVHQQIPRPVNVQYSTSK
FT                   GGIKMMTETLALNYADKGIRVNAIAPGTIATESNVDTKKEESRQKQLKKIPMKAFGKPE
FT                   EVAAAAAWLVSEEASYVTGATLFVDGGMTLYPSQLE"
FT   CDS_pept        19548..21233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycdG"
FT                   /product="YcdG"
FT                   /note="glcA gene"
FT                   /note="probable alpha-glucosidase"
FT                   /db_xref="GOA:O34364"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34364"
FT                   /protein_id="BAA22245.1"
FT                   /translation="MKTDWWKDAVVYQIYPRSFQDSNGDGIGDLRGIISRLDYIKELGA
FT                   DVIWICPIYPSPNVDYGYDVTNHKAIMDSYGTMDDFHELLDQVHQRGLKLVMDFVLNHT
FT                   SVEHPWFKEAELDKNSKYRSYYYWRPGTKNGPPTDWLSNYGCPVWQYEEHTGEYYLHMN
FT                   AVKQADLNWENPEVRQAVYDMMKFWLDKGVDGLRIDQLHLISKKEYLPSYEDYINQQAE
FT                   PKPFQPNGERIHDYLKEITDEVFSHYDVMSVGEVGSVTPEEGLKYTGTDKHELNMIFHF
FT                   QHMELDQQPGKEHWDLKPLELSDLKSVLTKWQKKLEHQGWNTLFWCNHDQPRIVSRFGD
FT                   DGEYRKASAKMLAAVIYFMKGTPYIYQGEEIGMTNAPFTRIEDYKDIQTINMYHKRVFE
FT                   KGYDPNDVMRSILAKSRDHARTPMQWNSGKNAGFTDGTPWLKVNPNFTAINVEEAQGDP
FT                   DSVLNYYKKLISLRKQYADLMKGSFDLLLPDDPQLFVYMRENSKQQLLSVNNFSKEQAV
FT                   FQWPKNCGKAQASLLLSNYNNDDLDDEMVFRPYESRVYLLDKTN"
FT   CDS_pept        21421..22380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycdH"
FT                   /product="YcdH"
FT                   /note="homologue of adhesion protein precursor of
FT                   Streptococcus pneumonia"
FT                   /db_xref="GOA:O34966"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="PDB:2O1E"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34966"
FT                   /protein_id="BAA22246.1"
FT                   /translation="MFKKWSGLFVIAACFLLVAACGNSSTKGSADSKGDKLHVVTTFYP
FT                   MYEFTKQIVKDKGDVDLLIPSSVEPHDWEPTPKDIANIQDADLFVYNSEYMETWVPSAE
FT                   KSMGQGHAVFVNASKGIDLMEGSEEEHEEHDHGEHEHSHAMDPHVWLSPVLAQKEVKNI
FT                   TAQIVKQDPDNKEYYEKNSKEYIAKLQDLDKLYRTTAKKAEKKEFITQHTAFGYLAKEY
FT                   GLKQVPIAGLSPDQEPSAASLAKLKTYAKEHNVKVIYFEEIASSKVADTLASEIGAKTE
FT                   VLNTLEGLSKEEQDKGLGYIDIMKQNLDALKDSLLVKS"
FT   CDS_pept        22436..23131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycdI"
FT                   /product="YcdI"
FT                   /note="homologue of Streptococcus parasanguis adhesion
FT                   protein (FimA)"
FT                   /db_xref="GOA:O34946"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34946"
FT                   /protein_id="BAA22247.1"
FT                   /translation="MNLVSLKDIVFGYSHTPVLDKVSLDIESGEFVGITGPNGASKSTL
FT                   IKVMLGMLKPWEGTVTISKRNTEGKRLTIGYVPQQISSFNAGFPSTVLELVQSGRYTKG
FT                   KWFKRLNEEDHLEVEKALKMVEMWDLRHRKIGDLSGGQKQKICIARMLASNPDLLMLDE
FT                   PTTAVDYDSRKGFYEFMHHLVKNHNRTVVMVTHEQNEVQQFLDKVIRLERGEKGGWKCL
FT                   TWNSCDELF"
FT   CDS_pept        23089..23931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceA"
FT                   /product="YceA"
FT                   /note="homologue of a hypothetical 32.8 kDa protein in
FT                   YCF23 - APCF intergenic regio of Cyanophora paradoxa"
FT                   /db_xref="GOA:O34610"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34610"
FT                   /protein_id="BAA22248.1"
FT                   /translation="MEMFDLEFMRRAFLAGGMIAVMAPILGVYLVLRRQALMADTLSHI
FT                   SLSGVAIGFFLSTNITAASIVVVTIGAIGIEYMRRAYRTYSEVSIAILMAAGLSFAMFL
FT                   ISLSKGTANMSIDQYLFGSLVTVNQQQVYIISIITLLILLYFIVLRRPLYLLTFDEATA
FT                   KTSGINTNVLSLSFSIVTGLAISVIIPIIGVLLVSALLVLPAAFAIRIAKGFNMVFITA
FT                   ILISLFSVFTGLTSSYQLGTPPGPSITLLLIVLLLIGFAVQGVWTFIKKEAQRKKRSR"
FT   CDS_pept        complement(23969..24910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceB"
FT                   /product="YceB"
FT                   /note="homologue of a hypothetical 36.6 kDa protein in qoxD
FT                   - vpr region of Bacillus subtilis"
FT                   /db_xref="GOA:O34504"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34504"
FT                   /protein_id="BAA22249.1"
FT                   /translation="MTTLQHSVELAQLSEQWGYKRYWFAEHHSTKGLASTAPEIMIARI
FT                   AAQTNTIRVGSGGVLLPQYSPFKVAETFRQLEALYPNRIDLGVGRSPGGTTKTRLALTD
FT                   GVKKSLTEFNRQLQDVSYFLTDSLPPDHPYAGIKAAPLIGTAPELWVLGLGENSARRAA
FT                   HQGIGYVFGHFINPERGENAFRIYRESFRPSAHFSNPSALFTIFVICAKTDEEAEELAL
FT                   SQDLWLLRVGKGLDSRVPSIEEAKAHPYTASDKKLIEENRKRMVIGSPTTVKQQLLDLT
FT                   GCYETNEIMVLCNVFDFEAKKESYERLAELFL"
FT   CDS_pept        25248..25847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceC"
FT                   /product="YceC"
FT                   /note="probable tellurite-resistance relating protein;
FT                   homologue of tellurite-resistance protein (TerZ) of plasmid
FT                   R478 form Serratia marcescens"
FT                   /db_xref="GOA:P81100"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/Swiss-Prot:P81100"
FT                   /protein_id="BAA22250.1"
FT                   /translation="MAISLEKGQRIDLTKGKAGLSKLMVGLGWDPVSSGGGFFSKLLGG
FT                   GGPNIDCDASVLMLENGKFTDKKNLIYFGNLKSRCGGVQHTGDNLTGDGAGDDEQIMID
FT                   LDKVPGNIDKLVFVVNIYDCVRRKQDFGMIQNAFIRVVDQSNHEEMLKYNLRDNYAGRT
FT                   SLITAEIYRSGSEWKFAAVGEGTNDTRLEDIISRYV"
FT   CDS_pept        25869..26450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceD"
FT                   /product="YceD"
FT                   /note="probable tellurite-resistance relating protein;
FT                   homologue of tellurite-resistance protein (TerD) of plasmid
FT                   R478"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/Swiss-Prot:P80875"
FT                   /protein_id="BAA22251.1"
FT                   /translation="MTISLAKGQKVDLTKTNPGLSKVVVGLGWDTNKYDGGHDFDLDSS
FT                   VFLLDAAGKCASPNDFIFYNQLEGGNGSVVHSGDNLTGAGEGDDENVKVNLSAVPANID
FT                   KISFVITIHDAEARSQNFGQVSNAFVRIVNEETNEELIRYDLAEDFSIETAIIAGELYR
FT                   HNGEWKFSAIGSGYQGGLARIATDYGLQVG"
FT   CDS_pept        26485..27063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceE"
FT                   /product="YceE"
FT                   /note="probable tellurite-resistance relating protein;
FT                   homologue of tellurite-resistance protein (TerE) of plasmid
FT                   R478"
FT                   /db_xref="InterPro:IPR003325"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34384"
FT                   /protein_id="BAA22252.1"
FT                   /translation="MAIQLSKGQRIDLTKTNPGLTKAVIGLGWDTNKYSGGHDFDLDAS
FT                   AFLVDAHDNCVNDLDFVFYNNLEHPSGGVIHTGDNRTGEGDGDDEQIIVDFSKIPAHIE
FT                   KIGITVTIHDAEARSQNFGQVSNAFVRVVDEETQNELLRFDLGEDFSIETAVVVCELYR
FT                   HGGEWKFNAIGSGFSGGLAALCRNYGLQV"
FT   CDS_pept        27114..27887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceF"
FT                   /product="YceF"
FT                   /note="probable tellurite-resistance relating protein;
FT                   homologue of tellurite-resistance protein (TerC) of plasmid
FT                   R478"
FT                   /db_xref="GOA:O34447"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022493"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34447"
FT                   /protein_id="BAA22253.1"
FT                   /translation="MDFLHHILSTYASFFDWKMWGEVLTDPVSWGLIGSLVVLEGLLSA
FT                   DNALVLAVMVKHLPEKQRKKALTYGLFGAYIFRFIFIGLGMLLIKFWWIKVLGALYLAW
FT                   LVIKHFWIGEKEEEADGMKKNSWMVRTFGIFWATVISVELMDLAFSVDSILAAFAVSEK
FT                   VWVLLIGGMLGILMMRTVAKVFLVLIDKIPELENTAFVLIGIIALKMAGSAFHYEMPHS
FT                   VFFIIIIAAFAVTLIIHYINKQKQVREQTAASKEE"
FT   CDS_pept        27972..29585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceG"
FT                   /product="YceG"
FT                   /note="probable tellurite-resistance relating protein
FT                   (function unknown)."
