(data stored in ACNUC7421 zone)

EMBL: AB001488

ID   AB001488; SV 1; linear; genomic DNA; STD; PRO; 148068 BP.
XX
AC   AB001488;
XX
DT   13-MAR-1997 (Rel. 51, Created)
DT   14-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Bacillus subtilis genome sequence, 148 kb sequence of the region between 35
DE   and 47 degree.
XX
KW   alr; cspC; ddlA; dinB; expZ; gsiB; mutT; nap; orfR; orfS; orfT; rsbU; rsbV;
KW   rsbW; rsbX; sigB; topB; ydaA; ydaB; ydaC; ydaD; ydaE; ydaF; ydaG; ydaH;
KW   ydaI; ydaJ; ydaK; ydaL; ydaM; ydaN; ydaO; ydaP; ydaQ; ydaR; ydaS; ydaT;
KW   ydbA; ydbB; ydbC; ydbD; ydbE; ydbF; ydbG; ydbH; ydbI; ydbJ; ydbK; ydbL;
KW   ydbM; ydbN; ydbO; ydbP; ydbQ; ydbR; ydbS; ydbT; ydcA; ydcB; ydcC; ydcD;
KW   ydcE; ydcF; ydcG; ydcH; ydcI; ydcJ; ydcK; ydcL; ydcM; ydcN; ydcO; ydcP;
KW   ydcQ; ydcR; ydcS; ydcT; yddA; yddB; yddC; yddD; yddE; yddF; yddG; yddH;
KW   yddI; yddJ; yddK; yddL; yddM; yddN; yddO; yddP; yddQ; yddR; yddS; yddT;
KW   ydeA; ydeB; ydeC; ydeD; ydeE; ydeF; ydeG; ydeH; ydeI; ydeJ; ydeK; ydeL;
KW   ydeM; ydeN; ydeO; ydeP; ydeQ; ydeR; ydeS; ydeT; ydfA; ydfB; ydfC; ydfD;
KW   ydfE; ydfF; ydfG; ydfH; ydfI; ydfJ; ydfK; ydfL; ydfM; ydfN; ydfO; ydfP;
KW   ydfQ; ydfR; ydfS; ydfT; ydgA; ydgB; ydgC; ydgD; ydgE; ydgF; ydgG; ydgH;
KW   ydgI; ydgJ; ydgK.
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-148068
RA   Ogasawara N.;
RT   ;
RL   Submitted (03-MAR-1997) to the INSDC.
RL   Naotake Ogasawara, Nara Institute of Science and Technology, Graduate
RL   School of Biological Sciences; 8916-5 Takayama-cho, Ikoma, Nara 630-01,
RL   Japan (E-mail:nogasawa@bs.aist-nara.ac.jp, Tel:07437-2-5430,
RL   Fax:07437-2-5439)
XX
RN   [2]
RA   Kasahara Y., Nakai S., Lee S., Sadaie Y., Ogasawara N.;
RT   "A 148 kbp sequence of the region between 35 and 47 degree of the Bacillus
RT   subtilis genome";
RL   Unpublished.
XX
RN   [3]
RX   DOI; 10.1007/s004380050546.
RX   PUBMED; 9341680.
RA   Beloin C., Ayora S., Exley R., Hirschbein L., Ogasawara N., Kasahara Y.,
RA   Alonso J.C., Le Hegarat F.;
RT   "Characterization of an lrp-like (lrpC) gene from Bacillus subtilis";
RL   Mol. Gen. Genet. 256(1):63-71(1997).
XX
DR   MD5; 3266715d229451519477b102f239f259.
DR   EuropePMC; PMC107188; 9573198.
DR   EuropePMC; PMC107534; 9748431.
DR   EuropePMC; PMC110988; 10986248.
DR   EuropePMC; PMC2786583; 19946141.
DR   EuropePMC; PMC92150; 10919786.
DR   EuropePMC; PMC95284; 11395465.
DR   EuropePMC; PMC98967; 10357852.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF01410; BsrC.
DR   RFAM; RF01690; Bacillaceae-1.
DR   RFAM; RF01691; Bacillus-plasmid.
DR   RFAM; RF01766; cspA.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..148068
FT                   /organism="Bacillus subtilis"
FT                   /map="35 - 47 degree"
FT                   /strain="168"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   regulatory      1..33
FT                   /note="PROBABLE RHO-INDEPENDENT TRANSCRIPTIONAL TERMINATOR"
FT                   /regulatory_class="terminator"
FT   regulatory      175..180
FT                   /gene="ydaA"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        189..2273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaA"
FT                   /note="PROBABLE HTH_LYSR_FAMILY TRANSCRIPTIONAL REGULATOR."
FT                   /db_xref="GOA:P96574"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96574"
FT                   /protein_id="BAA19254.1"
FT                   /translation="MYMTAREQKLLKHLLLQNRYITVTELAELMQVSTRTIHRELKSIK
FT                   PLMETVGLTLDKQPGKGLKAVGSPEGKQKLLTDLSYEQHEYSADERKLLILCSLLESQE
FT                   PVKLYTLAHDLQVTNATVSYDLDELEKWISPFGLTLIRKRGFGIQLIGPENAKRKIVGN
FT                   LIVNRLDIQMFLEAVELNIKGKTDSSEKMFGVVSKGELLKMERILFQLKEKIAFSLSDS
FT                   SYIALVVHLTYAIERIKLGETITMEQNELEELMNAKEYSSALEIAGELERAFGVTIPEA
FT                   EVGYITIHLRSANRKYKTEYKAQEIELETALQTKRLIAFISDKIRMDLTKNYSLYEGLI
FT                   AHLEPAVSRIKENIEIYNPMKEQIKRDYFLLYMAIEEGVEKYFPGMSFSDDEIAFIVLH
FT                   FGSALEIKKEEAKVKALVVCSSGIGSSKMLASRLKKELPEIESFDMSSLIELKGKDVQA
FT                   YDMIVSTVPIPYENIDYIMVSPLLNEEDANQVKQYIKRKIPLILNKKRSSKEEAQQADV
FT                   PDMLEAAESIGRYMEVIQDVLRHFTLAQLKTNPDHSMLLLELFQQLKKDGLIRDPEKAA
FT                   VCLAEREKQGGLGIPGTNMALYHLKNDEIVLPFFKMFDLSTPYEVDGMDGNTLRMTRIL
FT                   VMMAPGSLSAEGSEILSAISSAIIESGESMAGFQEEGGQELYQRLNRIFFTWMKEKNIL
FT                   "
FT   regulatory      2472..2479
FT                   /gene="ydaB"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        2484..3881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaB"
FT                   /note="SIMILAR TO ENZYMES WHICH ACT VIA AN ATP-DEPENDENT
FT                   COVALENT BINDING OF AMP TO THEIR SUBSTRATE."
FT                   /db_xref="GOA:P96575"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96575"
FT                   /protein_id="BAA19255.1"
FT                   /translation="METLQHLILHDMPNSEEIEAVKSGDHTLTYKGYRKRINQLANAML
FT                   QKGIQKGDRVALLCKNGHPASTVMFAALEIGAVVVPVSWQLKPYEMTGILKASEPKAMF
FT                   YGAEFKEILDEVLPELSSLCVTMETGTAYETSAEFEALFAGPDHLPETEMVSPDDTALL
FT                   MFTSGTTGNPKRCMITHGGIYRYVKKSNSSIARMKGLRFLACHPIYHTSALICIMLGTF
FT                   AETTFVFTKDQDPVHMLKVIEEEKIQTVMALPVFYTYLLEAWEKHQTDLSSLVILMTGG
FT                   TKVPSSLISRYLDIGIPLAHGYGSTEAWGISTWTPDMGMDKAASAGKPVAGVKVKVEDP
FT                   LTGEELPQGEIGEIVVHTPFLFKGYEDNPEATAKVLQNGWFRTGDSGYVDEDGFIFITG
FT                   RYKDVIIYGGDNVYPDQVEEVIQQIPGILETAVVGIPDPLYGEKPKAFIVKNGGQRITE
FT                   EDVIAFL"
FT   CDS_pept        complement(4016..4561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaC"
FT                   /note="FUNCTION UNKNOWN, SIMILAR PRODUCT IN SEVERAL
FT                   BACTERIA."
FT                   /db_xref="GOA:P96576"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96576"
FT                   /protein_id="BAA19256.1"
FT                   /translation="MIAGYIMAAENQTLNQWTINQLGITRGDSILEVGFGPGYCMQQML
FT                   KREKDVHLHGIDVSEAMLKLAARRVKPKGVRLIQGSIETFPLPASFYDKVISVNNYTIW
FT                   NDQTKGIKQIYRALKPGGKAAITMQPREADASPEKTKSFGRQMIADFKAAGFEDIDIQF
FT                   KNIKPELSVCATAKKPAT"
FT   regulatory      complement(4572..4577)
FT                   /gene="ydaC"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      4752..4759
FT                   /gene="ydaD"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        4769..5629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaD"
FT                   /note="BELONGS TO THE INSECT-TYPE ALCOHOL DEHYDROGENASE /
FT                   RIBITOL DEHYDROGENASE FAMILY."
FT                   /db_xref="GOA:P80873"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:P80873"
FT                   /protein_id="BAA19257.1"
FT                   /translation="MANYPKELPAQTQSRQPGIESEMNPSPVYEYEDYKGADKLKGKVA
FT                   LITGGDSGIGRAVSVAYAKEGADIAIVYKDEHEDAEETKKRVEQEGVKCLLIAGDVGEE
FT                   EFCNEAVEKTVKELGGLDILVNNAGEQHPKESIKDITSEQLHRTFKTNFYSQFYLTKKA
FT                   IDYLKPGSAIINTTSINPYVGNPTLIDYTATKGAINAFTRTMAQALVKDGIRVNAVAPG
FT                   PIWTPLIPATFPEETVAQFGQDTPMGRPGQPVEHVGCYVLLASDESSYMTGQTLHVNGG
FT                   NFVTT"
FT   regulatory      5628..5639
FT                   /gene="ydaE"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        5645..6148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaE"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="GOA:P96578"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="PDB:2Y0O"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96578"
FT                   /protein_id="BAA19258.1"
FT                   /translation="MGITKEEVNSYYQKAGIVLTDEEVDQIQLMDYGLGKERKVGLQLF
FT                   VYVNTDRYCSKELVLFPGQTCPEHRHPPVDGQEGKQETFRCRYGKVYLYVEGEKTPLPK
FT                   VLPPQEDREHYTVWHEIELEPGGQYTIPPNTKHWFQAGEEGAVVTEMSSTSTDKHDIFT
FT                   DPRI"
FT   regulatory      6146..6174
FT                   /note="PROBABLE RHO-INDEPENDENT TRANSCRIPTIONAL TERMINATOR"
FT                   /regulatory_class="terminator"
FT   regulatory      6219..6230
FT                   /gene="ydaF"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        6233..6784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaF"
FT                   /note="PROBABLE ACETYLTRANSFERASE."
FT                   /db_xref="GOA:P96579"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="PDB:1NSL"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96579"
FT                   /protein_id="BAA19259.1"
FT                   /translation="MFTCKVNEHITIRLLEPKDAERLAELIIQNQQRLGKWLFFAENPS
FT                   SADTYRETIIPDWRRQYADLNGIEAGLLYDGSLCGMISLHNLDQVNRKAEIGYWIAKEF
FT                   EGKGIITAACRKLITYAFEELELNRVAICAAVGNEKSRAVPERIGFLEEGKARDGLYVN
FT                   GMHHDLVYYSLLKREWEGEK"
FT   regulatory      6846..6855
FT                   /gene="ydaG"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        6862..7284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaG"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="GOA:P80238"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR038725"
FT                   /db_xref="UniProtKB/Swiss-Prot:P80238"
FT                   /protein_id="BAA19260.1"
FT                   /translation="MNQQDIKQKVLDVLDHHKVGSLATVQKGKPHSRYMTFFHDGLTIY
FT                   TPTSKETHKAEEIENNPNVHILLGYDCEGFGDAYVEVAGKAKINNSAELKDKIWSSKLE
FT                   RWFDGKDDPNLVILEIEPEDIRLMNAGEKTPVSLEL"
FT   regulatory      7778..7783
FT                   /gene="ydaH"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        7790..8599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaH"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="GOA:P96581"
FT                   /db_xref="InterPro:IPR021260"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96581"
FT                   /protein_id="BAA19261.1"
FT                   /translation="MHVITTQVLFIFCFLLLIHSIETLAYATRLSGARVGFIASALSLF
FT                   NVMVIVSRMSNMVQQPFTGHLIDDAGKNALAIVGEQFRFLIFGSTVGTILGIILLPSFV
FT                   ALFSRAIIHLAGGGGSVFQVFRKGFSKQGFKNALSYLRLPSISYVKGFHMRLIPKRLFV
FT                   INMLITSIYTIGVLSALYAGLLAPERSTTAVMASGLINGIATMLLAIFVDPKVSVLADD
FT                   VAKGKRSYIYLKWTSVTMVTSRVAGTLLAQLMFIPGAYYIAWLTKWF"
FT   regulatory      8844..8849
FT                   /gene="ydaI"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        8857..9552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaI"
FT                   /note="PROBABLE TRANSCRIPTIONAL REGULATOR, SIMILAR TO LEU
FT                   RESPONSIVE REGULATOR."