FT                   /db_xref="InterPro:IPR025647"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34809"
FT                   /protein_id="BAA22254.1"
FT                   /translation="MRQEELTIHKALPADGDWKSLLFQPLPERDHYETAQGLSFSRLAG
FT                   QILGTPIDETDYYNELYELSVNDRITILSETLDKTIEPETFQKLQHIHSINQKEKGLSV
FT                   SRFVAFLDGEKLIAKHSNPLMHRHLRKALMTLLHTFADSHEKGLNHPDFRRVLLDVSKF
FT                   SLNHLNPWLEKTDIEREMPKVVWYGDATKSQLYFLYYLMLVGCDVLLFHPAGTDQLALV
FT                   DPKQELGFTEKLPDVSELQPFPKEKPDRKSTVAYRSTKEIEHVLNHEESMLYKPWQFRD
FT                   HTPVSVTLKTTYDELFLITKERAFIRPNFKADKHSIEIPNVFAKIMGVSKDNKEYWNRL
FT                   HTLADYQETEMVRSFPFTEEIKSNYQFHYSHALDQEGNIDPDKLMASNVWQYKQLPAGV
FT                   QTAIAKTISRMCRYPRLKALHQEQVKDVQIYLFKQTTNLPANLLKLIQMFDYAQTVPKL
FT                   VLYHTEMSGGLTRSDAAALLFLNEIGIDIIIYNPPGHQDIEQFIEEDQYDIHWLDDMVF
FT                   QQDYKEPSLVKRLFRTITQK"
FT   CDS_pept        29601..30692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceH"
FT                   /product="YceH"
FT                   /note="probable tellurite-resistance relating protein;
FT                   homologue of a hypothetical 43.8 kDa protein in xpaC - abrB
FT                   intergenic region of Bacillus subtilis"
FT                   /db_xref="InterPro:IPR008863"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34833"
FT                   /protein_id="BAA22255.1"
FT                   /translation="MTTENQNPLVLDKNEEISQQKADDIRLQLRQEPEVKRLAQQIDVK
FT                   NQMELLEYGKEPAVEISKFSDRILGMMKTTSVTDSGTMLTQLGKIMDRFDKNDFDEPKG
FT                   LMAKIFKRGGSMIEKIFKKYQTLGGEIEKIHVEISKYKDEMTKTNYTLDEMYENNIKYY
FT                   MELEKYVVAGQMKLEEMQSILPSYEEKAASGNQLAQMQLDTLRNGIQALEERVYDLDMA
FT                   RMVALQTAPQIRLLQRGNAKLIGKINSAFIITIPIFKNGIIQAVTVKRQKLVADSMSEL
FT                   DRRTNEMLKRNAENISSQSVEIARMAGRPSIDIETIESSWNTIVSGMQETKQIEEENKR
FT                   LREDGARRIAQLQDNIKKAALQQ"
FT   CDS_pept        30814..32016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceI"
FT                   /product="YceI"
FT                   /note="probable tellurite-resistance relating protein;
FT                   homologue of transmembrane transporter SV2 of Discopyge
FT                   ommata"
FT                   /db_xref="GOA:O34691"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34691"
FT                   /protein_id="BAA22256.1"
FT                   /translation="MGKQQPISQRKLLGVAGLGWLFDAMDVGILSFIIAALHVEWNLSP
FT                   EEMKWIGSVNSIGMAAGAFLFGLLADRIGRKKVFIITLLCFSIGSGISAFVTSLSAFLI
FT                   LRFVIGMGLGGELPVASTLVSEAVVPEKRGRVIVLLESFWAVGWLAAALISYFVIPSFG
FT                   WQAALLLTALTAFYALYLRTSLPDSPKYESLSAKKRSMWENVKSVWARQYIRPTVMLSI
FT                   VWFCVVFSYYGMFLWLPSVMLLKGFSMIQSFEYVLLMTLAQLPGYFSAAWLIEKAGRKW
FT                   ILVVYLIGTAGSAYFFGTADSLSLLLTAGVLLSFFNLGAWGVLYAYTPEQYPTAIRATG
FT                   SGTTAAFGRIGGIFGPLLVGTLAARHISFSVIFSIFCIAILLAVACILIMGKETKQTEL
FT                   E"
FT   CDS_pept        complement(32269..33441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceJ"
FT                   /product="YceJ"
FT                   /note="homologue of multidrug-resistance protein Bmr of
FT                   Bacillus subtilis"
FT                   /db_xref="GOA:O34724"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34724"
FT                   /protein_id="BAA22257.1"
FT                   /translation="MNRIWLFFSVMFVIGTDTFLLSPLLPLLQDQFHVSTDLSGWMVSA
FT                   YALGYALFAFIAGPISDRLNRKTVMLWGLAGFIVSTFLCGIAPSFAAMCLFRFAAGVSA
FT                   AFVTPQIWASIPVIVQPSQIIKGMGIATAGLAASQMLGLPIGGFLASFTWHTPFFVLSA
FT                   CSLILLLILAAVMPGIRPSEPLARPSIVNPYRELFSLPKTSVILLAYFLFQTGNFASFS
FT                   FLGTWLSADYHLTVSQIGAAMLVLGLGNMLGSLIGSRVSEKLGMFKTLISGMLLMGALY
FT                   FALPFFPNLFLVEAGFFLTFFTAGIIFPLMMGVFQSIAPNARGTIASLSNAAMYAGTTV
FT                   GTSIAGFLYQSTQHFGAVTGFTAILFILSMTLYQTISKTGKRQSTARAQL"
FT   CDS_pept        complement(33510..33812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yceK"
FT                   /product="YceK"
FT                   /db_xref="GOA:O34464"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34464"
FT                   /protein_id="BAA22258.1"
FT                   /translation="MYYSFMTMKQSDDQIRAQIFKALSDESRLAIIRTLYVSGKELSCG
FT                   EVGEKCNIVKTTASYHFKTLREAGLTATRKDSRTKYVSLREDTFQTYLPGFLETL"
XX
SQ   Sequence 35000 BP; 10249 A; 7335 C; 8415 G; 9001 T; 0 other;
     gtaaggaata tgaataaaac cgccgcgaat gtgtggggat gtccggctaa tgtgatccat        60
     taacccgtag aacaaatagt tgcatacaaa ggtccccgct gtgtaggaaa ccgcagctgg       120
     aatgccgtgt tccttcatct tagcagtcat tcgtttcacg ggaagccttg tccagtaagc       180
     ggcgggccca tctggagaaa tctcttcatc aatcggctga tgtccttcgt tatcggggat       240
     tcgcgcatct gcaaggttga ttgccactcg ttccggtgta atctgcatcc gtcctcctgc       300
     ttggccgaca caaattacga tatctggctg atgtttttga atggcttggc gcagagtgtc       360
     cagagcggat ctaaagacgg ttggaatttg ttccgctgta ataatggctt cttctgtctc       420
     gaagccatta agccgtttcg ccgcttccca tgatggattg acggtttctt tgtcaaaagg       480
     gtcaaagcct gtgatcagca ctttttttct catactccca tctccttttt cttttattct       540
     attgtttatt tatgggtttt tcatcaaaat aatgtaaagg agtgaatcat aatggagcat       600
     ttgccggagc agtatcgcca gttattccca accttgcaga cgcatacgat gcttgccagc       660
     tgttctcaga gcgcattggc agagcctgta tcaagggcga tccaggatta ttatgatagc       720
     ctgctgtata aagggacgaa ctggaaagaa gcgattgaaa aaacagagtt tgcgagaaac       780
     gagtttgcaa agctgatcgg ggctgaaccg gatgaagtgg cgattgtgcc gtcagtttct       840
     gatgcactgg tttctgtagc atcgtactta actgcatttg gaaagaagca cgttgtatat       900
     acagatatgg attttccggc ggtgcctcat gtttggcagg cacactccga ttataccgta       960
     tccgtcattc catcaataga cggcgtgctg ccgcttgaac aatatgaaac gcatatttcg      1020
     gatgaaacag tactgacgtg tgttcctcac gttcattatc gtgacggcta tgttcaggat      1080
     ataaaagcga ttgccgagat ttctcagaga aagggctctt tattgtttgt agatgcttat      1140
     caatcagccg ggcatattcc cattgatgtg aaggaatggg gcgtagatat gctggcagca      1200
     ggcacccgga agtatttgct cggcataccg ggtgtggcgt ttctttatgt gagaaaggag      1260
     ctggctgacg cactgaagcc gaaagcatca gcttggttcg gaagagagag cggatttgat      1320
     ggggcttatg caaaagtcgc gcgccgtttt caaacgggca ccccagcttt tatcagcgta      1380
     tacgcagctg cagcggcttt atcgctgctg aatcatattg gggtttctca tatcagggat      1440
     catgtgaaaa cgatctgtgc cgatgcagtt caatatgccg ctgaaaaagg cctgcagctg      1500
     gcggcggcac aaggtgggat tcagccgggc atggttgcga tccgggatga gcgggcatcg      1560
     gaaacggcgg ggttgctgaa gaagaaaaaa gtgatttgcg cgccgcggga aaatgttatc      1620
     cgtctcgctc cccattttta taatacgaag gaggaaatgc ggcacgcgat tgatgaaatc      1680
     gcggcgaaaa cgatccacaa gtaaacatga aaaagcccct gaacactagt caggggcttt      1740
     tcatattaat gatctacttt aacgcgtttc ataaagaaag cgccaattaa accgataatg      1800
     gcaacaatca ttgcaaacac aaatgcgtgc tgtacgcctg ctgtcaaagc ttgcgggatg      1860
     actgccggat cggcagggtt tttaactgta ctcatataat catgctggcc tgcagccata      1920
     atgctgaccg caaccgctgt tccgatagcg ccggccattt gctgcagcgt gttcataatg      1980
     gcggtgccgt ctggataaaa ttcacgcggc agttggttta aaccgtttgt ctgtgcaggc      2040
     atcatgatca tagaaatccc gatcatcaag caggtgtgca ggatgataat cagcacagct      2100
     gttgaagtgg tcgtgacatt tgagaagaac catagtacaa cggtgacaat cacaaatccc      2160