FT                   /db_xref="GOA:P96582"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="PDB:2CFX"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96582"
FT                   /protein_id="BAA19262.1"
FT                   /translation="MNNRIKSDIPSIKPIVRSLPIGVCSINRPPCGHVFILYYKQSGGA
FT                   YDSFQKMFGKHSFLHAFSRELYLSFTKIPEIMCTKSKKKDVEMKLDQIDLNIIEELKKD
FT                   SRLSMRELGRKIKLSPPSVTERVRQLESFGIIKQYTLEVDQKKLGLPVSCIVEATVKNA
FT                   DYERFKSYIQTLPNIEFCYRIAGAACYMLKINAESLEAVEDFINKTSPYAQTVTHVIFS
FT                   EIDTKNGRG"
FT   regulatory      9599..9610
FT                   /gene="topB"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        9617..11800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="topB"
FT                   /product="PROBABLE DNA TOPOISOMERASE III"
FT                   /EC_number="5.99.1.2"
FT                   /db_xref="GOA:P96583"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96583"
FT                   /protein_id="BAA19263.1"
FT                   /translation="MSKTVVLAEKPSVGRDLARVLKCHKKGNGYLEGDQYIVTWALGHL
FT                   VTLADPEGYGKEFQSWRLEDLPIIPEPLKLVVIKKTGKQFNAVKSQLTRKDVNQIVIAT
FT                   DAGREGELVARWIIEKANVRKPIKRLWISSVTDKAIKEGFQKLRSGKEYENLYHSAVAR
FT                   AEADWIVGINATRALTTKFNAQLSCGRVQTPTLAMIAKREADIQAFTPVPYYGIRAAVD
FT                   GMTLTWQDKKSKQTRTFNQDVTSRLLKNLQGKQAVVAELKKTAKKSFAPALYDLTELQR
FT                   DAHKRFGFSAKETLSVLQKLYEQHKLVTYPRTDSRFLSSDIVPTLKDRLEGMEVKPYAQ
FT                   YVSQIKKRGIKSHKGYVNDAKVSDHHAIIPTEEPLVLSSLSDKERKLYDLIAKRFLAVL
FT                   MPAFEYEETKVIAEIGGETFTAKGKTVQSQGWKAVYDMAEEDDEQEDDRDQTLPALQKG
FT                   DTLAVRTLTETSGQTKPPARFNEGTLLSAMENPSAFMQGEEKGLVKTLGETGGLGTVAT
FT                   RADIIEKLFNSFLIEKKGQDIFITSKGKQLLQLVPEDLKSPALTAEWEQKLSAIAAGKL
FT                   KSAVFIKDMKAYAHQTVKEIKNSSQTFRHDNITGTACPECGKMMLKVNGKRGTMLVCQD
FT                   RECGSRKTIARKTNARCPNCHKRMELRGQGEGQTFACVCGHREKLSVFEKRKNKDKARA
FT                   TKRDVSSYMKKQNKDEPINNALAEQLKKLGLDK"
FT   regulatory      11802..11833
FT                   /note="PROBABLE RHO-INDEPENDENT TRANSCRIPTIONAL TERMINATOR"
FT                   /regulatory_class="terminator"
FT   regulatory      11987..11993
FT                   /gene="ydaJ"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        11997..13091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaJ"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="GOA:O31486"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31486"
FT                   /protein_id="BAA19264.1"
FT                   /translation="MPVRHVLIAVILFFLSIGLSAGCAEAGNKTQNQSATEVNASPLQP
FT                   AEYFIYHNLMNDKGLIKTDFSDQPSYLSESLGLWMEFLLSKNDAPHFQDQYQHLTDSFL
FT                   MSNHLVTWKIQNGQASGTNALIDDMRIMLSLDQAAAKWGRSDYAQTARDIGTSLKTYNM
FT                   NNGFFTDFYDSQAASKDVTLSYVMPDALAVLKKNGIIDEETEQRNANVLYSAPLKNGFL
FT                   PKTYSSETKEYTYDSEINLIDQLYAAWHLPEGDEKASVLADWIKQEFQKNGKLYGRYSA
FT                   YTKEPAVQYESPSVYALAVLFLTKQHENSSVIKAIYDRMNDFEIHDPVKSYYGGYMSGT
FT                   QTHSFDNLLPLLAERKLFNENIIQ"
FT   regulatory      13057..13064
FT                   /gene="ydaK"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        13072..13923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaK"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="GOA:P96585"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96585"
FT                   /protein_id="BAA19265.1"
FT                   /translation="MKISFSESQKLFAYFSGLIAALSLFIYYVSAQQSEGALILCITFG
FT                   VIAAGIWFGPIYALAVTLIVLFVLGTLMMFFQTGQTSLFPAEEGLRMLVVWGIALLLFS
FT                   FISGRIHDITAELRRSMTRLQSEIKSYVAVDRVTGFDNKQRMKLELSEEIKRAERYGNS
FT                   FVFLLLHMHYFKEFKSLYGEKETDRLFQYVGQQIRTSVRETDKKFRPSDERIGIVLTHT
FT                   PAEHMPAVLTKLKKQLDTYQLENGKYVSLTFHVCYLPYRNDIQTADQFLEELENEMMMN
FT                   EL"
FT   regulatory      13901..13912
FT                   /gene="ydaL"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        13913..15643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaL"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="GOA:O31487"
FT                   /db_xref="InterPro:IPR018763"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31487"
FT                   /protein_id="BAA19266.1"
FT                   /translation="MNYKGITLLCVMMLLFSAIASFPVSAQAKDQDAGILIIYSTLDGK
FT                   ESSQVKMLDLLAGHFTSHVTVKKDSDVEASDFKGKDHVIYYGQTKRKLSQKLLSLISGV
FT                   KKPVVAIGYNAGQISQFSGLSLARKENVFQVHSRSEKADVSLESGLNVLSVSGLKGTAL
FT                   YTFKADEGTTHSFIWKTKKGNVYIGLTNLLNDNLIVAKQLREAFGEKAGTTLLYLRLED
FT                   ISPMSDEKLLLQAGTYLHKRHIPFILAVIPVYLNPETGDKVYLSNQPKMVKVLKKLQSM
FT                   GGSIIVHGYTHAYRYSETGEGFEFWDAKADQPITSGNAEDPPSILEKEQDFPNEQAYHS
FT                   YLEPFREKEETYTKQKLTRAIEDLTSSGLYPLAFEAPHYTMSEYGYQIASQYFTSIFGQ
FT                   VQLSSTTWKTSGAPPFVTAPSMLHGMTLYPETIGFVDTSKQNPLGEMEEHISQMIDFEG
FT                   GVAGGFYHPYLGMKYLPELVDQMERIPDSEWLDLKKTKQTVKTDKVEIHTSGDGTIQVK
FT                   NGVSPIYEFFDHHRQTPLEKALWILSAVVLLFVIMFVSYTFYLRATLKKRIFKERRSLG
FT                   "
FT   regulatory      15620..15627
FT                   /gene="ydaM"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        15636..16898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaM"
FT                   /note="FUNCTION UNKNOWN, SIMILAR PRODUCT IN MANY BACTERIA."
FT                   /db_xref="GOA:P96587"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96587"
FT                   /protein_id="BAA19267.1"
FT                   /translation="MGNTLFFISLSLIWVMLLYHMFLMQGGFRHYMTFERNIPKWRENM
FT                   KELPKVSVLIPAHNEEVVIRQTLKAMVNLYYPKDRLEIIVVNDNSSDRTGDIVNEFSEK
FT                   YDFIKMVITKPPNAGKGKSSALNSGFAESNGDVICVYDADNTPEKMAVYYLVLGLMNDE
FT                   KAGAVVGKFRVINAAKTLLTRFINIETICFQWMAQGGRWKWFKIATIPGTNFAIRRSII
FT                   EKLGGWDDKALAEDTELTIRVYNLGYHIRFFPAAITWEQEPETWKVWWRQRTRWARGNQ
FT                   YVVLKFLAQFFKLKRKRIIFDLFYFFFTYFLFFFGVIMSNAIFVVNLFYDLHLSVGFLA
FT                   MILWILAFFLFMTEVMITLSIEKTEMNKQNFFIVFLMYFTYSQAWIVLVIYSLFVEIKH
FT                   RLFKQEVKWYKTERYNQHKSG"
FT   regulatory      16888..16894
FT                   /gene="ydaN"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        16895..19015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaN"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="GOA:O31488"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR018513"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31488"
FT                   /protein_id="BAA19268.1"
FT                   /translation="MTFLKQIMIFLTSFMLLAMTGQTALAKDVQVSGSLLGKSSQEQAK
FT                   QQVLTSELITLYGSKDSAELTYQIPAGASSGNQQLVIEYEASNLLISPSSLTVVIDDEP
FT                   VKTLKLDGDSKRKTVKLNLNKSQSAQGYHNVSLKFYGVMKEGVCVRQDTSGNWIKIYPD
FT                   SRLTLADSSEAKGTSLDHYPYPFAQSGNTAEETAIVIPDNPSSAEIEAAVKTEGYLKTV
FT                   DSSVSIAYVTESELKKIDKPTIVIGVDKHWNGKVKKLLKQAGLQAKGENLLLAERVLKA
FT                   EGKQQPVLFAQAASEDALTKKISVMTDQTYTGQLSGDTLSISKLQQTEKKESDKLTLEN
FT                   FGAGDITIGADKTSSAHYFYPASAVLDENQSAKLSLKLKKSETIQASTAENESASQAAE
FT                   LKVMINGQPHSVRLDELGKEDKNGFYHVTVKVDPKLLQKNRYIDIQFVTTGLKENNPCN
FT                   TTDEEKWVFIDKNSTLSYAIKGMSPSADFQEWPLPYAGNQDQTTLIVLPDTVSQSKLEE
FT                   LSLVTESFGNEAQHSYTVKKSSDVTANDAKGRNLIFIGGINQFSLLKEKSSDLLVPQEK
FT                   NGSFDVSSFEMLNETTKQVVFTQASVWDSRYTMAVFAPSKGDGTAVTKEIISYLNSNDE
FT                   SATVLNETNSQQVFTNHQQLKSETNSSDAEQPTQDHSQKWMYIGVLALIMVVAAVFIWI
FT                   AVRRKKRKTDTE"
FT   regulatory      19014..19042
FT                   /note="PROBABLE RHO-INDEPENDENT TRANSCRIPTIONAL TERMINATOR"
FT                   /regulatory_class="terminator"
FT   regulatory      19475..19480
FT                   /gene="ydaO"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        19491..21314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaO"
FT                   /note="FUNCTION UNKNOWN, WEAK SIMILARITY TO YEEF_ECOLI."
FT                   /db_xref="GOA:P96589"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96589"
FT                   /protein_id="BAA19269.1"
FT                   /translation="MYHSIKRFLIGKPLKSQAAGEQKLTKLKALAMLSSDALSSVAYGT
FT                   EQILIILATISAAAFWYSIPIAVGVLILLLALILSYRQIIYAYPQGGGAYIVSKENLGE
FT                   KPGLIAGGSLLVDYILTVAVSISAGTDAITSAFPALHDYHVPIAIFLVLVIMILNLRGL
FT                   SESASILAYPVYLFVVALLVLIAVGLFKLMTGQIDQPAHHTSLGTPVAGITLFLLLKAF
FT                   SSGCSALTGVEAISNAIPAFKNPPARNAARTLAMMGILLAILFSGITVLAYGYGTAPKP
FT                   DETVVSQIASETFGRNVFYYVIQGVTSLILVLAANTGFSAFPQLAFNLARDQYMPRMFT
FT                   VRGDRLGFSNGIIFLGFASIVLIILFGGQTEHLIPLYAVGVFIPFTLSQTGMCMKWIKQ
FT                   KPKGWIGKMLINSCGALISFMVLSILFVTKFNVVWPVLIFMPIVVLLFFAIKNHYTAVG
FT                   EQLRIVDKEPEEIKGTVVIVPVAGVTTVVQKSIHYAKSLSDQVIAVHVSFDREQEKKFE
FT                   KRWEELNNGVRLVTLHSSYRSLVHPFDKFLETVEAKAKKEQFSVMVLFPQFITKKRWHT
FT                   ILHNQSAFLLRVRLFWKKDIMVATLPYHFKK"
FT   regulatory      21321..21346
FT                   /note="PROBABLE RHO-INDEPENDENT TRANSCRIPTIONAL TERMINATOR"
FT                   /regulatory_class="terminator"
FT   regulatory      21358..21366
FT                   /gene="mutT"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        21373..21822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutT"
FT                   /note="FUNCTION UNKNOWN, CONTAINS MUTT MOTIF, SIMILAR
FT                   PRODUCTS IN SYNECHOCYSTIS."
FT                   /db_xref="GOA:P96590"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96590"
FT                   /protein_id="BAA19270.1"
FT                   /translation="MYTQGAFVIVLNESQQILLVKRKDVPLWDLPGGRVDPGESAEEAA
FT                   VREILEETGYNAALSAKIGVYQRPKFQDEQHLFFGSITGGQAMADGTETAGLKWVSPGR
FT                   LPLFMVPNRKRQINDFKNGAQDVNVTVKDSGLLAAIDLLKRRLGK"
FT   regulatory      21874..21883
FT                   /gene="ydaP"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        21889..23613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaP"
FT                   /note="SIMILAR TO PYRUVATE OXIDASE AND ACETOLACTATE
FT                   SYNTHASE."
FT                   /db_xref="GOA:P96591"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96591"
FT                   /protein_id="BAA19271.1"
FT                   /translation="MAHKTAGQAMTELLEQWGVDHVYGIPGDSINEFIEELRHERNQLK
FT                   FIQTRHEEVAALAAAAEAKLTGKIGVCLSIAGPGAVHLLNGLYDAKADGAPVLAIAGQV
FT                   SSGEVGRDYFQEIKLEQMFEDVAVFNREVHSAESLPDLLNQAIRTAYSKKGVAVLSVSD
FT                   DLFAEKIKREPVYTSPVYIEGNLEPKKEQLVTCAQYINNAKKPIILAGQGMKKAKRELL
FT                   EFADKAAAPIVVTLPAKGVVPDKHPHFLGNLGQIGTKPAYEAMEECDLLIMLGTSFPYR
FT                   DYLPDDTPAIQLDSDPAKIGKRYPVTAGLVCDSALGLRELTEYIERKEDRRFLNACTEH
FT                   MQHWWNEIEKDETEATTPLKPQQVVARLQEAAADDAVLSVDVGTVTVWMARHFKMNANQ
FT                   DFIVSSWLATMGCGLPGAIAASLSEPERQAIAVCGDGGFSMVMQDLPTAVKYKLPITVV
FT                   ILNNENLGMIEYEQQVKGNIDYVTKLQNVDYAAFAESCGAKGIKVTKAEELAPAFHEAL
FT                   HSDQPVVVDVMIGNEPPLPGKITYGQAKGFSKYMLKNFFENQKFEMPSLKKSLKRLF"
FT   regulatory      23766..23776
FT                   /gene="ydaQ"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        23790..24080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaQ"
FT                   /note="FUNCTION UNKNOWN."
FT                   /protein_id="BAA19272.1"
FT                   /translation="MLILIKSYRTLLIIGYFSFFFSPKKKGKAEPTKKVPNKNMPPINT
FT                   WKFVCPAVNAVIREMILSTIMAMPGATLIFPLDLWAATEHKMPITIGTIHK"
FT   regulatory      24177..24203
FT                   /note="PROBABLE RHO-INDEPENDENT TRANSCRIPTIONAL TERMINATOR"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(24204..25481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaR"
FT                   /note="PROBABLE INTEGRAL MEMBRANE PROTEIN."
FT                   /db_xref="GOA:P96593"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96593"
FT                   /protein_id="BAA19273.1"
FT                   /translation="MMNKDITAQSPRSKAVQDALDGKIRGFRGLLPFLGPAFIAAIAYI
FT                   DPGNFATNISAGSKYGYMLLWVILFSNIMALLIQSLSAKLGIATGKNLPEVAREEFPKP
FT                   VSIGLWIQGELVIIATDLAEFIGAALGLYLLFGIPMLEASIIAAIGSFAILELQRRGYR
FT                   SLEAGIAGMLFVVVIAFALQTFFAKPDAVSVMKGLFVPAFHGTDSVLLAAGILGATVMP
FT                   HAIYLHSALTQRRVVGKTDAERKKIFRFEFIDILIAMLIAGAINASMLIVAAALFFKNG
FT                   LFVEDLDVAFQQFGHLVSPMSAALFGIGLLVAGLSSSSVGTLSGDVIMQGFINYRIPLY
FT                   VRRFITIIPPILIIASGVNPTTALVLSQVVLSFGIAFALIPLIMFTSNKRIMGSLINAK
FT                   WITVVSWLIAVLIVALNVFLIVDTFR"
FT   regulatory      complement(25484..25490)
FT                   /gene="ydaR"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(25711..25968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaS"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="GOA:P96594"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96594"
FT                   /protein_id="BAA19274.1"
FT                   /translation="MLSFLVSLVVAIVIGLIGSAIVGNRLPGGIFGSMIAGLIGAWIGH
FT                   GLLGTWGPSLAGFAIFPAIIGAAIFVFLLGLIFRGLRKEA"
FT   regulatory      complement(25974..25982)
FT                   /gene="ydaS"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(26046..26498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaT"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="InterPro:IPR018691"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96595"
FT                   /protein_id="BAA19275.1"
FT                   /translation="MPWSMKDYPASLKNLEKPVRKKAIDIANAMIDEGYEEGRAIPIAT
FT                   SKAKEWAENASTDEIDDFLTHDDETERDADPSSGSGPELMNKAEHVIKHKKGWAVKAEG
FT                   AKRVSEIKDTKKEAIERAKEIAAHKGTEVIVHLADGSVQRKIKTGS"
FT   regulatory      complement(26504..26513)
FT                   /gene="ydaT"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      26598..26607
FT                   /gene="ydbA"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        26616..27434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbA"
FT                   /note="SIMILAR TO B. SUBTILIS ATP-BINDING CASSETTE
FT                   TRANSPORTER (ECSC)."
FT                   /db_xref="InterPro:IPR024787"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96596"
FT                   /protein_id="BAA19276.1"
FT                   /translation="MPTERKEDLHQQLKEIEKWEKDQQKVWFWEKLSRLPFQLLDKLTP
FT                   EFIQKKIGKLLDEVGSFVQTGGQYLTSEKQIIRMFQKKLPEEIFESLEDIRKAPLPVMD
FT                   EIAEGMGKNRTNAATVQGATTGVGGVFTLAADIPAVLGLSLKTLQDIAVAYGYDPKEKK
FT                   ERVFIVKCLQLTSADVVGKRSILQELKHYDQDRTYKNVASQIQGWREVVLGYRDTFGWK
FT                   KLFQIVPVAGMVFGAAANRSTLNDITETGMMLYKKRRILERLKETEREME"
FT   regulatory      27547..27554
FT                   /gene="gsiB"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        27563..27934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gsiB"
FT                   /product="GLUCOSE STARVATION-INDUCIBLE PROTEIN B (GENERAL
FT                   STRESS PROTEIN B)"
FT                   /db_xref="InterPro:IPR019626"
FT                   /db_xref="UniProtKB/Swiss-Prot:P26907"
FT                   /protein_id="BAA19277.1"
FT                   /translation="MADNNKMSREEAGRKGGETTSKNHDKEFYQEIGQKGGEATSKNHD
FT                   KEFYQEIGEKGGEATSKNHDKEFYQEIGEKGGEATSENHDKEFYQEIGRKGGEATSKNH
FT                   DKEFYQEIGSKGGNARNND"
FT   regulatory      27966..28003
FT                   /note="PROBABLE RHO-INDEPENDENT TRANSCRIPTIONAL TERMINATOR"
FT                   /regulatory_class="terminator"
FT   regulatory      28050..28056
FT                   /gene="ydbB"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        28066..28407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbB"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="GOA:P96597"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR019780"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96597"
FT                   /protein_id="BAA19278.1"
FT                   /translation="MSKMQNLLAIANEVKEKHANFSISEVNDHCVRLAVFTGEYDWHHH
FT                   PDSDELFIVLEGELLIDFKDKETAVLKANDSLLIPKGTVHRTRSYVRTVNLCVEHKQAE
FT                   TVIIEEQPC"
FT   regulatory      28389..28394
FT                   /gene="ydbC"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        28401..28760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbC"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR032555"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96598"
FT                   /protein_id="BAA19279.1"
FT                   /translation="MLIKKMICEVDAANAEAFAKAQSQWEALSHISGFIKQAGGWRKTI
FT                   DEPLTAEIISVWENREAYDHFMENEHDSIYEENDQKAVILSIEVTVYEEDKPFVHDLLH
FT                   NPDIRYEPNWTVLKA"
FT   regulatory      28764..28790
FT                   /note="PROBABLE RHO-INDEPENDENT TRANSCRIPTIONAL TERMINATOR"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(28797..29618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbD"
FT                   /note="SIMILAR TO MANGANESE-CONTAINING CATALASE
FT                   (EC1.11.1.6) OF LACTOBACILLUS PLANTARUM."
FT                   /db_xref="GOA:P80878"
FT                   /db_xref="InterPro:IPR007760"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR027407"
FT                   /db_xref="InterPro:IPR039377"
FT                   /db_xref="UniProtKB/Swiss-Prot:P80878"
FT                   /protein_id="BAA19280.1"
FT                   /translation="MFKHTKMLQHPAKPDRPDPLFAKKMQEILGGQFGEISVAMQYLFQ
FT                   GWNTRGNEKYKDLLMDTATEELGHVEMIATMIARLLEDAPLDQQEKAAEDPVIGSILGG
FT                   MNPHHAIVSGLGAMPESSTGVPWSGGYIVASGNLLADFRANLNAESQGRLQVARLFEMT
FT                   DDKGVKDMLSFLLARDTMHQNQWLAAIKELEAQEGPVVPGTFPKALEKQEFSHQLINFS
FT                   EGEVSAEQNWLNEKAPDGEAFEYVKEAKTFGEKPELKPAPPFVHNTLPGRE"
FT   regulatory      complement(29624..29633)
FT                   /gene="ydbD"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(29709..30761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbE"
FT                   /note="SIMILAR TO C4-DICARBOXYLATE-BINDING PERIPLASMIC
FT                   PROTEIN OF RHODOBACTER CAPSULATUS."
FT                   /db_xref="GOA:P96600"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96600"
FT                   /protein_id="BAA19281.1"
FT                   /translation="MKSLLACLALMIAGIATALFIGFHDHTGNKKIVYDDDQEGLQDQI
FT                   VFKFSHVVAENTPKGLAANKFADLVNEKSGGKIKIEVFPNGSLYSDIEEIEALQNGDVQ
FT                   FIAPSTSKLGMLSPEWGVLDLPYAFTDYNAVKKGLNGSIGTQLFDSLKKNQLKGLAYWT
FT                   NGFKQITTNQGPVKTPDDLKGQDLRIMQSDVIEDQFKLLGATPHQESFNSTFQLLENNV
FT                   VDGEENTISNIYSKKFYNVQDYLTISSHGYLGYAVMTDEHFWKAQTPETRRILTEAMKE
FT                   TTEWNETYAEQMNKEQLEEIKKNSAIHIYELSDKEKQEWMKRLDPVYRQYEPIFGRELI
FT                   RELLELRKDS"
FT   regulatory      complement(30769..30773)
FT                   /gene="ydbE"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      30818..30824
FT                   /gene="ydbF"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        30831..32438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbF"
FT                   /note="PROBABLE SENSORY TRANSDUCTION HISTIDINE KINASE."
FT                   /db_xref="GOA:P96601"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR016120"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96601"
FT                   /protein_id="BAA19282.1"
FT                   /translation="MNKKKLSIRWKITILSYILVIFSFLIGGIVLIGNIQHTEERELKK
FT                   RLMNTARTVSEMTEVKEALARKKQTEAVRHAVEEIRMINEADYIVVMDMNHIRYTHPVS
FT                   TSIGKKSEGADEEAAFAEHIYFSEAKGEIGTAVRAFYPVKDQDLNQIGVVLVGKTLPGI
FT                   ADILLHLKRDIAFIVVLTLGFGLAGSFLLARHIKKQMFQLEPHEIVRMYEERTATFHSM
FT                   NEGVIAIDNRLVITIFNEKAKQIFEVQGDLIGKVIWEVLKDSRLPEIVERNKAVYNEEI
FT                   RVSGKVIMSSRIPIVMKKKVIGAVAIFQDRTEAAKMAEELTGVRNFVEALRVQNHEHMN
FT                   KLHTIAGLIQLGKSEKALQLAFQASTEQENVTEFLHRSIQNDAAAGLLLSKIRRGRELG
FT                   IAVHIDENSSLQQFPEHVDQHDIVVLLGNLIENAFGSFETVQSEDKRIDISIEQTDDIL
FT                   AILIEDNGCGIEPTHMPRLYDKGFTVNKTGGTGYGLYLVKQIIDKGSGTIEVDSHAGQG
FT                   TSFSIVFPMKGEEAQHGS"
FT   regulatory      32414..32418
FT                   /gene="ydbG"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        32428..33108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbG"
FT                   /note="PROBABLE REGULATORY COMPONENT OF SENSORY
FT                   TRANSDUCTION SYSTEM."
FT                   /db_xref="GOA:P96602"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96602"
FT                   /protein_id="BAA19283.1"
FT                   /translation="MARKEWKVLLIEDDPMVQEVNKDFITTVKGVTVCATAGNGEEGMK
FT                   LIKEEQPDLVILDVYMPKKDGIKTLQEIRKQKLEVDVIVVSAAKDKETISLMLQNGAVD
FT                   YILKPFKLERMRQALEKYKQYKQKIEANDTLSQEQLDAILNIPQQAVQDLPKGLNHFTM
FT                   NEVTAFLKQQTASLSAEEVAKALGIARVTARRYLDYLEKTGIIKLDVQYGGVGRPVNRY
FT                   VLKG"
FT   regulatory      33214..33223
FT                   /gene="ydbH"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        33229..34494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbH"
FT                   /note="PROBABLE C4-DICARBOXYLATE TRANSPORT PROTEIN."
FT                   /db_xref="GOA:P96603"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR023954"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96603"
FT                   /protein_id="BAA19284.1"
FT                   /translation="MKLFKNLTVQVITAVIIGVIVGLVWPDVGKEMKPLGDTFINAVKM
FT                   VIAPIIFFTIVLGIAKMGDMKKVGKVGGKAFIYFEVVTTLALIIGLFVVNIMKPGAGLD
FT                   YSKLEKGDVSQYTQNGGQGIDWIEFITHIVPSNMVDAFAKGDILQVLFFSILFGVGLAA
FT                   LGEKGKSVIDFFDKVSHVFFKIIGYIMRAAPIGAFGAMAYTIGHFGLDSIKPLASLMMS
FT                   VYITMFLFVFVALNIICKLYGFSLWNYLRFIKDELLIVLGTSSSESVLPRMMDKMERYG
FT                   CSKSVVGLVIPTGYSFNLDGTSIYLSMATVFLAQVFGVDLSIGQQITIILVLMLTSKGA
FT                   AGVTGSGFIVLASTLSALQVIPLEGLALLLGVDRFMSEGRAIVNLIGNGIATIIVAKSE
FT                   NEFDEAKSIEAVEGMKKMKTAV"
FT   regulatory      34501..34522
FT                   /note="PROBABLE RHO-INDEPENDENT TRANSCRIPTIONAL TERMINATOR"
FT                   /regulatory_class="terminator"
FT   regulatory      34630..34636
FT                   /gene="ydbI"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        34642..35694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbI"
FT                   /note="FUNCTION UNKNOWN, SIMILAR PRODUCTS IN SYNECHOCYSTIS
FT                   AND H. INFLUENZAE."