     ggaatgacaa gccatttcgg cccgtattta tcgaacaagc ggcctgtaac aggggacata      2220
     aatccattta aaataccgcc cggcaagaga acaagaccag atgcaaatgc agtgaggact      2280
     aagccgcctt gcagatacat cggcagaagc agcatagatg acagaatgac catcatacaa      2340
     atgaacacca tgatcacacc caaaataaac atcgggtatt tgaacgcacg gaggttcatc      2400
     ataggctgct tcattgtcag ctggcggatt gaaaataaga taaggccgac aacgccgaca      2460
     atcagcgaca cgataacagt cgggctggac catcccccgg agccttcacc cgcgttgctg      2520
     aatccgaata caatgccgcc gaagccaatc gtcgacagga tgatagacaa tacatcgatt      2580
     ttcggctttg tcgtttcaga tacattttgc atatatgcga taccgaaaac aagcgccagc      2640
     acaaggaatg gaagagagat ccagaaaatc cagtgccagt tgagatgctc cagaaccaat      2700
     cctgagaaag ttgggccgat ggcgggcgcg aacataatga caagcccgat cgttcccatt      2760
     gcggcacccc gtttatgagg cgggaaaatc accaagattg tgttaaacat cagcggcagt      2820
     aaaagaccgg ttccaagtgc ctgaacgatc cttgccgcta ataaaaacga gaagctcggc      2880
     gcaagcgccg caatgaatgt acctaaaatt gaaaagataa gtgacacggt aaaaagctgt      2940
     cttgttgtga accactgcaa cagcagtcct gaaacaggaa caaggatacc gagtacaagc      3000
     aggtagcccg tcgttaacca ttggacggtt gccgctgtaa tgttcaattc cttcataagg      3060
     tcggttaacg caatattcag cgctgtttca ctgaacatgc cgataaaacc ggccaacagc      3120
     aaggaaatca taatcggcat cactttgtat tgctgagatg ctttagctgt tgtttccaaa      3180
     atcatttccc ctctctatca actgcatgta gtatgtcgtt ttttttatct cttcagcagg      3240
     tcaggaatgc agctggagat atgaaggagc ggcgtactgt tttttgccgt caaagataaa      3300
     aggatgccgc cttcaatcat cgcgttaacc acagtgctgg cttcttttgc acggctctcg      3360
     ctgcagccag tctgccgcag tttttcctca tacacagagg cccattcttt gtaggcttca      3420
     tgacaggctt cgcgcaacgg ttcgcttttc aatgacgtct cagccgctag caagcccaca      3480
     ggcaagcctt caatgtcttc cgtacatgaa aactggcagg agagctcctt caaaaaggct      3540
     tgaatgcctt ccgctggatc ggtgcaggct tccatgcagt ccgcgatttt ctgacggata      3600
     tactccttca tctcattcac ggcttcgatc gcaagctgtt ctttaccccc gggaaagtgg      3660
     tagtaaagag agcctttagg cgcgccgctt tcctttataa tctggttcag ccccgtgccg      3720
     taataccctt gcagctgaaa aagccgggta gctgccgaaa ggattttctc acgggaatct      3780
     ccataactca taacattccc accttactga attgcaatca aaaatatagt gactggtcta      3840
     ttatcttgat tcaatcatca attgtcaaga aaaattcatt gtatgaaaag acaaaaaaag      3900
     aaggatatga caacaaaaaa tactgagaga aaagctgact gatcttttga ctgaatagat      3960
     aaaatgtaca atgattaatc atcatatgga tgtaaggaga gaaatagatg aaaaaacaac      4020
     gaatgctcgt actttttacc gcactattgt ttgtttttac cggatgttca cattctcctg      4080
     aaacaaaaga atccccgaaa gaaaaagctc agacacaaaa agtctcttcg gcttctgcct      4140
     ctgaaaaaaa ggatctgcca aacattagaa ttttagcgac aggaggcacg atagctggtg      4200
     ccgatcaatc gaaaacctca acaactgaat ataaagcagg tgttgtcggc gttgaatcac      4260
     tgatcgaggc agttccagaa atgaaggaca ttgcaaacgt cagcggcgag cagattgtta      4320
     acgtcggcag cacaaatatt gataataaaa tattgctgaa gctggcgaaa cgcatcaacc      4380
     acttgctcgc ttcagatgat gtagacggaa tcgtcgtgac tcatggaaca gatacattgg      4440
     aggaaaccgc ttattttttg aatcttaccg tgaaaagtga taaaccggtt gttattgtcg      4500
     gttcgatgag accttccaca gccatcagcg ctgatgggcc ttctaacctg tacaatgcag      4560
     tgaaagtggc aggtgcccct gaggcaaaag ggaaagggac gcttgttgtt cttaacgacc      4620
     ggattgcctc agcccgatat gtcaccaaaa caaacacaac tacaacagat acatttaaat      4680
     cagaagaaat gggcttcgtc ggaacaattg cagatgatat ctattttaat aatgagatta      4740
     cccgtaagca tacgaaggac acggatttct cggtttctaa tcttgatgag ctgccgcagg      4800
     ttgacattat ctatggatac caaaatgacg gaagctacct gtttgacgct gctgtaaaag      4860
     ccggagcaaa ggggattgta tttgccggtt ctgggaacgg gtctttatct gatgcagccg      4920
     aaaaaggggc ggacagcgca gtcaaaaaag gcgttacagt ggtgcgctct acccgcacgg      4980
     gaaatggtgt cgtcacacca aaccaagact atgcggaaaa ggacttgctg gcatcgaact      5040
     ctttaaaccc ccaaaaagca cggatgttgc tgatgcttgc gcttaccaaa acaaatgatc      5100
     ctcaaaaaat ccaagcttat ttcaatgagt attgaagaaa agaaggcgaa taagccttct      5160
     tttttttggc tttttaggac caataatgac ctctgaatct taaaatttct ttaaaaataa      5220
     gccaaaatta ccctttactt aattaatttg gtaacgtaat acaattggag aatttgttac      5280
     aaaaaaagga ggatattatg aaatttgtaa aaagaaggat cattgcactt gtaacaattt      5340
     tgatgctgtc tgttacatcg ctgtttgcgt tgcagccgtc agcaaaagcc gctgaacaca      5400
     atccagtcgt tatggttcac ggtattggag gggcatcatt caattttgcg ggaattaaga      5460
     gctatctcgt atctcagggc tggtcgcggg acaagctgta tgcagttgat ttttgggaca      5520
     agacaggcac aaattataac aatggaccgg tattatcacg atttgtgcaa aaggttttag      5580
     atgaaacggg tgcgaaaaaa gtggatattg tcgctcacag catggggggc gcgaacacac      5640
     tttactacat aaaaaatctg gacggcggaa ataaagttgc aaacgtcgtg acgcttggcg      5700
     gcgcgaaccg tttgacgaca ggcaaggcgc ttccgggaac agatccaaat caaaagattt      5760
     tatacacatc catttacagc agtgccgata tgattgtcat gaattactta tcaagattag      5820
     atggtgctag aaacgttcaa atccatggcg ttggacacat cggccttctg tacagcagcc      5880
     aagtcaacag cctgattaaa gaagggctga acggcggggg ccagaatacg aattaatgaa      5940
     aaacaaaacc ttgaagaatg ctattcttca aggttattct gctttcagca caatggtttt      6000
     cgcagccata tcatgaacgg tttgtttttt cttcgtaaat gcggcagtca aatagatcag      6060
     gcgggagaac acatgcaccc acgctatcag gtaacggaca atggcttgcg ggaaggatat      6120
     ttttttatat gtttcgtccc tcacgatttg cagcccgatg atttttttgc ccagtgtgcc      6180
     cttccaattt gtcagcggca tcagcaaagg gtacacaatc agcatcaata tggcgacaat      6240
     aatgacaccg gcggacccat cgccaaacgt aaatccggct gccaaaatca ctgctgcggc      6300
     aatgattaca tcaagtaaaa gagcgcaggc gcgcagcatg aaaccagcta gttccaatag      6360
     aaacactcct taaaatgtta aataaacacc taatgattgt aaaaaagaag ggcctaaagt      6420
     gggaataggt gataagcctt aaatcacaaa agttggtgaa aatgtcatag gtaaattggc      6480
     ataatcagcc agcttatcac attaccaaat tcttttttag cccgaaacca agccctcaga      6540
     agttattttt gttaaaatag aaaagttaca acagaattcg gagggtttat tgtgggaaaa      6600
     gtgaaacgaa atgccccttg cccatgcggc agcggcaaga aatataaaaa atgctgcgga      6660
     agtaaagttg tcgacttccc ggcggaacta gcggcaaaag aagcgaaaca aattcaggaa      6720
     gacttagtgg agtatgcctt cacagtacat agagaaagca tttcaggctt tatcaaccag      6780
     catgattttc tttctgctat ggacagacag acgaaagaca tcagcgtatt taacttagga      6840
     atctggggaa tcttcttcca cccgcttgct ggtgagaaga caatcttcga agagtacctt      6900
     cagaaaaaag gcgattcgat cactcgtccg aaaacgcgtg agatcgtaga atcatggcag      6960
     agcatgacgc ctgctttatt gctgctgaag gacctgaagg aaggcatcat tcactttgaa      7020
     gatgtcatta cggcaaaaca attcgaagtg gaaatggacg ccagcaatca agaccttcct      7080
     ccagtgggaa gcctgattct tggataccca atccacgaag cggaaaaagc agaattcttc      7140
     atgcagttca cgatcttccc ggtgaagaga acagaagcgc tgatcagcaa ggtgaagaaa      7200
     tatgcggatg ccgctgtgaa ggacggcaaa acgccggagg acttcatgaa gcaggaattc      7260
     aacaacgttc tgttcgcgtt gttagctgag aaagatgaag agccacaagc agagaaagcg      7320
     gaagtaagca ctgttgagtg ggcaaacgac ttggagaaag aaaccgctgc ggctattgaa      7380
     gaaggcatga gcggggaaga gtatccgact gaattgatcc cagctgttat tgacatctgg      7440
     aaaacattct gcgagaaaaa atcacctgtc atcagaaagc cggaagcttt tgcggcggca      7500
     gttgaatatt atgtaaacgc aatttctctt aacggcgcgt ccgtttccca ggctaaactg      7560
     gcgaaaaaat acggcgttag cgcatcaacg atttccagcc gttacaaaga aattgaaagc      7620
     acgctgcaag atgaagcaga tcgttttgca caagcgttat cctcataatg gaaaaaacct      7680