FT                   /db_xref="GOA:P96604"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96604"
FT                   /protein_id="BAA19285.1"
FT                   /translation="MAALVKFFQHPGVRRFSIFVVLTGVLYLFKSMINLILLTFIFTFL
FT                   MDRLELVVRQFVSQFFRVSQRVVITFLYMLLAVLLTVGGFVFYPVVAAQIQQLVKQIKH
FT                   IAYHPDSIPFFDEITSVFGDINISSYVKEGFNVVYTYLADISTFGLQVVMALILSMFFL
FT                   FEKKRLSEFMAKFKTSKLRVFYEEIAFFGSKFARTFGKVLEAQFIIALVNCILTFIALW
FT                   IMHFPQLFGLSIMVFFLGLIPVAGVVISLIPLSIIAYSTGGGMYVLYIVLVIFAIHAIE
FT                   TYFLNPKLMSAKTELPIFFTFTVLIFSEHFFGIWGLIIGIPIFVFLLDILDVTNKEDRS
FT                   KGPRENSDKK"
FT   regulatory      35955..35962
FT                   /gene="ydbJ"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        35971..36897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbJ"
FT                   /note="PROBABLE TRANSPORT ATP BINDING PROTEIN."
FT                   /db_xref="GOA:P96605"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96605"
FT                   /protein_id="BAA19286.1"
FT                   /translation="MAEPILHIEGLDKKIGSKQILKQISMDVMEGEIIGLLGPNGSGKT
FT                   TLIRIIVGLLKQNSGSVTISGFQHDTEFEKAMEAVGAIVENPEFYPYLTGWENLKHFAN
FT                   MHKKIADERLDEVVERVGLTSAIHDKVKTYSLGMRQRLGIAQAILHRPKLLILDEPTNG
FT                   LDPAGMKDFRDHIKELAEMEGTAVLFATHLLREVEDLCDRVIIIQKGEIKAEVSLQGTD
FT                   QTTEKAIIEVQPQEKALNWLTGNQYQAESQDGTIVVEVAKENIPELNRSLVGQDLNVFS
FT                   ITPYTQSLEDEFIKATTAHQEEGEELV"
FT   regulatory      36906..36912
FT                   /gene="ydbK"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        36917..37657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbK"
FT                   /note="PROBABLE MEMBRANE SPANNING PROTEIN."
FT                   /db_xref="GOA:P96606"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96606"
FT                   /protein_id="BAA19287.1"
FT                   /translation="MKLFNRKVTLVSLILMAVFQFFMALIIKRIVISAGTDENFIGYLS
FT                   YTPSLNILLQALTIVIAATIVSMEFDKKTIKFLLIRPVKRQKVFWSKLITVVMVSFYLY
FT                   LAYYILALLFGLLFFGTSVTAESKTLLVNTLALIGSNWLEAVMMGLFGLLCSSLFRNSA
FT                   VAVVVSFVVLYGASTLVQLMKLFENKWGSFLLFANTDFTQYRSGETALFSGMTPLFSIG
FT                   ILIIHAIFFIVVGWWCFCKRDVRV"
FT   regulatory      37739..37745
FT                   /gene="ydbL"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        37752..38087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbL"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="GOA:P96607"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96607"
FT                   /protein_id="BAA19288.1"
FT                   /translation="MRNFITALPIVLLLGFSFVSFMFQFEHLVYFRLALGLFSLVGLYM
FT                   IYKMKTGIRYFIIYLYASWIVLAAVTAFEEPIFSSFFFGGLVMTMGYLTYMLIYLGMKQ
FT                   DRDANPV"
FT   regulatory      38204..38210
FT                   /gene="ydbM"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        38215..39360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbM"
FT                   /note="SIMILAR TO ACYL-COA DEHYDROGENASE."
FT                   /db_xref="GOA:P96608"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013107"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96608"
FT                   /protein_id="BAA19289.1"
FT                   /translation="MSLFIQNDQQRQWMEKIGRIADEFQQTAAEDDEQGRFPAEKIQKL
FT                   RDAGYTALTLPASHGGGGISVYDMLLFQERLARGDAPTALSIGWHLSVIGELGEGNSWD
FT                   EDVFAFVAKEVQNGAVINRAATEAKTGSPTRGGRPGTHAVKKDGKWAVNGRKTFTTMSQ
FT                   ALDYFLVTAWIEDKQTTGVFLIHKDDPGLSIEETWDMMAMRATGSHDLVLNEVMLDENK
FT                   LVELLQGPRGAKPNGWLLHIPAIYLGVAQAARDYAVQFASEYSPNSLNGPIKNVPAVQQ
FT                   RTGEMELELLNARHFLFHIAQLYDDPVRRPHLTSELGAAKHIVTNAALSVVDKAMRIVG
FT                   AKSLERTNPLQRYYRDVRAGLHNPPMDDAVIHKLAAEAFES"
FT   regulatory      39362..39386
FT                   /note="PROBABLE RHO-INDEPENDENT TRANSCRIPTIONAL TERMINATOR"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(39385..39564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbN"
FT                   /note="PROBABLE TRANSCRIPTIONAL REGULATORY PROTEIN, SIMILAR
FT                   TO SENS_BACSU."
FT                   /db_xref="InterPro:IPR025004"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96609"
FT                   /protein_id="BAA19290.1"
FT                   /translation="MNTNMSGGRRSMPKRKVKTYQQLIQENKEAIMGNPKLMNVIYDRI
FT                   DRKHQKNLQEQNNT"
FT   regulatory      complement(39571..39577)
FT                   /gene="ydbN"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      39911..39918
FT                   /gene="ydbO"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        39929..40801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbO"
FT                   /note="FUNCTION UNKNOWN, SIMILAR PRODUCT IN B. SUBTILIS AND
FT                   E. COLI."
FT                   /db_xref="GOA:P96610"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96610"
FT                   /protein_id="BAA19291.1"
FT                   /translation="MERTENLKKGEKGALLNIFAYVILAVVKLVIGILYHSEALRADGL
FT                   NNGTDIVASVAVLIGLRISQRPADSDHPYGHYRAETISSLVASFIMMAVGIEVLIGGGK
FT                   AIAGGTTETPNLIAAWTALGSAVFMYGIYLYNKRLAASIKSSALMAAAKDSRSDAFVSA
FT                   GAFIGVFSSQLKLPWVDPVTAFIIGIIICKTAWDIFKDASHSLTDGFHLKDLEPYKQTV
FT                   GRIENVHRLKDVKARYLGSTVHIEMVITVDPKLTVEEGHGVADEVEDKIKHEHDVTHVH
FT                   VHVEPDDIK"
FT   CDS_pept        complement(40816..41136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbP"
FT                   /note="PROBABLE THIOREDOXIN."
FT                   /db_xref="GOA:P96611"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96611"
FT                   /protein_id="BAA19292.1"
FT                   /translation="MKKITTNEQFNELIQSDKEIIVKFYADWCPDCTRMNMFIGDILEE
FT                   YNQNDWYELNKDELPDLAEKYQVMGIPSLLIFKNGEKTAHLHSANAKTPEEVTEFLSEH
FT                   IS"
FT   regulatory      complement(41143..41152)
FT                   /gene="ydbP"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        41311..42375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddlA"
FT                   /product="PROBABLE D-ALANINE--D-ALANINE LIGASE A"
FT                   /EC_number="6.3.2.4"
FT                   /db_xref="GOA:P96612"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96612"
FT                   /protein_id="BAA19293.1"
FT                   /translation="MYGGKSAEHNVSLQTALAVIKALNTEKFDIHPIYITEKGEWVRGA
FT                   RLTEPVSNVKMLQFEQGGSAFSPAALNQEMFPQEASQQNEAIDVVFPLLHGPNGEDGTI
FT                   QGMLELLNIPYVGNGVLASSAGMDKVVMKHLFAQVGLAQAKYAAFLKKDWTRSPKESCE
FT                   EVEQELGYPCFVKPANLGSSVGISKCRNREELQKAFELAFQYDRKVVVEEGINGREIEI
FT                   GVLGNDDPKCSVVGEIAPKTDFYDYKAKYEDGDTDLMIPAIVTDEEYATISDMAIKAFK
FT                   AIDGSGLVRADFFLTADGEVLINEVNTMPGFTPFSMFPLLWKEAGVEYADLIEQLVELA
FT                   KERHAEKQLIKHTF"
FT   regulatory      42430..42439
FT                   /gene="ydbQ"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        42447..43820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbQ"
FT                   /note="PROBABLE UDP-N-ACETYLMURAMOYLALANYL-D-GLUTAMYL-2,
FT                   6-DIAMINOLIGASE (EC 6.3.2.15)."
FT                   /db_xref="GOA:P96613"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96613"
FT                   /protein_id="BAA19294.1"
FT                   /translation="MIKRTVKNIAEMVKGTLANPQYEQTVIHGVATDTRKLEQHQLFIP
FT                   LKGERFDGHSFVEQAFEAGVAAVLWDRSVPNPPENHAVILVDDTLTALQQLAKAYLQEL
FT                   GTRVIGVTGSNGKTTTKDMIHAVLGTQYRVHKTGGNFNNHIGLPLTVLAMPENTEIAVL
FT                   EMGMSAKGEIDLLSRLANPDAAVITNIGESHMQDLGSREGIAEAKLEIINGLKEDGVLI
FT                   YIGDEPLLQNAYSCQTKTYGTGTHNDYQLQDVSQSEEGTHFTIKGIENTFFIPILGKHN
FT                   VMNAMAAIAAGAYFGIAPEDAAKGLSGLKVTGMRLELIKTDSGLSIINDAYNASPTSMK
FT                   AAIQLTESLEGYGKKMLVLGDMLELGDLEETFHKECGAVISPDKIDRVFTYGKLGAFIA
FT                   EGALKHFEKDRVSHYTEKKDLLQAVKENASKGDLILFKASRGMKLEEIVKDLIESPLS"
FT   regulatory      44152..44157
FT                   /gene="ydbR"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        44169..45704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbR"
FT                   /note="ATP-DEPENDENT RNA HELICASE DEAD HOMOLOG."
FT                   /db_xref="GOA:P96614"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030880"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96614"
FT                   /protein_id="BAA19295.1"
FT                   /translation="MVNHDITETAIRRSLNNLTITFQDFNLSSDLMKAINRMGFEEATP
FT                   IQAQTIPLGLSNKDVIGQAQTGTGKTAAFGIPLVEKINPESPNIQAIVIAPTRELAIQV
FT                   SEELYKIGQDKRAKVLPIYGGQDIGRQIRALKKNPNIIVGTPGRLLDHINRRTIRLNNV
FT                   NTVVMDEADEMLNMGFIDDIESILSNVPSEHQTLLFSATMPAPIKRIAERFMTEPEHVK
FT                   VKAKEMTVSNIQQFYLEVQERKKFDTLTRLLDIQSPELAIVFGRTKRRVDELAEALNLR
FT                   GYAAEGIHGDLTQAKRMVALRKFKEGAIEVLVATDVAARGLDISGVTHVYNFDVPQDPE
FT                   SYVHRIGRTGRAGKTGMAMTFITPREKSMLRAIEQTTKRKMDRMKEPTLDEALEGQQQV
FT                   TVERLRTTISENNLNFYMTAAAELLEDHDAVTVVAAAIKMATKEPDDTPVRLTDEAPMV
FT                   SKRYKNQRSSKRRDGQGGGYRGGKGKSNNRSSYDKKRSNDRRSSGDRRQKKSY"
FT   regulatory      45720..45748
FT                   /note="PROBABLE RHO-INDEPENDENT TRANSCRIPTIONAL TERMINATOR"
FT                   /regulatory_class="terminator"
FT   regulatory      45859..45868
FT                   /gene="ydbS"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        45877..46356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbS"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="GOA:P96615"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96615"
FT                   /protein_id="BAA19296.1"
FT                   /translation="MREQPKNQISPDGLKVWRLQEIIISAVCLLIVIAVAVLSYYFHWP
FT                   YWISGVLGAVWLLGSIVTVFIIPKVRHKVWRYEVHEHEIDIQSGIFVVTRVIVPMVRVQ
FT                   HVDTSQGPLLKKYNLATVKISTAATVHSIPALEMEEADRLRDSISRLARVTDDDV"
FT   regulatory      46332..46339
FT                   /gene="ydbT"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        46346..47827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydbT"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="GOA:P96616"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="InterPro:IPR014529"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96616"
FT                   /protein_id="BAA19297.1"
FT                   /translation="MMSEPKRLHPVAVILNLCHTIIQTIKNIILPFFFVYIVNSNHTVR
FT                   FYGAIALGVLFIWLVAASIIKWRRFTYRIEDDEFRIEEGLFVTKKRYISIDRIQTMNTS
FT                   AGLVQQIFKLVKLQIETAGGGKEAEAVLSAISVEEAERIKEAVFKKKAQRRENELDEER
FT                   LEAEEELDPSVEVQEHYRMNAKELLMAASTSGGIGVIISAVFALISQLDEVLPMDWLFD
FT                   KFSFLQHASIGIYAVLIFIGLFIAWIFSIAGMMFRYANFQIIKKEQELVISRGIIEKHQ
FT                   VTIPLRKIQAIKIKENIIRQLFGFVTVSIVSAGGGDREKEEGALTILFPMIHKKKLPHM
FT                   LRTFTPEYTLEENCRRLPRRALKRYLFRSVIFSLFLIIPLCIFFQPWGYLSVILLPIEL
FT                   LFGYLAYKEAAWTINGDRLQLTSRFIGRTTAIVLKKRMQVCKFSQSYFQKKGRLYTIST
FT                   SVKSSSHMEELTVRDVGEEDAAFILKWYSYEKADG"
FT   CDS_pept        complement(48079..48678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcA"
FT                   /note="FUNCTION UNKNOWN, SIMILAR PRODUCT IN H. INFLUENZAE
FT                   AND SYNECHOCYSTIS."
FT                   /db_xref="GOA:P96617"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96617"
FT                   /protein_id="BAA19298.1"
FT                   /translation="MFIRTENFQTFIRLYPVVTFILALQAVLWLFFSLPAHSVVLWRDT
FT                   VTGYNLGVANGEWWRLITPILLHAGFTHLLFNSMSIFLFAPALERMLGKARFLLVYAGS
FT                   GIIGNIGTYVTEPLDYVHVGASGAIFGLFGVYLFMVLFRNELIGQEHSKMIITLLAFAV
FT                   LMSFINSNINMMAHLFGLCGGFLLSFLCVQKKERRY"
FT   regulatory      complement(48685..48691)
FT                   /gene="ydcA"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      48756..48764
FT                   /gene="ydcB"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        48773..49138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcB"
FT                   /note="FUNCTION UNKNOWN, SIMILAR PRODUCT IN E. COLI AND
FT                   MYCOPLASMA PNEUMONIAE."
FT                   /db_xref="GOA:P96618"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="PDB:1F7L"
FT                   /db_xref="PDB:1F7T"
FT                   /db_xref="PDB:1F80"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96618"
FT                   /protein_id="BAA19299.1"
FT                   /translation="MIYGIGLDITELKRIASMAGRQKRFAERILTRSELDQYYELSEKR
FT                   KNEFLAGRFAAKEAFSKAFGTGIGRQLSFQDIEIRKDQNGKPYIICTKLSQAAVHVSIT
FT                   HTKEYAAAQVVIERLSS"
FT   regulatory      49183..49189
FT                   /gene="ydcC"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        49199..50320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcC"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="GOA:P96619"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96619"
FT                   /protein_id="BAA19300.1"
FT                   /translation="MRLLWYASVLPKRVPSVPLKSNKRFLPFTSIEKKGLKKVRKSFVL
FT                   LLTGLLAVLILSACGQKTQQDIVAGLDEKAKEYTSYKAKAKMTIETGSEPQVYNVEIWH
FT                   KKPSLYRVYLENPKKDQNQVILRNENGVFVLTPSLNKSFRFQSDWPNNSSQVYLFESLV
FT                   KDVQNDSDAVFTAKEKKYVFETKTNYQHNKMLPTQEITFNKKDMSPSSVKVMDTDRKVM
FT                   VKVEFSSFEFNKQFDKESFDEKKNMTLSQMDVATSAKPSDTFAVKTPLELPLGVKLLEE
FT                   KDISTEDGKRIIMTYGGEKSFTLIQEKAQIAKASSSVTLNGEPVNLGYTIGALSDASLS
FT                   WTYDGVDYLLSSKDLSKEEMVTVAKSMQGQSSK"
FT   regulatory      50326..50354
FT                   /note="PROBABLE RHO-INDEPENDENT TRANSCRIPTIONAL TERMINATOR"
FT                   /regulatory_class="terminator"
FT   regulatory      50422..50429
FT                   /gene="alr"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        50435..51604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alr"
FT                   /product="ALANINE RACEMASE"
FT                   /EC_number="5.1.1.1"
FT                   /db_xref="GOA:P10725"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/Swiss-Prot:P10725"
FT                   /protein_id="BAA19301.1"
FT                   /translation="MSTKPFYRDTWAEIDLSAIKENVSNMKKHIGEHVHLMAVVKANAY
FT                   GHGDAETAKAALDAGASCLAVAILDEAISLRKKGLKAPILVLGAVPPEYVAIAAEYDVT
FT                   LTGYSVEWLQEAARHTKKGSLHFHLKVDTGMNRLGVKTEEEVQNVMAILDRNPRLKCKG
FT                   VFTHFATADEKERGYFLMQFERFKELIAPLPLKNLMVHCANSAAGLRLKKGFFNAVRFG
FT                   IGMYGLRPSADMSDEIPFQLRPAFTLHSTLSHVKLIRKGESVSYGAEYTAEKDTWIGTV
FT                   PVGYADGWLRKLKGTDILVKGKRLKIAGRICMDQFMVELDQEYPPGTKVTLIGRQGDEY
FT                   ISMDEIAGRLETINYEVACTISSRVPRMFLENGSIMEVRNPLLQVNISN"
FT   regulatory      51705..51711
FT                   /gene="ydcD"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        51720..52001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcD"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="GOA:P96621"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="PDB:4ME7"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96621"
FT                   /protein_id="BAA19302.1"
FT                   /translation="MSESSARTEMKISLPENLVAELDGVAMREKRSRNELISQAVRAYV
FT                   SERTTRHNRDLMRRGYMEMAKINLNISSEAHFAECEAETTVERLVSGG"
FT   regulatory      51993..51997
FT                   /gene="ydcE"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        52006..52356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcE"
FT                   /note="FUNCTION UNKNOWN, SIMILAR PRODUCT IN MYCOBACTERIUM
FT                   TUBERCULOSIS AND STAPHYLOCOCCUS AUREUS."
FT                   /db_xref="GOA:P96622"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="PDB:1NE8"
FT                   /db_xref="PDB:4MDX"
FT                   /db_xref="PDB:4ME7"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96622"
FT                   /protein_id="BAA19303.1"
FT                   /translation="MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVA
FT                   AITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQIRTIDKQRLTDKITHLDDEMMDKVD
FT                   EALQISLALIDF"
FT   regulatory      52369..52394
FT                   /note="PROBABLE RHO-INDEPENDENT TRANSCRIPTIONAL TERMINATOR"
FT                   /regulatory_class="terminator"
FT   regulatory      52457..52462
FT                   /gene="orfR"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        52471..53295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orfR"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="GOA:P42409"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR014792"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="PDB:2BNL"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42409"
FT                   /protein_id="BAA19304.1"
FT                   /translation="MMSNQTVYQFIAENQNELLQLWTDTLKELSEQESYQLTDQVYENI
FT                   SKEYIDILLLSVKDENAAESQISELALRAVQIGLSMKFLATALAEFWKRLYTKMNDKRL
FT                   PDQESTELIWQIDRFFSPINTEIFNQYSISWEKTVSLQKIALQELSAPLIPVFENITVM
FT                   PLVGTIDTERAKRIMENLLNGVVKHRSQVVLIDITGVPVVDTMVAHHIIQASEAVRLVG
FT                   AKCLLAGIRPEIAQTIVNLGIDLSQVITKNTLQKGIQTALEMTDRKIVSLGE"
FT   regulatory      53286..53290
FT                   /gene="orfS"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        53300..53665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orfS"
FT                   /product="SIGMA-B REGULATOR"
FT                   /db_xref="GOA:P42410"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42410"
FT                   /protein_id="BAA19305.1"
FT                   /translation="MRHPKIPILKLYNCLLVSIQWELDDQTALTFQEDLLNKIYETGAN
FT                   GVVIDLTSVDMIDSFIAKVLGDVITMSKLMGAKVVLTGIQPAVAVTLIELGIALEEIET
FT                   ALDLEQGLETLKRELGE"
FT   regulatory      53656..53660
FT                   /gene="orfT"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        53669..54070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orfT"
FT                   /product="SIGMA-B REGULATOR"
FT                   /db_xref="GOA:P42411"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:P42411"
FT                   /protein_id="BAA19306.1"
FT                   /translation="MNDQSCVRIMTEWDIVAARQLGRNVAKELGFGTVDQARITTAISE
FT                   LARNIYLYAGKGQIGIEQVADRGKKGLKIIAEDQGPGIPDIRKVMEDGFSTSGGLGAGL
FT                   PGVKRLMDEFSLNSVAGEGTEIQAIKWLR"
FT   regulatory      54069..54075
FT                   /gene="rsbU"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        54082..55089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbU"
FT                   /product="SIGMA FACTOR SIGB REGULATION PROTEIN RSBU"
FT                   /note="SIMILAR PRODUCT IN SYNECHOCYSTIS."
FT                   /db_xref="GOA:P40399"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014787"
FT                   /db_xref="InterPro:IPR017944"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="PDB:1W53"
FT                   /db_xref="PDB:2J6Y"
FT                   /db_xref="PDB:2J6Z"
FT                   /db_xref="PDB:2J70"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40399"
FT                   /protein_id="BAA19307.1"
FT                   /translation="MDFREVIEQRYHQLLSRYIAELTETSLYQAQKFSRKTIEHQIPPE
FT                   EIISIHRKVLKELYPSLPEDVFHSLDFLIEVMIGYGMAYQEHQTLRGIQQEIKSEIEIA
FT                   ANVQQTLLGTKVPQEEALDIGAISVPAKQMSGDYYHFVKDKESINIAIADVIGKGIPAA
FT                   LCMSMIKYAMDSLPETGIHPSQVLKNLNRVVEQNVDASMFITMFYANYNMDKHQFTYAS
FT                   AGHEPGFYYSQKDNTFYDLEAKGLVLGISQDYDYKQFDQHLEKGDMIVLFSDGVTECRT
FT                   ENGFLERPDLQKLIEEHMCSSAQEMVKNIYDSLLKLQDFQLHDDFTLIVLRRKV"
FT   regulatory      55139..55145
FT                   /gene="rsbV"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        55151..55480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbV"
FT                   /product="ANTI-SIGMA B FACTOR (RSBW) ANTAGONIST"
FT                   /note="SIMILAR PRODUCT IN SYNECHOCYSTIS."
FT                   /db_xref="GOA:P17903"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/Swiss-Prot:P17903"
FT                   /protein_id="BAA19308.1"
FT                   /translation="MNINVDVKQNENDIQVNIAGEIDVYSAPVLREKLVPLAEQGADLR
FT                   ICLKDVSYMDSTGLGVFVGTFKMVKKQGGSLKLENLSERLIRLFDITGLKDIIDISAKS
FT                   EGGVQ"
FT   regulatory      55462..55469
FT                   /gene="rsbW"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        55477..55959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbW"
FT                   /product="ANTI-SIGMA B FACTOR (SIGMA-B NEGATIVE EFFECTOR
FT                   RSBW)"
FT                   /db_xref="GOA:P17904"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010193"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:P17904"
FT                   /protein_id="BAA19309.1"
FT                   /translation="MKNNADYIEMKVPAQPEYVGIIRLTLSGVASRMGYTYDEIEDLKI
FT                   AVSEACTNAVQHAYKEDKNGEVSIRFGVFEDRLEVIVADEGDSFDFDQKQQDLGPYTPS
FT                   HTVDQLSEGGLGLYLMETLMDEVRVQNHSGVTVAMTKYLNGERVDHDTTIKNYETN"
FT   regulatory      55909..55914
FT                   /gene="sigB"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        55919..56713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigB"
FT                   /product="RNA POLYMERASE SIGMA-B FACTOR (SIGMA-37)"
FT                   /db_xref="GOA:P06574"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014288"
FT                   /db_xref="InterPro:IPR014322"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/Swiss-Prot:P06574"
FT                   /protein_id="BAA19310.1"
FT                   /translation="MIMTQPSKTTKLTKDEVDRLISDYQTKQDEQAQETLVRVYTNLVD
FT                   MLAKKYSKGKSFHEDLRQVGMIGLLGAIKRYDPVVGKSFEAFAIPTIIGEIKRFLRDKT
FT                   WSVHVPRRIKELGPRIKMAVDQLTTETQRSPKVEEIAEFLDVSEEEVLETMEMGKSYQA
FT                   LSVDHSIEADSDGSTVTILDIVGSQEDGYERVNQQLMLQSVLHVLSDREKQIIDLTYIQ
FT                   NKSQKETGDILGISQMHVSRLQRKAVKKLREALIEDPSMELM"
FT   regulatory      56699..56705
FT                   /gene="rsbX"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        56713..57312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsbX"
FT                   /product="SIGMA-B NEGATIVE EFFECTOR (ORF X IN SIGB REGION)"
FT                   /db_xref="GOA:P17906"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR039248"
FT                   /db_xref="PDB:3W40"
FT                   /db_xref="PDB:3W41"
FT                   /db_xref="PDB:3W42"
FT                   /db_xref="PDB:3W43"
FT                   /db_xref="PDB:3W44"
FT                   /db_xref="PDB:3W45"
FT                   /db_xref="UniProtKB/Swiss-Prot:P17906"
FT                   /protein_id="BAA19311.1"
FT                   /translation="MIQVEENEHIQTLVYQLNKEGKSICGDSFFMKADDKELICAVADG
FT                   LGSGSLANESSAAIKDLVENYASEDVESIIERCNQAMKNKRGATASILKINFEQRQFTY
FT                   CSVGNVRFILHSPSGESFYPLPISGYLSGKPQKYKTHTATYEKGSKFIIHTDGLNVPDI
FT                   RSHLKKGQSVEEISNSLKMYTTSRKDDLTYILGQLS"
FT   regulatory      57321..57353
FT                   /note="PROBABLE RHO-INDEPENDENT TRANSCRIPTIONAL TERMINATOR"
FT                   /regulatory_class="terminator"
FT   regulatory      57539..57544
FT                   /gene="ydcF"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        57555..57848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcF"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96623"
FT                   /protein_id="BAA19312.1"
FT                   /translation="MERKEHCFCKEKQFSYGLSMWRNIGRFLSWSTCPHSNVIMEFFHV
FT                   LQKQKEDLCITYGIVLEGAEAKKWGEIIGTELSKDMPTAVSRLVHLYGGVIK"
FT   regulatory      57833..57840
FT                   /gene="ydcG"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        57845..58285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcG"
FT                   /note="FUNCTION UNKNOWN, SIMILAR PRODUCT IN BACILLUS
FT                   LICHENIFORMIS."