     tgaaaagcca ggcttttcaa ggttttttta tttctgaaac ggaattttga tttctaaccg      7740
     gaagatgggg tggcggtagg taaaatccag cctgccaaaa gcgcccttca ccagtttttg      7800
     aatgatatat gtgcccatgc cttcatgagc gccgtttttc gttgagcggc caaacgattg      7860
     ataaattgta tcgagcactt ttgggtccat cccgggagtg ctgttttcac aagtcagtac      7920
     ataaagcccg ctgcgcagtg aagtctccag tttaatctct gctttttctc gggcctccgc      7980
     cgcgctgtcg agcgcatttt ctaatatgtt gccgaccaag ctgacctgat cagcaggcga      8040
     aaacggaagg gaagaaagcg gtgtatgcat atgcagcgaa acactcacat tcgaggcgcg      8100
     ggctttttct aaaaaatcat aaagcacccc tgcaacgtac gcgttctctc ctttcaaaaa      8160
     acggtcatat tggctgtatt gatccgccca gttttgaata tatgcttgtg tatctgcctt      8220
     gggctgagct gatttgattg cagtgatatg tttcattgtg tcatgattcc ggcttctgac      8280
     atcaatcagc atttgattgg cgtgctgttc agcttgagtc agcttatcaa tttgatcaga      8340
     aagccttgcc tgcaaagcag actgtccgat acggagccct tcacaccctg caaatatcgc      8400
     gattacacat aataccggca tgatgtctgt gccaatcaac accactccca ccgacatcac      8460
     ttgaatcacc gcaatccacg cacaaagccc tgaggaacag tgtttccaca cccgcttcgt      8520
     attccaaatg tacaatcctg cagcagctgc gcctaaagca gcggcgagcc aagaggcggc      8580
     tgtgctgtgt gaaaaagcag cagctccctg ataacatatg aaactaaata aaatcagata      8640
     aagacattga aaaagggtaa tcacgtacta aactcctcaa aaatagtagt tttgaaaata      8700
     atcaagctgc tgcttagtga tcatcgcttt tttagacgtt ccctcaaagg aaactgtgaa      8760
     tgaatgcttg gtataagcgg aaaaatgctt tatgtaatga atgttgataa taaaggaacg      8820
     atgcgaacga agaaaatctt tttcgggcag gtcgccttta atatcattta atgtttgata      8880
     cgtttgcacc tcttcggcgg ttgtcacaat cgtcgtcgaa cgtcccgtcc gttctgcgaa      8940
     aataatatcc ttcttttgca ggacgtgcat ttcagacttt tgctttatca atatacgccc      9000
     attcaaactc gtttccgttt tctttttcaa gtaccggtcg aaggaagcgg ccagacggtc      9060
     ggcatagtac ggcttcataa tataatcatg gacgttcagg tcaaaggcgt gaaccgcata      9120
     accgccgtgg ccggtaacaa aaatcacatc cacatcaagt gaatgggatt tgatcaaatc      9180
     agcaagctcg tagccagaca tatggggcat ctcgatatcg gcaagcagca gatcaatgtc      9240
     tccgttcttt acccgcctgt aggcttcctt cgctgaatcg gtggaaaaga caatttcgac      9300
     gtcctgcatt ctggacacga tcgcttctaa cttctctaaa tctactcgat aatcatctac      9360
     aagtccgact tttaccatta tcattcccct agttacatag aatcatcttt attctatccc      9420
     atttcacgac ataaaaagaa ctcttcgcga caactttatc caactaatcc agcttttcgt      9480
     atatagtcat tactagaaat aaagataagg gagattgtga catgattaca ctgaccgatt      9540
     gcagccgcag gtttcaggat aagaaaaaag tagtcaaagc ggtgcgagat gtaagcttaa      9600
     caattgaaaa aggagaagtc gtcggcattc tcggagaaaa cggtgccggc aaaacgacga      9660
     tgctgagaat gattgcttcc ttgcttgaac catcacaggg tgtaatcaca gtagacggct      9720
     ttgacacggt caagcagccg gctgaggtca aacaaagaat cggtgtctta ttcggaggag      9780
     aaaccgggct ttacgacagg atgaccgcta aagaaaatct ccaatacttc ggcaggctgt      9840
     atgggctgaa ccgccacgag atcaaagcaa gaatagaaga tttatcgaaa cggttcggca      9900
     tgcgcgatta tatgaaccgg agagtgggcg ggttttcgaa aggcatgagg cagaaagtcg      9960
     ccattgccag agcgctgatt cacgatccgg acatcatttt atttgatgag ccgacaactg     10020
     ggcttgatat tacgtcaagc aacatcttcc gcgaatttat acagcagctg aaaagagaac     10080
     aaaaaacgat tcttttctcc agccacatta tggaggaagt gcaggcgctc tgtgacagtg     10140
     tcatcatgat tcacagcgga gaggtgattt accgaggggc gcttgaatca ctatacgaga     10200
     gcgagcgcag tgaggatttg aattacatct ttatgtctaa gcttgtcagg gggatttctt     10260
     aaatgctgag ccatatttat aaaaaagaaa tgatcgacgc tttacgcgac agaaaaacga     10320
     tattactcac aatcttagtg ccgatgatta tgatgcttgg acttgtcttt ttttatgaaa     10380
     gcatgctgtc cgacaaaggg gagcagtaca cgctggctgt cgccattcgc ttccgcccgc     10440
     actgaaagca agcttaatga gattgacgaa atcagcgtaa aaacattgca aagcctgaag     10500
     aggcagttga gaaggaaaag cagatgccta tctgaacgtc ccgaaagagt tcgactcata     10560
     tgtcaacagc atgacacctt ttaaggttga tgtttacggc aattcaatcg atcaagggtc     10620
     gtcaaatgcc atgcagcttg tgcagtctgc cttagatcag tacaaaaatg aaattgtgca     10680
     gcaacgttta acaaataagc atattgatca atcggtgatc cagccgttta caattcagca     10740
     aaaggaagcg gatgaggaga aagggacttc cgctattatg ctttccgcca ttctgcccat     10800
     gctgattctg acttccattg tttccggcgc aatgccgatc gctcttgata tcatggccgg     10860
     tgaaaaggac cgaaagtcaa tcgaggcgct gctattaacg ccagtcagca gaaacaaagt     10920
     gctggtcggc aagtggcttg cggtttccac ttttggcgtg gcttcaggtg tatttgcttt     10980
     ggtgtttttg attttgtcca ccgtgttatt taccgaaaat ttaaaaacgg ccttccagct     11040
     gggagatcat atgtggagtg taatcggcgc ttcagcctta atcattgtgc tctctgcatt     11100
     gctgatatct gcgatggagc ttttcatcag catcatgtcc agctcggtaa aagaagcgca     11160
     aagttatatg tctctcgtcg tctttctgcc tgtgttcccg atgtttttca tcttcagcaa     11220
     ggcaccgaac caatttgact tatcatactt tctcatcccg tttctgaacc tgcatgcgtt     11280
     atttaaacag cttttattcg ggatggttga cccggctacc attttgtcta cgtcaggaac     11340
     catcgccgtg ctcatcgcca tcttcttttt actagccaga gcctgcttcc tgaaagacaa     11400
     atgggttctt ccaaaataaa cttgcgaaag gagaaataca ctttctcctt tttgtatatc     11460
     ctgaaaaaag aaggaaaata gaaaaaggat atctaataca aaaagtgacc ctgcactatt     11520
     tttcatcaaa attggtttca aaggagaagg aacaatggat caaacacgta cactcggcaa     11580
     aacgaagctg aaggtgaagc ggatcggatt cggcgcgaat gcggtcggcg ggcataatct     11640
     atttccaaat ctaaatgatg aaacagggaa ggatttagtg cgcacggcat tggatggcgg     11700
     cgtcaatttt atcgataccg cctttatata tggattgggg cgatctgaag aattaatcgg     11760
     cgaagtcgta caggaacgcg gcgtgcggaa tgagctcatc atcgccacca aaggagctca     11820
     taaagaagtg gacggcagca ttgaattaga caatagccgg gagtttcttc gcagcgaggt     11880
     ggagaagagc ctgaagcggc tgaaaacaga ttacattgat ttgtattatg ttcactttcc     11940
     ggatggaaaa acacctctcg ctgaagtggc gggcactttg aaagagctga aggatgaggg     12000
     gaaaatcaaa gcgatcggcg cttcgaacct cgattatcag caattgcagg attttaatgc     12060
     tgacggctat ttggaggtct tccaggccga atattctctc atacagcgtg atgccgagaa     12120
     agagcttctt ccatactgtg aaaaacaagg catctccttt attccttact ttccgcttgc     12180
     gtccggactg ctgacaggaa aattcacgca agacacagtc tttgatgatt tcagaaagga     12240
     taaacctcaa tttcagggtg aaacgtttat ccacaatctc aaaaaagtag ataagctgaa     12300
     agcagtagcg gaggaaaaac aagcggatac ggcacatgtc gccttggcgt ggctgttaac     12360
     gagaccggcg attgatgcca ttattccagg agctaaacga ccggagcaat tacaggataa     12420
     cctgaaaacc ttgaacattg aactgaccga agatgaagtg aatttcatca gcgacatttt     12480
     caaataaaaa aggaaatagc cgtcatggct atttcctttt ggtgttttat tctttgatga     12540
     atgcttcgac taattctgct gctctgtaat catccatatc aagctgccat tggtcgatgt     12600
     catttttctt cattttcact tcaactgttt tttcagatga agcaggtcca agctttttga     12660
     attcctcagg atagacttga agcgcgtatt tcactgcctc ttcatagctg gcactagagt     12720
     ttttactgta gtagtctttc actttgtctt cgatgcggtc tgaaagagaa gatgcatcta     12780
     caggtttaac tgtggcttca acaattgctt cgtctttaga gattgaagtc gtttttgctt     12840
     gaatggaaga gtttttgctt aatccctctt taatgccgtt cacgatatta tcaagcgctt     12900
     tgctgtccgc atatgtgctg gaaaggccgg aagctgagag ataaccgtct ttggctgatt     12960
     cattaaaatc atttacaatt tcatttttgt tagcgccggt gattttttcg aaatcggcgt     13020
     tatctttgcc gaaaagaagg acatcaacat aagctgataa cgcttttgca gaatcttgga     13080
     gcttatctgc cgtcgccagg atttttttgt cttttccgtc aattttaaaa gtaactgatt     13140