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR022996"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96624"
FT                   /protein_id="BAA19313.1"
FT                   /translation="MNTNYWIGVVSEQHVLKGAAGGFAQLCHGKKAPLAKMKEGDWLIY
FT                   YSPRDAYPDGKLLRSFTAIGKVKSGNIYPYQMAPNFIPYRLDIDYYPCHKIGFYDIKSK
FT                   LEFVQETKHLGFLFRRGHFEISKKDFLTIAQAMGVNISGMAL"
FT   regulatory      58253..58260
FT                   /gene="ydcH"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        58269..58712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcH"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="GOA:P96625"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96625"
FT                   /protein_id="BAA19314.1"
FT                   /translation="MEWHSKFSGPNTSPGFLLWQATQSWQRKVGKALAEFDLTHVQFVL
FT                   LTSCKYMIAHGETVTQKKLASFSQTNIMMVSEVVRTLEKKGFIERSKNPQDKREVLLSL
FT                   TEIGGEKVTAALPIVEKIDQAFFAAAMKKENFLSGLQELLKHE"
FT   regulatory      58791..58795
FT                   /gene="ydcI"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        58806..60818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcI"
FT                   /note="FUNCTION UNKNOWN, SIMILAR PRODUCT IN E.COLI, H.
FT                   INFLUENZAE AND NEISSERIA MENINGITIDIS."
FT                   /db_xref="GOA:O31489"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31489"
FT                   /protein_id="BAA19315.1"
FT                   /translation="METSALLKQQIAKEIGLSQKHVESVIRLLEDGNTVPFIARYRKEQ
FT                   TGSMDEVQIQTISERWQYIQNLNQRKEEVIRLIAEQDKLTDNLKRKIEQSVKLQEVEDL
FT                   YRPYKQKRKTKATVAKSKGLEPLADYILTLPQDDHLAATADQYISEEKEVFTREEAIEG
FT                   AKHIIAEQISDEPTFRKWIRQETFKRGTIKSAAGKSADTDEKNVYEMYYEYEEPIAKVV
FT                   PHRVLAMNRGEKEDILKVAIEPPADHIKAYLEKQIIKNRSTSVREILQETIEDSYKRLI
FT                   QPAIEREIRKELSEKADEQAIHIFSENLRKLLLQPPMKGKTVLGVDPAFRTGCKLAVSD
FT                   ETGKVLKIDVIYPHAPVNKTKEAHEKVKKILEQYQVEMVAIGNGTASRETEQFIVNVLR
FT                   DMPRKIYYVIYPHAPVNKTKEAHEKVKKILEQYQVEMVAIGNGTASRETEQFIVNVLRD
FT                   MPRKIYYVIVNEAGASVYSASELAREEFPDLKVEERSAVSIARRLQDPLAELVKIDPKS
FT                   VGVGQYQHDVSQKRLNESLRFVVETVVNQVGVNVNTASAALLQYVAGLSKSVAGNVVKK
FT                   REEIGKFSNRKELKDIPRLGAKTYEQCIGFLRVQEGTEPLDRTGIHPESYKETKALLKK
FT                   LGLSTEHIGTAELKDKINQWRSLKRQKSWESAKSL"
FT   regulatory      60750..60754
FT                   /gene="ydcJ"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        60767..61138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcJ"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="GOA:O31489"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31489"
FT                   /protein_id="BAA19316.1"
FT                   /translation="MALSETAKELGIGEITLKDICEQLTRPERDPRDKVPKPLLKTDVL
FT                   QLEDLKEGMELQGTVRNVVDFGAFVDIGVKQDGLVHISKLSNQFVKHPLDVVSVGDIVT
FT                   VWVDGVDVQKGRVSLSMVK"
FT   regulatory      61137..61165
FT                   /note="PROBABLE RHO-INDEPENDENT TRANSCRIPTIONAL TERMINATOR"
FT                   /regulatory_class="terminator"
FT   regulatory      61351..61360
FT                   /gene="ydcK"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        61365..61817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcK"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="GOA:P96628"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="InterPro:IPR023524"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96628"
FT                   /protein_id="BAA19317.1"
FT                   /translation="MDNKELQKLTEDISETYFKKPFRHQALFNDRLKTTGGRYLLTSHN
FT                   IELNRKYLIEHGREELIGIIKHELCHYHLHLEGKGYKHRDRDFRMLLQQVNAPRFCTPL
FT                   KKKAENKKTYMYICTTCGQQYIKKRAMNPDRYRCGKCRGKIKRIFS"
FT   tRNA            61940..62014
FT                   /product="tRNA-Asn"
FT   tRNA            62019..62109
FT                   /product="tRNA-Ser"
FT   tRNA            62139..62210
FT                   /product="tRNA-Glu"
FT   tRNA            62222..62296
FT                   /product="tRNA-Gln"
FT   tRNA            62323..62398
FT                   /product="tRNA-Lys"
FT   tRNA            62410..62491
FT                   /product="tRNA-Leu"
FT   tRNA            62572..62655
FT                   /product="tRNA-Leu"
FT   regulatory      62662..62695
FT                   /note="PROBABLE RHO-INDEPENDENT TRANSCRIPTIONAL TERMINATOR"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(62741..63847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcL"
FT                   /note="PROBABLE INTEGRASE."
FT                   /db_xref="GOA:P96629"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96629"
FT                   /protein_id="BAA19318.1"
FT                   /translation="MSVKKLENGQYQVDVSFGFDPITGERIRTRPVASTRKEALELEAK
FT                   LRREFQEERARKSRSVSFPTLISIYLASCEIDSKPNYYQNQKYIINKHISDYFLKSDIQ
FT                   KITHREITDFRKHLMETGLSNKSVNNIMTSLSKIFDTAVHEEILKRNPCDNVKRLPLTR
FT                   KKMKFWRPEEFKKFISLIPQDQLLFKTFYTVAFLTGLRCGEMLALQWKDIDKILLEIDV
FT                   HKSCTWLDGQFVVTTPKTKNSIRRVSINKKLLKLLERWKEAQEELFNELGIRHSHDTYI
FT                   FQYKDTPSRKDIFSRKIKYFCKDSDLTPIRLHDFRHSHVALLIHQGEDYITIKERLGHG
FT                   SVKTTIDVYGHLYPNKQKEMADKLDDLL"
FT   regulatory      complement(63855..63861)
FT                   /gene="ydcL"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(63860..64369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcM"
FT                   /note="SIMILAR TO IMMUNITY REGION PROTEIN IN BACTERIOPHAGE
FT                   PHI-105."
FT                   /db_xref="GOA:P96630"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96630"
FT                   /protein_id="BAA19319.1"
FT                   /translation="MITIYTSKGIKHKVQSVIKTHGTNNVYEICDIQKIYILKNDLGQA
FT                   NGLLQHDKATDQYLIHINENLQHQQFVIAHELGHYFLHKRLNTFKVVNCSKVLKDKLEH
FT                   QASLFASELILTDKMLNEALPYIQGFSKEQIAAYFNVPSFVTDYKLSQIGSFSNRIYSH
FT                   EISAFG"
FT   CDS_pept        complement(64366..64749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcN"
FT                   /note="PROBABLE REPRESSOR PROTEIN."
FT                   /db_xref="GOA:P96631"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96631"
FT                   /protein_id="BAA19320.1"
FT                   /translation="MSLGKRLKEARQKAGYTQKEAAEKLNIGNNNLSNYERDYRDPDTD
FT                   TLLKLSNLYNVSTDYLLGKDEVSKKNETDLLNKTINEAIQELKDEDTLLFMNDGEFDEE
FT                   TARLVKKALKNGIKFIDELKKKE"
FT   regulatory      complement(64759..64767)
FT                   /gene="ydcN"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      65514..65521
FT                   /gene="ydcO"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        65528..65788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcO"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="UniProtKB/Swiss-Prot:P96632"
FT                   /protein_id="BAA19321.1"
FT                   /translation="MKIRVNATIITDVEALKADKDLNHFKDYATCETFVVDADNHLKAN
FT                   EEISELLKGWDWWCIWSTRPLSKKDNQVFTLYNDDLYNLCR"
FT   regulatory      66141..66154
FT                   /gene="ydcP"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        66158..66538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcP"
FT                   /note="SIMILAR TO ORF22 AND ORF23 OF ENTEROCOCCUS FAECALIS
FT                   TRANSPOSON TN916."
FT                   /db_xref="InterPro:IPR010365"
FT                   /db_xref="InterPro:IPR038620"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96633"
FT                   /protein_id="BAA19322.1"
FT                   /translation="MNLNFIVPDINMTFGDMKFMGLNRERYVYDRENNKRTDVLESRIY
FT                   NIASAVQGGQIEVTIPEYAGAKEIPPFADIELKNPKISAMATSQRDSTYANVMWKLEAD
FT                   DIVVKGGSSVKPAAATGGNEKK"
FT   regulatory      66559..66568
FT                   /gene="ydcQ"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        66574..68016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcQ"
FT                   /note="SIMILAR TO ORF21 OF ENTEROCOCCUS FAECALIS TRANSPOSON
FT                   TN916."
FT                   /db_xref="GOA:P96634"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96634"
FT                   /protein_id="BAA19323.1"
FT                   /translation="MSDFLNKRFWKYRGKRIRPYMRNNVKLAGAIIFVPVFLLSMFLFW
FT                   REQLIHFDLSQVIKNFEWNVPLIIKSVLCSVLIAVGSIVASYFLLFDSYKKILHRQKIA
FT                   KMIFSNKFYEKENVKVRKIFSNETDSKEKITYFPRMYYQVKNNHIYIRIAMDMSRFQNR
FT                   FLDLGKDLENGLFCDLVDKQMEEGFVCFKLLYDVKKNRISIDDAVAENGVLPLMKHISW
FT                   QFDKLPHMLIAGGTGGGKTYFMLTIIKACVGLGADVRILDPKNADLADLEEVLPKKVYS
FT                   QKNGILMCLRKSVDGMMERMDEMKQMSNYKTGENYAYLGLKPVFIFFDEYVAFMDLLDM
FT                   KERNEALSYMKQLVMLGRQAGYFLVLGAQRPDAKYLADGIRDQFSFRVSLGLMSDTGYG
FT                   MMFGDVEKAYVNKKETGRGYANVGTGSVLEFYSPIVPKGYDFMSSIKNALVGVEGAQAT
FT                   AVASGSVSDQTASGEGVSEANG"
FT   regulatory      67991..67999
FT                   /gene="ydcR"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        68009..69067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcR"
FT                   /note="SIMILAR TO ORF20 OF ENTEROCOCCUS FAECALIS TRANSPOSON
FT                   TN916."
FT                   /db_xref="GOA:P96635"
FT                   /db_xref="InterPro:IPR003491"
FT                   /db_xref="InterPro:IPR040819"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96635"
FT                   /protein_id="BAA19324.1"
FT                   /translation="MDELKQPPHANRGVVIVKEKNEAVESPLVSMVDYIRVSFKTHDVD
FT                   RIIEEVLHLSKDFMTEKQSGFYGYVGTYELDYIKVFYSAPDDNRGVLIEMSGQGCRQFE
FT                   SFLECRKKTWYDFFQDCMQQGGSFTRFDLAIDDKKTYFSIPELLKKAQKGECISRFRKS
FT                   DFNGSFDLSDGITGGTTIYFGSKKSEAYLCFYEKNYEQAEKYNIPLEELGDWNRYELRL
FT                   KNERAQVAIDALLKTKDLTLIAMQIINNYVRFVDADENITREHWKTSLFWSDFIGDVGR
FT                   LPLYVKPQKDFYQKSRNWLRNSCAPTMKMVLEADEHLGKTDLSDMIAEAELADKHKKML
FT                   DVYMADVADMVV"
FT   regulatory      69321..69326
FT                   /gene="ydcS"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        69332..69601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcS"
FT                   /note="SIMILAR TO YDCT GENE PRODUCT OF THIS ENTRY
FT                   (YDCT_BACSU)."
FT                   /db_xref="UniProtKB/Swiss-Prot:P96636"
FT                   /protein_id="BAA19325.1"
FT                   /translation="MHNVNLLNQAGLENALESVGCLDIVEDLIEKMQEYVLYHTETAER
FT                   FAIDIFTVVNNYTKKVHAIFNVLENEDGETNVKNVEFEVMHFTE"
FT   regulatory      69624..69630
FT                   /gene="ydcT"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        69640..69906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydcT"
FT                   /note="SIMILAR TO YDCS GENE PRODUCT OF THIS ENTRY
FT                   (YDCS_BACSU)."
FT                   /db_xref="UniProtKB/Swiss-Prot:P96637"
FT                   /protein_id="BAA19326.1"
FT                   /translation="MFNINLLNQARLESDLDSLGCLDIAEELIEKMMEDVFYSDVAQRI
FT                   IVQTLAVINNANAKLQATFNILEDEDMETDERSVEFEGISYYE"
FT   regulatory      69905..69913
FT                   /gene="yddA"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        69923..70231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yddA"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="UniProtKB/Swiss-Prot:P96638"
FT                   /protein_id="BAA19327.1"
FT                   /translation="MSAVDKRFKSLGFNVGIPSLVFVRSLSRDCMLVVEGERVKGFAEY
FT                   RYTFYKTRYLPDGRMTSLKVYMENQSIKRVLHRVASFLSFLERTKQIEQKECEKVAQ"
FT   regulatory      70205..70210
FT                   /gene="yddB"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        70212..71285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yddB"
FT                   /note="SIMILAR TO ORF13 OF ENTEROCOCCUS FAECALIS TRANSPOSON
FT                   TN916."
FT                   /db_xref="GOA:O31491"
FT                   /db_xref="InterPro:IPR024735"
FT                   /db_xref="InterPro:IPR035628"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31491"
FT                   /protein_id="BAA19328.1"
FT                   /translation="MKKLLNKEIGSDKKEESFFRSAFQKLKRIERPEKDKQKVPRDRSK
FT                   LIAVTLWSCVGSLLFICLLAVLLSINTRSQLNDMKDETNKPTNDDKQKISVTAAENFLS
FT                   GFINEYMNVKNDQESIEKRMQSLESYMVKQEDNHFEDEERFNVDGLKGDRELKGYSLYN
FT                   VKEGDKNSLFQYKVTYENLYPVEKEVEKEVKDGKKKKKVKEKVKTNEKYEKQMLLNIPV
FT                   TNKGDSFAVSAVPYFTQIYDLKGDIAFKGKEETRDEYAGEKKESIESFLQNFFEKYASE
FT                   KKEEMVYMMKKPEALEGNLLFGEVQSVKIFETKKGFEVFCAVRFKEKENDIPVNEKFSL
FT                   EITENSGQFYVNKLKHQ"
FT   regulatory      71284..71290
FT                   /gene="yddC"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        71297..71545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yddC"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="GOA:P96640"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96640"
FT                   /protein_id="BAA19329.1"
FT                   /translation="MDFMNFFILGADLPTLGGVKGWASDVVIQFITIVVMFIAAKNLMK
FT                   LKMGGIIFVCCIGSAVTWVIKHWSEFSGWINALMEKL"
FT   regulatory      71544..71549
FT                   /gene="yddD"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        71558..72082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yddD"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="GOA:P96641"
FT                   /db_xref="InterPro:IPR025608"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96641"
FT                   /protein_id="BAA19330.1"
FT                   /translation="MGRLVFNYRKAMREPKKIQQLTENYSLPFAVELIPAINYFIFVGL
FT                   CFGFWYGVRMIFPHAFDNSYVIVIFGIPFFLTMLVTKIKPEGKNIYIYFFDFAKYYFFI
FT                   KLPQKKYCNDRKIDLSNEKQIEFRKLVKVVDYSNETKNAYEGNTQEFAVNKNGRRVGVL
FT                   PNKKQFDSYAK"
FT   regulatory      71951..71959
FT                   /gene="yddE"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        71970..74465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yddE"
FT                   /note="SIMILAR TO ORF16 OF ENTEROCOCCUS FAECALIS TRANSPOSON
FT                   TN916."
FT                   /db_xref="GOA:P96642"
FT                   /db_xref="InterPro:IPR016628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96642"
FT                   /protein_id="BAA19331.1"
FT                   /translation="MRLKTPMKAIHKNLLLTRTGDVWAYYRIKSNSIPMQNKEKVESYK
FT                   KKWQHLFEEITSYEDFHLMMYPSEYELEKRFKDLETDIAADAMDVARYYNEETVRLLEQ
FT                   RLGRLTKYDFILGVKLKSSLVNISVELKDNILSFFNTATDTVVKMLGWEQNVSTSFFEK
FT                   YEEVEETLANIMASVRGERLSETEMTYINRYHFVRGLKHQTNEESEIKDVRSITNTIID
FT                   PTDPSVLHLHSDQDEGYSAFVVIDEFLHNMSESDLFYEAQSLPFPVEVQMKIQTESKSI
FT                   TKPALNLKRQQLKEEQKEQQSTGDRSDVSTVTSATMIRHLQDEIKKEDVHVMNWLSVIV
FT                   VHGKTKKECVGKATIVKRHLKGAGITCRLPVADQLNLFYKMLPGEKLDITDKNWIQKTT
FT                   QDGVAESLFAVNSDIGSKIGFFLGWVDRFQEHTDLESAIMSSRDFVLFHPFLANQQLKG
FT                   SKTRSPHCLITGDTGNGKSYLAKLIFNYISMLNIKSLYIDPKKEMRKWIQRVLNDEYIR
FT                   ENFPLYIAHLEKYNYITLDHENTHNWGALDPISFLPPMKAKELVQVIFEQVYDFKGKDD
FT                   INTAFLRATSEVIDAKQKGEQVGSLDIIRKMQSHPEEAVQKAGDYLNEVVSDSILKLCI
FT                   HDGSNPALSLEKRITILEVENMDLPDHAERLENYTISQLKSSAVMFALGKFCELFGMNQ
FT                   DEQTVEFIDEAWIFTTSQQGKKVERQMRRIGRSYNNAEYFISQSTKDALKEEDSGNFGV
FT                   AFAFDEPNEREEVLKWMNMEVTKDNKKMMESMFQGQCLFKDYYGRTSKISIECLFEEWQ
FT                   GALKTVEKKAVAYAEEKYL"
FT   regulatory      74466..74476
FT                   /gene="yddF"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        74484..74810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yddF"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="InterPro:IPR015055"
FT                   /db_xref="InterPro:IPR037236"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96643"
FT                   /protein_id="BAA19332.1"
FT                   /translation="MEIAFLNSLVVTSPGFYKAEKITLDEVKQWLKHYDGRYKSFIGHK
FT                   STAQFLQKLLGIRIEQNRKTFRHMKYQKAICFSLYERYPENVLLTQRDLEKARYQFYLL
FT                   TRLD"
FT   regulatory      74809..74816
FT                   /gene="yddG"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        74814..77261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yddG"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="GOA:P96644"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96644"
FT                   /protein_id="BAA19333.1"
FT                   /translation="MVVMKKKRILIVSAIVLLFLTVASAVTVFSADGDTTTQPKVEKAG
FT                   GVELKVKRFPISRYQANNEASDDLIKGAFVGLTNVTFSFAGNIVRVVDTGMDILYNLQP
FT                   IDEFANSITNVSKTVYKTLKKNFGEALFIFTCAYVVYLFCVRGSVKEAMRRSILFICVM
FT                   VIGGLWMSNAGYYMKVLNALSVEAQGKLLTAGNGLVGIVQDEGNFADSSAIEKGKEMEG
FT                   TVAVMRNLYFDIALMKPFLIVNFDETSEKKINEEDTDKGGLNRIDKLLSYKLSEDGEKD
FT                   KKDYIKETEIDDYKNESMTSGNVFNQLGESFIAVVASIVIGIPFLALAFFNFLLQVVAL
FT                   VIVFFVPFAFILAYVPQLAYSGFVTLGRLGSVYLLKAMLGVIVLFVYVTCFIVDKLIPP
FT                   NGFGMYLLNVAVLASILWIGFHKRDAIIKFVTAGKVVSVDNNMMENMRQNIVQPAWEQA
FT                   KKIGGVWGNGGGVFTDFTKHFGGRKDGSNADGVTGAPSGGGNSPSGTAMGYDNTHAISR
FT                   TPQKETANGIANHNSRSLKRNPQTLSKEQEKQKQKEAFANAKENKQQSHLARLRKDGIN
FT                   SPMLKDALNEGNEDLSKRAPILQDKKDESARTDQKEYVEQLLKQPNNQQQTDDASLQHE
FT                   EESTSNRAPVLQENEKDTERTDQKAYIYDEQNQNLETDQQQDFEVQKDDSVSNSEPVAQ
FT                   EKTAEIKRSDQKVMMNQPEPQLGFESPQSTKVENQPIANNERKIRPSEPAKVHSDGIRV
FT                   DEKQAVAPAENKTVSREKQPSSQTIKRTEQSVNSFDQVSLNEIARRSSSKVEDRLRRDE
FT                   RTR"
FT   regulatory      77240..77248
FT                   /gene="yddH"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        77258..78247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yddH"
FT                   /note="SIMILAR TO ORF14 OF ENTEROCOCCUS FAECALIS TRANSPOSON
FT                   TN916."
FT                   /db_xref="GOA:P96645"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96645"
FT                   /protein_id="BAA19334.1"
FT                   /translation="MISKKVVLPLVFSAPFIFFFVLCIVVVMTISRENQVGDDFIGGGD
FT                   GEYETVGIAPEVERFRAVFEKYARQEGVFDQVNIIMALTMQESGGRSLDIMQSSESIGL
FT                   PPNSITDPERSIEVGIKHFKKVFKQAGGDVRLTLQAYNFGSGFIDYVKKNGGKYTKKLA
FT                   LDFSRLQAFKMGWKSYGDPSYVDHVMRYVKGSDKNVKPVKGSMDFYETVMKEALKYEGQ
FT                   PYAWGGSNPETGFDCSGLVQWSFAKAGITLPRTAQEQHGATKKISEKEATAGDLVFFGG
FT                   TYEGKAITHVGIYVGNGRMFNSNDSGIQYSDLKSGYWRDHLVSFGRIK"
FT   regulatory      78250..78257
FT                   /gene="yddI"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        78262..78768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yddI"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="GOA:P96646"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96646"
FT                   /protein_id="BAA19335.1"
FT                   /translation="MKTHIAWASACLLLVMLTGFFTIGQQTYKIEKLKDKNEVLSEKIK
FT                   ELNHIESTSSASENKAFFEAFFNYSDIDIRYETVKKHTTGKGFDYAFPSRSDQKHTVSV
FT                   QSELLSLESYSKPLDESHELFLNIVEVATTANSVTTNQVLIVQTTMKKEKDGWLVDNVQ
FT                   VKGNG"
FT   regulatory      78812..78820
FT                   /gene="yddJ"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        78831..79211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yddJ"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="InterPro:IPR028075"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96647"
FT                   /protein_id="BAA19336.1"
FT                   /translation="MKNLFIFLSLMMMFVLTACGGSKYDDAIDDVISQYKEHKGNDTEI
FT                   NIKRENAIVRVYEGGKYIQFAFYMPDNSSRELTTFKYYEKFGDKYEKMTDMPGNGENDR
FT                   LGLSKKTPDYEEVKGEETELEE"
FT   CDS_pept        complement(79402..80202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yddK"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="GOA:P96648"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96648"
FT                   /protein_id="BAA19337.1"
FT                   /translation="MDTLKKLKFEANGIIGVLLDYSREPVLTNIIDQFRTSLESNDIEL
FT                   IRYSLEQLKTWYARNRNEIYKNEFVFNEFEHHETENKIKKFLDELPVVDETEKSSITHF
FT                   SSDQNRELEKKIFISHSSKDKIVCNAFVELLEDIGVSSEDIIYTSSPYHGIPGDEDIFE
FT                   YLKKHLFKGAYVFYMLSDNYYDSVYCLNEMGATWVNSNNCSTFILPGFKGEIKGVIDKN
FT                   KKAFSLEEPIDLFNLKEKILRMYDLTLEDKKWERIKAKFNTKLK"
FT   regulatory      complement(80209..80214)
FT                   /gene="yddK"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      80524..80531
FT                   /gene="yddL"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        80542..81717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yddL"
FT                   /note="PROBABLE PROTEIN ASP-PHOSPHATASE."
FT                   /db_xref="GOA:P96649"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR040702"
FT                   /db_xref="PDB:4I1A"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96649"
FT                   /protein_id="BAA19338.1"
FT                   /translation="MRGVFLDKDKIPYDLVTKKLNEWYTSIKNDQVEQAEIIKTEVEKE
FT                   LLNMEENQDALLYYQLLEFRHEIMLSYMKSKEIEDLNNAYETIKEIEKQGQLTGMLEYY
FT                   FYFFKGMYEFRRKELISAISAYRIAESKLSEVEDEIEKAEFFFKVSYVYYYMKQTYFSM
FT                   NYANRALKIFREYEEYAVQTVRCQFIVAGNLIDSLEYERALEQFLKSLEISKESNIEHL
FT                   IAMSHMNIGICYDELKEYKKASQHLILALEIFEKSKHSFLTKTLFTLTYVEAKQQNYNV
FT                   ALIYFRKGRFIADKSDDKEYSAKFKILEGLFFSDGETQLIKNAFSYLASRKMFADVENF
FT                   SIEVADYFHEQGNLMLSNEYYRMSIEARRKIKKGEIIDENQPDSIGSSDFK"
FT   regulatory      81816..81851
FT                   /note="PROBABLE RHO-INDEPENDENT TRANSCRIPTIONAL TERMINATOR"
FT                   /regulatory_class="terminator"
FT   regulatory      81933..81941
FT                   /gene="yddM"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        81946..82887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yddM"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="GOA:P96650"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96650"
FT                   /protein_id="BAA19339.1"
FT                   /translation="MGENMFKKEKVTEYIWTILIPTIITFIISWVGSYYNGTSTVSIGQ
FT                   PTKVSGQYITPINISPYHDIKELRITFPQKLDVKQISSNEPINVKSDKNNIGVESNSTF
FT                   EIAKIVENNSVQLLITTQKKLNDKEIRIDKNGNNISVNYESQIVNPAKKQLINLIITSS
FT                   IYFIMLNILALIMNKRWDKYYAKMKNEIKEFEDNAKDLDKKSKKKSEELSELRKTLNQA
FT                   FEETDRIKYHEKKKQILLLAKLNDYKKELTFWRNTIRKVLYELPDGDKKADKLIGTVTS
FT                   SLKTYGTVEKNEHDYESLKVAAALLNDSDKRS"
FT   CDS_pept        complement(83458..84477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yddN"
FT                   /note="SIMILAR TO ALKANAL MONOOXYGENASE ALPHA CHAIN."