     ttggcttttt atcaccgtaa gattccggcg tatagttaag ctcgtattgc ttgcctttat     13200
     ctacaacgaa gaaaagattt ccttcaacgg atttgtcagc gttaatcgtg ctgccctgaa     13260
     gcttttcgct atagtcttca gggtctgtgt cagacatttt ggtatcacct tgatacaatg     13320
     tgaaatccat actgtctaca ttcagcgggt cttttcctgt gtttttcacc gcgacattga     13380
     cttttaacac aagctggtca tctgaagtgg acttatcata tttagacgga agtgtgtaag     13440
     agacatcctt gattttgact tgagctatat ctgagctttt ttctgtttct gattctttct     13500
     tctccgcgct tgttttgctg ccggaacaag cagctgtaaa catcatcagc agaagaatta     13560
     ggaaaacagc gtacgttttt ttctgaaaca ttcatttttc ctcctcaaat ggtttaggaa     13620
     aggggagtct tttgtctttg agaaatggat ctttttgaat ggattagcat catataacca     13680
     aaaaaatcag ttcttttctc acggttttca ccggattttc tggaaactcc gccctccttt     13740
     gtcatgaatg gacctataaa aagttacaac ggaattaatt ttaagattat tagcttttat     13800
     attgaatagg ttcatcatcc tatttttggt gaaaaatgtt ctggtaaaac tggtaaactc     13860
     agaaaactgt gtattttaga ctattacttt ttgattagtt ggagggaact taagaaggat     13920
     gaaaggggcc gcctttgtga agaaagaggg actgaaacaa aaagcactgg aaatcggccg     13980
     ggtgccgaca cacttaaaac tggaaattga agattatggc ggtgatgata aaagagctca     14040
     tttttgttgg gcagatcctc aggatgagaa taccggcatt atcgtggagc ttggaccgga     14100
     cggagagctg gaatcccttt cccgtgatat tgagcctgaa agcggagaaa ggctgtctga     14160
     ggagaaacta gaggatatca tgcgccaatt tgtcgagact catcatccgg gggcactctc     14220
     tgcctttgtt cgtgaagaaa atgaccgtgc atacggcgat aaagtgagat tttcatatgt     14280
     tcaaatggag gctgggcttc ctctccccat gagcggattt atggctgatg tttccttatc     14340
     aggtgagatt gtttacttcc gttattacgg cgaagcgggc agcatcatca agccaaagcg     14400
     ggtcgcggat gttgaagagg cacttgcctt tatcaagaag gacgtggagt tcgacctttt     14460
     gtttgaggtt ctccatcgtt ctgtttacaa aaacggagat gatcagccgc atttggtgta     14520
     cgagcctgaa ggtagggcga ttaccgtacc tgcggatttg gttcaagaag aacaagcagt     14580
     tgatgatgac gatgattaca gggagccgga gagctttcct ctccctttat tcgagggcat     14640
     ccgcgaaaag gccgatcctg acagcatgat tggtattgaa aatgggtttg tcaaagagcg     14700
     ggaagcggat ttgggagatg ggagaattgg aatcgtttgg cggaatccgg atgaccctgt     14760
     gtatcagccg gcggataaaa gcatggacag ctggtttaag ggacggactc atcaagtgct     14820
     gaaaaccatc tataacaaag aaaccggaaa actcgaaggc gtcatgtcat ttatggagaa     14880
     aaaagggccg ctgacagtaa ccttggcaga gtgtgaaaaa atcgcgcttc gctttctatt     14940
     tgctttattt ccgaatgccg atcaatattt taggatcaga tacgacgaaa aagatgaaga     15000
     agaaaacgca gtcgctggtt ttacgtttga agcgcattgt cacggagttc cgctccgatt     15060
     tgggcagatc agaatttgtg tcagccgcca gacagggtat atcaccgttt atatgggacc     15120
     ggatattgac ccaaataagc tggcaaccat tgatcctgtg ccggctattt cagttgaaca     15180
     agccaagtct atcttttggc agcattttaa agttgagctt ggctgggaaa gagagtacgg     15240
     ggatgatgaa gaacacagct accggctcgt ctataagccg gtgtatccgc attttatcga     15300
     tgcacataca ggggagcctg tcttcagcat atggtgaaac agccaaaagt cacgcaattg     15360
     cctcagatat agaagagagt atgtgatgaa agtaacagaa agaatctcaa aaaacaatga     15420
     caataataga aaaggacctt tcttcacttt aaatgaagaa aggtcttttt atataataaa     15480
     caggattctc tttgtcgtag actctttgaa agggatgact tcattggtta ataaacagct     15540
     gaaaaagaag gcgcaggaga tcggaaatgt accgacgcat tatgagcttg agatagaaga     15600
     ttacgaccaa aagcaaaaga agtacgggca ggcatatttt atctggaagg accctaaaga     15660
     tccggaaaag cacattacag ttgaacttag aaatgacggc gccttgctca ccttttcaac     15720
     aactgtccac tccgagacag acaaaaaact tccagatgcc gagctgaagc tgacggctct     15780
     tcagtttgcc gctgccaatc atcccggcac atttatgaat tttcattttc aaggcaagga     15840
     agaaaggggg cagcacatcc ggtttgtcta taccaaaatg gagctggggc ttccgattcc     15900
     caattcaggc tttttaattg atatgacacg aagcggtcag attgtccact ttctatatta     15960
     cggggaaggg cataaagccg aagttccgac ggaatttgta gcaaaagaga aggttgtatc     16020
     ccattactta aacacaatgt cttttgagct gatgtacgat gtcattgatg gcgaacagga     16080
     accaaggctt gtatatgaac cgattctacc gggatacagc tatcccgcag atgtagacga     16140
     aattgtgccc gaccagcata tcgcagatga aagaatagaa aacacggcgc cactgccgcc     16200
     gcttcagaac aaggaagaag ttgatatatt tgccttgctg ggttttacct ctgatatgca     16260
     gaaagtcagt gaaagagact ttggagaaca aattggaagc acgtggcgca ggggcgctgc     16320
     gccggagcgt aaggatttaa gcataggaag ctattttgaa acgagaaata aaaatacaat     16380
     caaaatgaag acggataaaa gaaccggaaa attaaaagca gcgctttctt ttatggactg     16440
     gcggaacaac ctccaatgct ccacggaaga atgccaagag atagcgcttc aatttttgta     16500
     tgccctctat ccgagagcgg ctgagttttt cagggtgaat cccgtccgaa ttgatgaaag     16560
     agggagagtc cgcaaccatt tttctgtctg gtataaagga gtgccgctgc ggttcggcgc     16620
     tgcccgcatc attgtcaatc cggaaactgg gttgattgac gcttttatgg cgcctgatat     16680
     tgaacctgaa caattggaag cgataaatca caggccggat gtttccgctg aagaagcgaa     16740
     agaagcattt ttagccgctt ttgatgtgaa actggaatgg cagcctgatt ttacagcagg     16800
     cagtgaccag cactgcaaac ttgtctataa gccggtttac ccttcctata ttgatgcgca     16860
     cataaggaaa aagaaaaggc tgtgaggggt gtctagttag gaatcatctc caagtggggg     16920
     tagtccttga atcgtttcca atccccgccc cattcgaaac cgagtgtctt agcgatctcg     16980
     acaacctcca gccaatctga ttttccgttt tgattgccgt catattccat atcccatatg     17040
     atgctgccat cctttttttg aagggcgaaa tcaatcgcta aaccatagtt atgatacgat     17100
     tcccctcctc ttgcataggt gacaatattc cctttttttg tacgtccctg tttatataat     17160
     tcatcttgtt ccttaaagga cctgaatcct tcagtaatga cgacgtcaat gcctttattc     17220
     gctgcagcgg ctttgagtgc atcggcattc tgcttcacaa tcggatgaag atccgagggg     17280
     acaggcatgt cctgcaaggc gttttgagaa tgccattcat gccgaatata actaaaacaa     17340
     agatctagaa gaaatagaat acataagata acaaatgttt ttgcgggtaa gttcatatcg     17400
     gtctcacttt ctcaagatgt gctgaatgtt aacgctttta agtgattgac tctctctaaa     17460
     agcgaacagc tatgataaaa tataacataa atagtagcag gaggaaggag gcagaccgat     17520
     gagagcaaag attccatcag aagaagtagc agtaaagctg aatgaatggt acaagctcat     17580
     tcgcgcattt gaagcagatc aagcagaagc gttaaagcag gagattgaat atgatttaga     17640
     agatatggaa gagaatcagg acttgctttt atatttttct ttgatggaat tccggcatcg     17700
     aatcatgctt gataagctga tgccggtgaa agacagcgat accaagcctc cgttctctga     17760
     tatgctgaac gaaattgaaa gcaatcagca aaaactcacg ggcttactgg aatactactt     17820
     ttattatttc agaggaatgt acgaattcaa gcagaaaaat ttcatattag cgattgacca     17880
     ttataaacat gccgaggaaa agctcgagta tgtcgaggat gagatcgaaa aagctgagtt     17940
     tctttttaaa gtcgcagaag tgtattatca catcaaacaa acgtattttt ccatgaatta     18000
     tgcgagccag gcgcttgata tctatacgaa atatgaactg tacggtcgcc gccgggttca     18060
     gtgtgaattt atcatcgccg gaaatttgac cgatgtgtat catcatgaaa aagcactgac     18120
     ccacttgtgc agcgctttag aacatgccag gcagcttgaa gaagcgtaca tgatcgctgc     18180
     tgcctattat aatgtcggac actgtaagta cagtctgggt gattacaaag aagcggaggg     18240
     ctatttcaaa acagccgccg ccatttttga ggagcacaac tttcagcaag ctgttcaagc     18300
     tgtattttca ctgacccata tctactgtaa agagggaaaa tacgacaagg cagtagaggc     18360
     ttatgaccgc gggataaaga gcgcggctga atgggaggat gacatgtact tgacgaaatt     18420
     ccgcctcatt catgagctgt atcttggaag cggcgacctg aacgtgctta cagaatgctt     18480
     tgacctgctg gaatccaggc agcttcttgc tgacgccgaa gatctgctgc atgatacagc     18540
     ggaacgtttc aatcagttgg aacattacga gtccgccgct ttcttttacc gcaggctgat     18600
     gaatattaaa aagaagcttg ccgagcagcg ttttcaatag gaaatggcag agaactacag     18660
     gttctctgct ttttttgtgc tgttttcaac tcggaaaaac agggtatttt ccactgcata     18720
     gtgagaaaca gaggaggata tcaagtatgt acaaagattt aaccggaaaa acagcgattg     18780
     tgacagggtc ttcaaaagga atcgggaaag ccattgcgga acggttcgga aaggagaaaa     18840
     tgaatgttgt tgtaaattac cacagcgacc cgtctggagc agatgaaact ctggaaatca     18900
     ttaagcagaa cggagggaaa gccgtctcag ttgaggcgga cgtgtcaaaa gaagagggga     18960
     ttcaggcgct cttggacaca gctttagagc atttcggcac gctcgatgtg atggtaaaca     19020
     actccggttt taacggcgtt gaggcgatgc cgcatgagat gagtcttgaa gattggcaga     19080
     gagtgattga tgtcaatgtt accggaacct ttctgggagc gaaagcagca cttaaccaca     19140
     tgatgaaaaa caatatcaag ggcaatgtgc tgaatatctc aagtgttcat cagcagattc     19200
     cgcgccctgt aaacgttcag tattccacat ccaaaggcgg catcaagatg atgacggaaa     19260
     cgctggcgct caattatgcg gataagggaa tccgcgtcaa tgcgatagcg cccggcacca     19320
     ttgccacaga atcaaatgtt gatacgaaaa aggaagagag caggcaaaaa caattgaaaa     19380
     aaatcccgat gaaagccttc ggaaagcctg aagaagtggc ggcagcagca gcttggctcg     19440
     tatctgagga agcaagctat gtgaccggcg caacactttt cgtcgacggc ggaatgacac     19500
     tttatccatc tcagcttgaa tagaagacaa aacaggggga ttgcgggatg aaaacagact     19560
     ggtggaagga tgcagtggtg taccaaattt acccgagaag ctttcaggac agcaatggag     19620
     acggaattgg ggacttgcgg gggattattt cccgtcttga ctacataaag gagctcgggg     19680
     cagatgtgat ttggatttgc ccgatctatc cttctccgaa tgttgattac ggctatgatg     19740
     tgacaaacca taaggcgatt atggattctt acggaacaat ggacgatttt cacgagctgc     19800
     tggaccaggt gcatcagcgg ggattaaagc tggtgatgga ctttgtgtta aatcacacct     19860
     cggtcgagca tccgtggttt aaagaagcgg agctggacaa aaacagcaaa taccgtagct     19920
     attattattg gcgtcccggc acaaagaacg gcccgccgac ggactggctc tcaaactatg     19980
     gatgcccggt ctggcaatac gaagagcaca ccggagaata ctatctccat atgaatgccg     20040
     tcaaacaagc tgatttaaac tgggaaaatc ccgaagttcg ccaggcggtg tatgacatga     20100
     tgaaattttg gctcgataaa ggggtcgacg gtttgcgaat tgatcagctc catctcattt     20160
     ctaagaaaga atatcttcct tcgtatgagg actatatcaa tcagcaggca gagccgaagc     20220
     cctttcagcc aaatggcgaa cgaatccatg actatttaaa agaaatcaca gatgaagtgt     20280
     tttctcatta tgatgtcatg tctgtcggag aggtcggcag tgtcacaccg gaagaaggcc     20340
     tgaaatatac gggaacagat aagcatgagc tgaatatgat ttttcacttt cagcatatgg     20400
     agcttgatca gcagcccgga aaagaacatt gggatttgaa gccccttgag ctttctgatt     20460
     taaaatcggt tttgacaaaa tggcaaaaga agcttgaaca tcaaggctgg aatacattgt     20520
     tttggtgcaa ccacgaccag ccccggattg tgtccagatt cggagacgat ggggaatacc     20580
     gcaaagcatc agcgaaaatg ctggcagccg taatttattt tatgaagggc acgccgtata     20640
     tttatcaggg agaagaaatc gggatgacaa acgcgccgtt cacccggatt gaagactaca     20700
     aagatatcca aacgatcaat atgtatcata aacgggtgtt tgaaaaaggc tatgatccaa     20760
     atgatgtgat gagatcgatc ttagccaaaa gccgggatca cgcccggacc ccgatgcagt     20820
     ggaacagcgg caaaaatgcc ggatttactg acggcacgcc ttggctgaag gtcaatccga     20880
     acttcaccgc aatcaatgtg gaggaagcgc agggagatcc tgattctgtc ttaaactatt     20940
     acaaaaagct gatcagcctg agaaagcagt acgctgacct catgaaaggg agctttgatc     21000
     ttttgcttcc ggacgatccg cagttgtttg tatacatgag agaaaacagt aaacaacagc     21060
     ttttgtcggt caataatttt tcaaaagagc aggctgtttt tcagtggcct aagaactgcg     21120
     gcaaagctca ggcctcactg cttctcagca attataacaa cgatgatctt gatgacgaaa     21180
     tggtgttccg gccttatgag agcagggtct atcttctgga caaaacaaac taatgattga     21240
     agtagcccgg catttttagc cgggtttttt tagtacatat attcgctctg caggcgggaa     21300
     aaataaatga aaatgaaatt tattcttgca aaacgtaatg acttcggttt attatgatat     21360
     aggattacaa aatcgttatc attttgattt aaagttactg aaaaagaggg gatatacgat     21420
     atgtttaaaa aatggagcgg tttgtttgtg attgcagcgt gctttttatt agttgcagca     21480
     tgcggcaact catcaacaaa agggtcggcg gattcaaagg gtgataaact gcacgttgtc     21540
     acaacgttct acccgatgta tgaattcaca aaacaaattg taaaagacaa aggcgatgtg     21600
     gatctgttaa tcccatcttc cgttgaaccg catgattggg aaccgacgcc gaaagacatt     21660
     gccaacattc aggatgctga tttgttcgtt tataatagtg aatacatgga gacatgggtt     21720
     ccgtcagctg aaaaaagcat gggccaaggc catgccgttt tcgttaatgc aagcaaaggc     21780
     attgatttaa tggaaggctc tgaagaagaa cacgaagagc atgatcatgg ggagcatgag     21840
     cacagtcatg caatggaccc tcacgtatgg cttagccctg ttctggcaca gaaggaagtt     21900
     aaaaatatta cggctcaaat cgtgaagcag gacccggata acaaagaata ctatgagaaa     21960
     aatagtaaag aatatattgc aaaactgcag gatcttgata aactatatcg tacaaccgca     22020
     aaaaaagcgg agaaaaaaga atttatcacg cagcatacag cttttggcta tctggcaaaa     22080
     gaatacggct tgaagcaggt tccgattgca gggctttcac ctgaccaaga accgagcgca     22140
     gccagcttgg caaagctgaa aacatatgcc aaagaacata atgtaaaagt tatttacttt     22200
     gaagaaattg catcctcaaa ggtcgcagat acgctcgcca gtgaaatcgg cgcgaagaca     22260
     gaagtgctga atacactgga aggcttgagc aaagaagaac aggataaagg tttagggtat     22320
     atcgacatta tgaaacaaaa cctcgatgcc ctgaaagatt cactattggt taaatcataa     22380
     gatagtgtgc gccggagggg tgcacactat ttctttgtga gaaaggaaga ttaacatgaa     22440
     tctcgtctca ttgaaagata tcgttttcgg ctattcccat acgcctgttt tagataaagt     22500
     atcacttgat attgaaagcg gtgagttcgt cggcatcact ggaccaaacg gcgcctctaa     22560
     atcgacgctc ataaaggtaa tgctcggcat gctgaaaccg tgggaaggca cagtgacgat     22620
     cagtaaaagg aatacagaag ggaaacgcct gaccataggg tacgtcccgc agcaaatttc     22680
     ttcatttaat gccggatttc cgagcacggt gctggagctt gttcagtcag gccgctatac     22740
     aaaagggaaa tggtttaaac gtttaaatga agaagatcat cttgaagtag aaaaagcatt     22800
     gaaaatggtg gaaatgtggg acctccgcca tcgtaaaatc ggtgatttat caggcggaca     22860
     gaaacagaaa atctgtatcg ccagaatgct cgccagcaac ccggatctgc tgatgctgga     22920
     cgaaccgacg acagctgttg attacgacag cagaaaagga ttttacgaat ttatgcatca     22980
     tctcgtgaaa aatcacaacc gcacagttgt gatggttact cacgaacaaa acgaagtaca     23040
     gcaattttta gataaagtga ttcgattaga gagaggagaa aaaggcggat ggaaatgttt     23100
     gacttggaat tcatgcgacg agcttttcta gcaggcggca tgatcgccgt catggctccg     23160
     atactaggag tgtatctcgt tctcagaaga caggccttaa tggctgacac actttcacat     23220
     atctcattgt caggtgttgc catcggcttt tttctcagca ccaatataac cgcagcaagc     23280
     atagtcgtcg tgaccatcgg cgcgatcgga attgaataca tgcggcgggc gtatcggact     23340
     tattcagaag tgtccattgc catcttaatg gcagctggtt tgtccttcgc gatgttttta     23400
     atcagccttt ccaaaggcac agccaatatg agcatcgatc aatacctatt tggatcgctt     23460
     gtgacagtaa accagcagca ggtctatatt atcagtatta tcacactgct gatcctgctt     23520
     tattttattg tactgagaag gccgctctac ctgctgacgt ttgatgaagc tacagccaaa     23580
     acatcgggaa tcaatacaaa cgttctctcg ttgtcattca gtattgtcac aggccttgcg     23640
     atttcagtca ttattccgat catcggggtc cttcttgtat cggccctgct cgtattgccg     23700
     gcagccttcg ccatcagaat tgcaaaaggc tttaacatgg ttttcattac agccatactc     23760
     atttcattat tcagcgtatt tacgggactg acatcatcct atcagctcgg gacgccgcca     23820
     ggtccgtcta ttaccctgct attgatcgtt ttgctattaa tcggatttgc agttcaggga     23880
     gtttggacgt ttatcaaaaa agaagctcag cgcaaaaaaa gaagccgata acatgaaaag     23940
     cagttttccc tagggaaaac tgcttttttt atagaaacaa ttcggcaagg cgctcataag     24000
     attctttttt cgcctcaaaa tcaaacacat tgcacagaac catgatttca tttgtttcgt     24060
     agcagcctgt gaggtctaac agctgttgtt tgacagtggt gggagaaccg atcaccatcc     24120
     gctttctgtt ttcttctatg agttttttat cggacgctgt atagggatga gctttcgctt     24180
     cctcgatgct tggcacgcgg ctgtccaagc cttttccgac gcgaagaagc cacagatcct     24240
     ggcttaatgc gagttcttct gcctcttcat ctgtttttgc gcaaatgaca aaaatcgtaa     24300
     acagtgcgga tggattcgaa aaatgggctg agggccgaaa gctttcccgg tagatgcgga     24360
     atgcattttc tcctcgctcg ggattaatga aatgcccaaa tacatatcca atcccctggt     24420
     gcgccgcgcg tcttgcgctg ttttcaccaa gaccgagcac ccatagctcg ggtgccgtac     24480
     caataagggg cgccgctttg attccggcat acggatggtc gggaggaagg gaatctgtta     24540
     gaaaataaga gacatcctgc agctgtctgt taaattcggt taagcttttt ttcaccccgt     24600
     ccgttaatgc aagtctggtt tttgtcgtgc cgccggggga gcgaccgacg ccgaggtcaa     24660
     tccggtttgg atacagggcc tcaagctggc gaaaggtttc agccacttta aatgggctgt     24720
     attggggcag aagcacgccg cctgatccga cacgaatggt gtttgtctgt gctgcgatgc     24780
     gggcgatcat gatttcaggc gctgtgcttg ccagtccttt cgtgctgtga tgctcggcaa     24840
     accaataacg cttatagccc cactgttcgc ttaattgggc aagctcaacc gaatgctgga     24900
     gagttgtcac agggctttct cctttagaaa caggtgcctg atcaagtatg cttaaatgaa     24960
     tcaaaaggcc gcttcctttc tgtctgtttt tagatggtga caccagaata ggcaaaatga     25020
     cttgcccgcg tcaaatggtt tgtttaagaa gcgcacttta tagcatttgc aaatcatata     25080
     tcaaatatgg aagttttttt tcgaggtttt tcgtcaatta ttcttaactt ttacgaaact     25140
     ttgatataat aacaaacgta tatattagta atttacggct tattttcctt gtgagcgtaa     25200
     aaataaatgt gactatcttc acattttgat gagtaggagt gaatcgtgtg gcaatttctt     25260
     tagaaaaagg tcaacgaatt gatttaacaa aaggaaaagc cggtctgtca aaattgatgg     25320
     tcggtctcgg ctgggaccca gtgtcctcag gcggaggatt cttcagcaaa ctgcttggcg     25380
     gaggcggtcc gaatatcgac tgtgacgctt cagtgctgat gctggaaaac ggaaaattca     25440
     ccgataagaa aaacctgatt tatttcggca acctgaaaag ccgctgcggc ggtgtacagc     25500
     atacaggcga caacctgacg ggtgacggtg cgggcgatga cgagcaaatt atgatagatt     25560
     tagataaagt gcctggaaac atcgataagc ttgtatttgt agtgaacatt tacgattgtg     25620
     tcagaagaaa acaagatttc ggcatgattc aaaatgcgtt tatccgcgta gttgatcaat     25680
     ctaatcacga ggaaatgctc aagtacaatt tgagagacaa ttacgccggc agaacaagcc     25740
     tgattacagc agaaatctac cgcagcggca gtgagtggaa gtttgcggcg gtcggtgaag     25800
     gcacaaacga tacgagatta gaagatatta tcagtcgata cgtataaaag aaaaggagtg     25860
     gatgaaacat gacaatttca ttggcaaaag gacaaaaagt agatttaaca aaaacaaatc     25920
     cgggtctttc aaaggttgtt gtcggtttag gctgggatac gaacaagtat gacggcgggc     25980
     acgactttga tcttgactca agtgtgtttc tgttagacgc cgcgggcaaa tgcgcgtcac     26040
     caaacgactt tattttctac aaccagcttg aaggcggcaa cggttcagtc gttcattcag     26100
     gcgacaacct gactggtgct ggcgaaggcg acgatgagaa tgtaaaagta aatctcagcg     26160
     ctgtaccggc aaacattgat aaaatctcat ttgttattac cattcacgat gcagaagcgc     26220
     gcagccaaaa ctttggacaa gtatcaaacg cgtttgtccg catcgtaaat gaagaaacaa     26280
     atgaagagct catccgttac gatcttgcag aagatttctc tattgaaacg gcaatcattg     26340
     caggggagct ttacagacat aacggcgagt ggaaattctc agcaatcggc tcaggctacc     26400
     aaggcggcct tgcccgcatt gcaacagact acggtttgca agtcggttaa gacaaatacg     26460
     aagagcagaa aggagagagg cagtatggcc attcaattat caaaaggaca gcgcattgat     26520
     ttaacaaaaa caaatccggg actgactaaa gcggtgatcg gcttaggctg ggatacaaac     26580
     aagtactccg gcggacacga ttttgacctg gatgcttcgg cctttttagt tgatgcgcat     26640
     gataactgcg taaatgatct cgatttcgtc ttctataata accttgaaca tccgagcggc     26700
     ggtgtcatcc atacgggtga caaccgcacg ggtgagggcg acggagatga tgagcagatt     26760
     atcgttgatt tctcaaaaat ccctgctcac attgagaaaa tcggcatcac agtgaccatt     26820
     cacgacgctg aagcacgcag ccaaaacttt ggacaagttt ccaatgcatt tgtccgcgtt     26880
     gtggatgaag aaacgcagaa tgagcttctt cgcttcgatt tgggagaaga cttctccatt     26940
     gaaacagctg ttgtcgtttg tgagctttac agacacggcg gcgagtggaa attcaatgca     27000
     atcggcagcg gattttccgg cgggctggct gcattgtgcc ggaattacgg tttgcaagtg     27060
     taagcgagtg acaaatagag aagtcaccgt ttcaaattat aggaggaaaa aacttggact     27120
     ttttacatca tattttgtct acgtatgctt catttttcga ttggaaaatg tggggggaag     27180
     ttctgactga tcctgtttcc tggggtttga tcggttccct tgttgttctg gaaggccttt     27240
     tatcggccga taacgcgctt gttcttgcgg tcatggttaa acacctgccg gaaaaacagc     27300
     ggaaaaaagc gttaacgtat ggtttgtttg gagcttatat tttcaggttt attttcatcg     27360
     ggctcggtat gcttctcatt aaattctggt ggatcaaggt gcttggcgcg ctttacctgg     27420
     cttggctcgt cattaagcac ttctggatag gcgaaaaaga agaggaagcg gacggcatga     27480
     agaaaaactc ttggatggtc cgcacgttcg ggatcttctg ggcgactgtc atttcagtag     27540
     aattaatgga tcttgccttc tctgtggaca gcatcctggc cgcgtttgca gtatctgaaa     27600
     aagtatgggt gcttctgatt ggcggtatgc ttggtatttt aatgatgcgt acagtggcaa     27660
     aagtgttcct tgtgctgatt gataaaattc ctgagctgga aaacacagca ttcgtcttaa     27720
     tcggcattat cgcgctgaaa atggcgggga gcgctttcca ttacgaaatg ccgcactctg     27780
     tattcttcat tatcattatc gctgcatttg cggtaacatt gatcattcac tacatcaata     27840
     aacaaaagca ggtgcgcgaa caaacagccg cttcaaaaga agaataaaac aaaacaagga     27900
     gggaggttca atgtccttcc ttttttgtta ccgaaatatc gtttcaatga caaaccggaa     27960
     aggaggatat gatgagacaa gaagaactaa ccattcataa agcacttccg gctgatggcg     28020
     attggaaaag cctgctgttt cagccattgc cggagcggga tcactatgaa actgcacaag     28080
     gcctttcttt ttctcgtctt gccggtcaga tattgggcac gcctattgat gagacggact     28140
     actataacga gctgtatgag ctgtctgtaa acgaccgcat aacgattttg agtgaaacgc     28200
     ttgataaaac aatcgaaccg gaaacatttc aaaagcttca gcatattcat tccatcaatc     28260
     agaaagaaaa agggctgtca gtcagccgct ttgttgcctt tctggacggg gaaaagctga     28320
     ttgcgaagca ctcaaatccc ttgatgcacc gccatttaag aaaagcgttg atgacgcttt     28380
     tacatacctt tgcggacagt catgaaaagg ggctgaatca tcctgatttt cgcagagtgc     28440
     tgcttgatgt ctcgaagttt tccttaaacc atctgaaccc ttggctggaa aaaaccgata     28500
     tagagcggga gatgccgaag gttgtttggt atggagatgc gacgaaaagc cagctctatt     28560
     tcttatatta tctgatgctg gtcggctgtg atgtactgct gttccatccg gcgggaacgg     28620
     atcagctggc gcttgtcgac ccgaagcagg agctcggttt tacggaaaag ctcccggatg     28680
     tttcggagct tcagccgttt ccgaaagaaa aaccagaccg gaaatcaaca gtggcttacc     28740
     gctcaacaaa ggaaattgaa catgtgctga atcacgagga atccatgcta tataagccgt     28800
     ggcagttcag agatcacaca ccggtgtccg ttacgctgaa aacgacctat gatgaattgt     28860
     ttttaatcac gaaagaacgc gcctttattc ggccgaattt caaagctgat aaacattcca     28920
     ttgagattcc gaatgtattc gccaaaatta tgggcgtgtc gaaagacaat aaggaatatt     28980
     ggaacaggct tcatactcta gcggattatc aggaaacaga aatggtcaga agctttccat     29040
     ttacagaaga aataaagtcg aactatcaat ttcactacag ccacgcactt gatcaagaag     29100
     ggaacattga tccggacaag ctgatggcaa gcaatgtgtg gcagtacaaa cagctgccgg     29160
     cgggcgttca gactgccatt gccaaaacga tttcgagaat gtgcaggtac ccgcggctta     29220
     aagccttgca tcaggaacaa gtcaaggatg ttcaaatcta tttgtttaaa caaacaacaa     29280
     acctgcctgc taatctgctg aaattgattc aaatgttcga ctatgcgcaa accgttccga     29340
     aactcgtttt atatcatacg gaaatgagcg gcggactcac gcgttcggat gctgccgccc     29400
     tgctgttcct gaatgaaatc ggaatcgata tcatcattta taatccgccc ggacaccaag     29460
     atattgagca gtttattgaa gaggatcagt atgatatcca ctggctggat gacatggtgt     29520
     ttcagcagga ctacaaagag ccttcgcttg tgaaaaggct cttcagaacc attacccaaa     29580
     aataaggaga gaagaaaagc atgacaacag aaaatcaaaa tccgcttgtt ctcgataaaa     29640
     atgaagagat ttcccagcaa aaagctgacg atatccgtct tcagctccgt caggaaccag     29700
     aagtgaagcg gcttgctcaa caaattgacg tcaaaaacca aatggagctg cttgagtacg     29760
     gcaaggagcc ggccgttgaa atatccaagt tctctgaccg catcttgggg atgatgaaaa     29820
     caacaagcgt gacagactcc ggcacaatgc tgactcagct tgggaaaatc atggaccgct     29880
     tcgacaaaaa tgattttgat gagccaaagg gattaatggc gaaaattttc aaacgcggcg     29940
     gcagcatgat tgaaaaaatc tttaaaaagt atcagacgct tggcggagag attgaaaaaa     30000
     tccacgttga gatttcaaaa tacaaagatg agatgacgaa gacgaactac acgctcgatg     30060
     aaatgtatga aaacaatatc aaatactata tggagcttga aaaatacgtc gttgccgggc     30120
     agatgaaact ggaagagatg cagtcgatcc ttccttcata tgaggaaaaa gcggcaagcg     30180
     ggaaccagct ggcgcaaatg cagctcgata cgttgcgcaa cggcattcag gcgcttgagg     30240
     aacgggtgta tgatcttgac atggcacgga tggtggcgct tcaaaccgca cctcaaatcc     30300
     gtctcctgca gcgaggaaat gcaaagctga tcgggaaaat caactccgcg tttatcatta     30360
     ccattccgat tttcaaaaac ggcattattc aggctgttac ggtaaagcgg caaaagcttg     30420
     tggctgattc catgagcgag cttgaccgcc ggacaaacga gatgctgaaa cgaaatgctg     30480
     aaaacatctc gagccaaagt gttgaaattg cgagaatggc cggcagaccg agcatagata     30540
     ttgaaacgat tgaatcgtct tggaacacga ttgtcagcgg catgcaggaa acaaaacaaa     30600
     tcgaagaaga aaacaagcgc ctccgcgaag acggcgcgag acgaattgcc cagcttcagg     30660
     ataatattaa aaaagcagca ttgcagcaat aataaaaacc ccgcttgtgg aacataagcg     30720
     gggtatttca attacatcat ttagttaatg acaatgtgta aagacaggtg taaacttaaa     30780
     cggtaatcat tttgcatatc agaggtgttg gcaatgggaa aacaacagcc tatatcccag     30840
     cgtaaactgc tgggcgtcgc cggtttgggg tggctgtttg atgcaatgga tgtcggaata     30900
     ttatcgttta ttatcgccgc gctccatgta gagtggaatc tgtcgcccga agaaatgaaa     30960
     tggatcggaa gcgtcaattc catcggcatg gctgcgggtg cgtttttgtt tggtttgctt     31020
     gctgatcgaa tcggccgcaa aaaagtgttc atcatcaccc ttttatgctt ttccatcgga     31080
     agcggcattt ccgcttttgt gacgagctta tcggcatttc taatccttcg tttcgtgatt     31140
     ggtatgggac ttggcggcga gcttccagtc gcttcaacac tcgtttcgga agcggttgtg     31200
     cctgaaaagc ggggcagagt gattgtgctt ttggaaagct tttgggccgt gggctggctc     31260
     gcagcggcct tgatttctta ctttgtgata ccaagcttcg gctggcaggc tgcccttctg     31320
     ttaactgcgc tgactgcttt ttatgcgctg tacctgcgga cgagtctacc tgattcgccg     31380
     aaatatgaat cgctttctgc caaaaagagg tcgatgtggg agaatgtaaa aagcgtctgg     31440
     gcaagacagt atatacggcc gacggtgatg ctgtcgatcg tttggttctg tgtggtgttt     31500
     tcttattacg gcatgttcct atggctcccg agtgtcatgc tgctgaaagg cttcagcatg     31560
     attcaaagct ttgaatatgt cctgctgatg acgcttgctc agctacctgg ctatttctct     31620
     gccgcatggc tgattgaaaa agcgggccgg aagtggatac tcgtcgttta cttgattggc     31680
     acagcaggaa gcgcctattt cttcggaacg gcggattcct taagtcttct gcttacggct     31740
     ggagtgctgt tatcgttttt caatctcggt gcgtggggcg tgctgtatgc ttataccccg     31800
     gagcaatacc cgactgcgat tcgagcaaca ggttcaggaa cgacagcagc gtttggaaga     31860
     atcggcggca tcttcgggcc tttgctcgtc ggaaccctgg cagcccgtca tatttcgttt     31920
     tcggtcatct tttcaatctt ttgcattgca atcttacttg cggttgcttg tattttgatt     31980
     atggggaaag aaacgaaaca aactgagcta gaataggaaa agcacctctt aaaagaggtg     32040
     ctttcagcgt gtcgacaaac cctcgcattc gttgtcagga ctgcgcttcg gtgctcaatg     32100
     cgaagtggat caacggctaa attctcaggc gtcctgccta aacgccgtcg tcatcacatc     32160
     ctgtgaatgt ccgctcctat gctcgtcctt cctagacttc aagggttttc aatcacgctg     32220
     aaaagatttt gtcaacaatc tgaggcacct cttgaatgag gtgctttttt acaattgcgc     32280
     ccgggctgtg gattggcgtt tcccggtttt actgattgtc tggtagagcg tcatagaaag     32340
     tatgaacaga atggcagtaa atcctgtgac agctccgaaa tgctgtgtgc tttgatataa     32400
     aaaacctgca atacttgtac cgacagtggt tccggcatac atagcggcat tggaaaggga     32460
     agcgatggtt cctcgcgcat ttggtgcaat ggattgaaag acacccatca ttaacggaaa     32520
     gatgatgcca gctgtaaaga acgtgagaaa aaagccggct tctactaaaa acaagtttgg     32580
     aaagaacgga agagcgaaat agagagcgcc cattagcagc atcccgctga tcagtgtttt     32640
     aaacatgccc agcttttctg aaacccggct gccgataagg ctcccgagca tatttcccag     32700
     tccgagtaca agcatagctg cgccaatttg tgacacggtt aaatgataat ccgcggaaag     32760
     ccaagtaccc agaaagctga acgatgcgaa gtttccggtt tgaaacagaa aataggcaag     32820
     cagaatgacc gatgttttcg gcaatgaaaa aagctcccga taggggttga caattgatgg     32880
     gcgcgccaat ggttcagaag gccggatgcc aggcatgacc gccgccagga tcaatagaag     32940
     aataagcgag cacgctgaca aaacgaaaaa tggcgtatgc catgtaaagg aagcgagaaa     33000
     ccctccaata ggaagtccga gcatttgtga agcggccaaa cctgctgtcg caatccccat     33060
     gccttttatg atctgagaag gctggacaat gactgggatg gacgcccaaa tttgaggcgt     33120
     cacaaacgca gcgctaacgc ctgcggcaaa acggaacagg cacatggcgg caaaagaggg     33180
     agcgatgccg cataaaaatg tggatacgat aaagcctgca agtccccaca gcatgactgt     33240
     tttcctgttc agccggtctg agattgggcc tgcaatgaaa gcgaagagtg cataaccgag     33300
     tgcataagca ctgaccatcc agcctgacaa atcagtagag acatgaaact gatcctgtaa     33360
     aagggggaga agcggcgaaa gcaaaaaggt atccgtgcca atgacaaaca tgacactgaa     33420
     gaaaagccaa atgcgattca aattttatca ctcctattgt tttataactt taaaactatg     33480
     aaacagatat gtatagagaa aaccctttgt tagagggttt ccaaaaagcc aggcaggtat     33540
     gtttgaaatg tgtcttcacg cagactgacg tattttgtcc gcgaatcttt ccgggttgcc     33600
     gtcaatcccg cttcacgcag cgttttaaaa tgataagatg ccgtggtttt gacaatattg     33660
     cacttttcac ctacttcacc gcagctgagt tcttttccgc tgacataaag cgtacgaata     33720
     atggcaagcc ttgattcatc agacagtgct ttaaaaattt gcgctctgat ttgatcatct     33780
     gattgtttca tagtcatgaa actataatac ataatgggtg ttgaaaaagc aacttatttt     33840
     tccagtaaag gagcaggaag tcataagagg aaggaggaat tcaattccaa taaaagcgtt     33900
     ttcaactaaa ggtaggagaa aaatcacccg taaaatacaa tcatatagga ggattacaga     33960
     gcatttagaa gcataaataa gatcatgtgg tcacatggat gtttataaag aaatggtaca     34020
     gaataaaaga gaatatgctg tttgtgtggg aagttacata aatgttacgg taataaagat     34080
     tgcttaatat ggagggaaaa tatgagtgta gatgagaaac caattaagat aaaagtcgag     34140
     aaagtctcta agatttttgg gaaacaaaca aagaaggcag ttcaaatgct tgccaacgga     34200
     aaggcaaaaa aagagatcct gaaagcaacc ggatcaaccg ttggggttaa tcaggcagat     34260
     tttgaagtat atgatggtga gatatttgtc atcatgggtc tatcagggag cggtaaatca     34320
     actttagtac ggatgttaaa ccggcttatt gaaccgactg ccggaaatat ttacattgat     34380
     ggtgacatga taacaaatat gtcaaaagac cagctccggg aagtccgccg gaaaaaaatc     34440
     agcatggtct tccaaaagtt cgctctgttt ccgcacagaa cgatacttga aaacacagaa     34500
     tacggactgg agcttcaagg tgtagacaaa caagagcggc agcaaaaagc gcttgagtct     34560
     cttaagctcg ttggactgga aggatttgaa caccaatatc ccgaccagct ttccggcggg     34620
     atgcagcagc gtgtcggcct tgcccgcgcg ttgacgaatg acccggacat ccttctgatg     34680
     gacgaagcgt tcagtgcgct cgatccactg attcgtaaag atatgcagga tgagcttctt     34740
     gatcttcacg ataatgtcgg aaaaacaatt atctttatta cgcatgactt ggacgaagcg     34800
     ttgcggatcg gcgacagaat tgtcctaatg aaggacggca acatcgttca aatcggcacg     34860
     cctgaagaaa tcctgatgaa tccatctaac gaatatgttg agaaattcgt cgaagatgtt     34920
     gatttgtcta aagtcctcac agcaggccac attatgaaac gcgctgaaac agtgcggatt     34980
     gataaagggc ctcgcgtagc                                                 35000
//

If you have problems or comments...

PBIL Back to PBIL home page