FT                   /db_xref="GOA:P96651"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96651"
FT                   /protein_id="BAA19340.1"
FT                   /translation="MKKFDISVLSVAPLRQGETMKQGIDSAVSLAKAVDNMGYKRIWFA
FT                   EHHNHDAYASAATVSIVQHILANTKDIRVGSGGIMLPNHSPLIVAEQFGTLETLYPNRV
FT                   DLALGRAPGTDQKTADVIRRSNHNGVFFFEREVNDILRFVGDKSVQGEVRAYPGIGTHV
FT                   PVFVLGSSTDSAEIAAKLGLPYAFGAQFSPHSMEEALSIYRENFQPSSYLQEPYVIACI
FT                   NVIAAESIDEASFISASHLQVYIDIYTNNLSKLIPPTENFLESLSQFELEILHSRLGYT
FT                   IMGDRETIRRELIDFQQMYHADELIVLSNIYELSKEIQSYEILKQVVDELFKKRMEQL"
FT   regulatory      complement(84482..84489)
FT                   /gene="yddN"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      84722..84727
FT                   /gene="yddO"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        84737..85147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yddO"
FT                   /note="PROBABLE TRANSCRIPTIONAL REGULATOR, SIMILAR TO
FT                   REGULATORY PROTEIN ASNC."
FT                   /db_xref="GOA:P96652"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96652"
FT                   /protein_id="BAA19341.1"
FT                   /translation="MIDEIDKKILDELSKNSRLTMKKLGEKVHLTAPATASRVVKLIDN
FT                   GIIKGCSIEVNQVKLGFSIHAFLNIYIEKIHHQPYLAFIETQDNYVINNYKVSGDGCYL
FT                   LECKFPSNEVLDQFLNDLNKHANYKVSIVIGK"
FT   CDS_pept        complement(85270..85719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yddP"
FT                   /note="PROBABLE TRANSCRIPTIONAL REGULATOR, SIMILAR TO
FT                   REGULATORY PROTEIN ASNC AND LRP."
FT                   /db_xref="GOA:P96653"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96653"
FT                   /protein_id="BAA19342.1"
FT                   /translation="MQIDSIDFQILQLLNKNARIQWKEIGEKIHMTGQAVGNRIKKMED
FT                   NGIIKAYSIVVDELKMGFSFTAFVFFFMNAYMHDDLLKFIATRNEISEAHRVSGDACYL
FT                   LKVTVHSQEVLNHLLNDLLKYGNYQLYLSIKEVKKHYNTSLMSDE"
FT   regulatory      complement(85725..85731)
FT                   /gene="yddP"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      85821..85829
FT                   /gene="yddQ"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        85834..86376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yddQ"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="GOA:P96654"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96654"
FT                   /protein_id="BAA19343.1"
FT                   /translation="MTTALLVIDIQNDYFPNGKMALTNPEKAAQNAAKLLSHFRNTGAP
FT                   VFHVQHITEGNIAHFFHPNTEGVEIHESVRPLEKETVIVKHMPNSFFNTDLNGKLQEEG
FT                   VKELVVCGMMSHMCIDATVRSAVEHGYVCQVVEDACATTTLQIEDKIVPAEHVHYAFMA
FT                   ALNGVYATVKTTEAFLK"
FT   regulatory      86909..86919
FT                   /gene="yddR"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        86929..87693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yddR"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="GOA:P96655"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96655"
FT                   /protein_id="BAA19344.1"
FT                   /translation="MNITQIRNATIVVKYANKKFLIDPMLAEKGTYATFPETIRQDLFN
FT                   PLVSLPTSIDNILDGVDAVIVTHLHLDHFDDVAKNVLPKNIKMFVQNEADAKEVKASGF
FT                   KNVEVLHQDTVFEGIQLVKTKGEHGRGEELLNLMGDVCGLVFKHPSEKVLYVAGDTVWY
FT                   DAIEDEIHTHQPEIIVVNGGDNQRLDLGSLIMGKEDIYEVHKAAPHAKIISVHMEAVNH
FT                   WTLSREELKNFSKEKGFSSNILVPEDGESYTF"
FT   regulatory      87873..87879
FT                   /gene="yddS"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        87887..89197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yddS"
FT                   /note="PROBABLE METABOLITE TRANSPORT PROTEIN, SIMILAR
FT                   PRODUCT IN E. COLI."
FT                   /db_xref="GOA:P96656"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96656"
FT                   /protein_id="BAA19345.1"
FT                   /translation="MVMTKKDTNISTQQPLWLQGYIDSPEKQNQLYKKTLKILIFSQIF
FT                   GGAGLGAGITVGALLAQDMIGSENVAGIPTALFTFGSAVAALLIGASSQRFGRRAGLAG
FT                   GFLIGGLGAIGVIIAALINSVALLFVSLLIYGAGMASNLQVRYAGTDLANEKQRATAAS
FT                   MALVSTTLGAVVGPNLVNTMGEFADSIGVPNLAGPFIMSGAAFIIAGIILLIFLRPDPL
FT                   FVSTAIANAEKKDDKVQIGGSLKNPAIDKKGIMVGAVIMILAQLIMTAIMTMTPVHMGH
FT                   HGHGLSEVGLVIGLHIAAMYLPSPLTGLLVDKFGRTTMAIASGATLLAAGLVAAIAPAD
FT                   SLSLLILALVLLGVGWNFGLLTGTALIIDSTHPSLRAKTQGTFDVLLALSGAAGGALSG
FT                   MVVAHSSYTILSISGAVLSLLLIPVVIWYFRRIQEKA"
FT   regulatory      89967..89973
FT                   /gene="yddT"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        89981..90667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yddT"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="UniProtKB/Swiss-Prot:P96657"
FT                   /protein_id="BAA19346.1"
FT                   /translation="MRKKRVITCVMAASLTLGSLLPAGYASAKEDSKTTPSYEELALHY
FT                   KMKSEKISSNGKLVEIEYVSGNETHKVQMNGNNHTVKVDGIEQKGLNFEYDENVAKRTN
FT                   YENNNLKSNEFTTQAAKPKKGYHYVGTLSGHTKAAKNALSVTMSLVGIVPGLGWGSKAA
FT                   TILFSYWAKEQIPDAYYKYDLYEKGAMTDSWYQYATVQFFEDKAHKKKMGKPWTSTPAK
FT                   VDLPNS"
FT   regulatory      91611..91618
FT                   /gene="ydeA"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        91627..92220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydeA"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="GOA:P96658"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="PDB:3F5D"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96658"
FT                   /protein_id="BAA19347.1"
FT                   /translation="MKKALFLILDQYADWEGVYLASALNQREDWSVHTVSLDPIVSSIG
FT                   GFKTSVDYIIGLEPANFNLLVMIGGDSWSNDNKKLLHFVKTAFQKNIPIAAICGAVDFL
FT                   AKNGLLNNHSHTGNFVYLWKDYKQYKPISSFVEKQAVRDKNLVTANGTAPIEFTNLILE
FT                   MIDFDTPENIEKMMYMNRYGFYHFCDKYGNPFVD"
FT   regulatory      92469..92474
FT                   /gene="cspC"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        92483..92683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspC"
FT                   /product="COLD SHOCK PROTEIN"
FT                   /note="CONSERVED IN MANY ORGANISMS."
FT                   /db_xref="GOA:P39158"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39158"
FT                   /protein_id="BAA19348.1"
FT                   /translation="MEQGTVKWFNAEKGFGFIERENGDDVFVHFSAIQSDGFKSLDEGQ
FT                   KVSFDVEQGARGAQAANVQKA"
FT   CDS_pept        complement(93370..93831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydeB"
FT                   /note="SIMILAR TO TRANSCRIPTION FACTOR OF MYXOCOCCUS
FT                   XANTHUS."
FT                   /db_xref="GOA:P96659"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96659"
FT                   /protein_id="BAA19349.1"
FT                   /translation="MFQIGDNIVYPMHGAGIIEAIEEKEFLEEKQQYYVIRMSISNMTV
FT                   MIPTSKILSSNIRPVTDILALKHIMHIFQHGESDRLLPWKQRYKINTDKIKTGEIQEGA
FT                   EVVRDLMRMKKEKALNASEKKMLDNAYEFLISELEVIKGITEKQIKSFG"
FT   regulatory      complement(93838..93846)
FT                   /gene="ydeB"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      94363..94393
FT                   /note="PROBABLE RHO-INDEPENDENT TRANSCRIPTIONAL TERMINATOR"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(94733..95608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydeC"
FT                   /note="PROBABLE HTH_ARAC_FAMILY OF TRANSCRIPTIONAL
FT                   REGULATOR."
FT                   /db_xref="GOA:P96660"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96660"
FT                   /protein_id="BAA19350.1"
FT                   /translation="MKNFVIDQNLKELTEHRTVELPVACYKTTINQNINGYIPLHWHDE
FT                   IQFVLILKGIALFQINEEKIEVHEGDGLFINSGYLHMAEEKEGSDCTYICLNVSPHFVL
FT                   SQELYSSYVQPYMFSTNLPYLFLAGNQQWAKNILDAVKKINQLIQQKTSLYEIDITMQL
FT                   TLMWKNLVVNGFQLEYDQSEMIKSHRMKQMLNWIHLHYVEKITLEDIAKAGQLSRSECC
FT                   RYFKRMLNKTPLRYVMDYRIQKSLLLLQHPESNVTEVSYQVGFNSTSYFISKFQQAMNM
FT                   TPLSYKKMNS"
FT   regulatory      complement(95619..95624)
FT                   /gene="ydeC"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      95707..95714
FT                   /gene="ydeD"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        95721..96680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydeD"
FT                   /note="FUNCTION UNKNOWN, SIMILAR PRODUCT IN E.COLI."
FT                   /db_xref="GOA:P96661"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96661"
FT                   /protein_id="BAA19351.1"
FT                   /translation="MNTSNRRMGLFYVITGATCWGIGGTVAKKLFQEYQIDVNWLVTTR
FT                   LLTAGMLLLMLQLFRKDRSQVIEVWKHKASAGQLLIFGLLGMLAVQYTYMASIQHGNAA
FT                   VATLLQYLSPVIVIIYTLLRKQTVLTKQDIITVVLALVGCFFLLTNGSMSQLSVPAAAV
FT                   VWGVLSGFAAAFYTLYAVGLLNKFDSLVVVGWAMIIGGFALGFIHPPWQLDFQRLTAEA
FT                   YAYILFVILFGTMIAFWFFIKSLESLSPKETSLLGSLEPLSAVVTTVVWLKAPFGSFQW
FT                   IGAICIIGITLILALHKEPSMESEKSILKIRNHANRDI"
FT   CDS_pept        complement(96833..97705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydeE"
FT                   /note="PROBABLE HTH_ARAC_FAMILY OF TRANSCRIPTIONAL
FT                   REGULATOR."
FT                   /db_xref="GOA:P96662"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96662"
FT                   /protein_id="BAA19352.1"
FT                   /translation="MDLLKSMNRALKYIEENLTNDIDFQEAAKLAFCSEYHFKRMFSFL
FT                   AGISLSEYIRRRRLTLAAFELKDSNVKVIDIAIKYGYNSPDSFARAFQNLHGINPSKAR
FT                   FNGHSLKAYPRMTFQLTIKGGNEMNYRIEEKEAFRIVGIKKRVPIIFKGINPEIASMWE
FT                   SLDEKAINKLKELSNVAPSGLISASTNFSEGRTEENGELDHYIGAATTKRCPDNFSRLE
FT                   VPASTWAVFESIGPFPDTLQEVWGRIYSEWFPSSNYEQIEGPEILWNEHKDVTSPSFKS
FT                   EIWIPITKK"
FT   regulatory      complement(97714..97721)
FT                   /gene="ydeE"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      97907..97916
FT                   /gene="ydeF"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        97923..99320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydeF"
FT                   /note="SIMILAR TO HYPOTHETICAL TRANSCRIPTIONAL REGULATORS."
FT                   /db_xref="GOA:P96663"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96663"
FT                   /protein_id="BAA19353.1"
FT                   /translation="MRIMPINSFENYPMSWKPSIDKAEKPIYKALAGQLEQDILNGVLL
FT                   PGTKLPPQRELADYLDLNVSTISKAFKVCELKGLLSATVGSGTFVSYDALSNAYLLEDT
FT                   KPTHLIEMGAILPDHASYEPLLYQLKNMVHEEDYEKWFSYGRAGESLWQKDAAVKLIQR
FT                   GGFETSVDHILFANGGQNAIAATLASLCKPGDRIGVDHHTYPGLKTVASLLSVQIVPIK
FT                   SENDEMSPESLEYACKNENIKGLYLIPDYHNPTTSFMSVENRRMVADIVKKYNLFVIED
FT                   ASYHLLNKNPLPALASFAPQQVIHIASLSKSLAPGLRLAYVAVPRQYKEPISKALYNLN
FT                   ITVSPLLAELTARTIVSNQFEVLIESHREQTIRRNQLVNRYVAGYTCLGVETGIFRWLL
FT                   LPGKMSGAEFEELAARLGVQVYAAERFVVGNSCPERAVRVSVCAPKTLEELEQGLMILR
FT                   RLLDDLT"
FT   regulatory      99417..99428
FT                   /gene="ydeG"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        99430..100722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydeG"
FT                   /note="SIMILAR TO YDDS_BACSU."
FT                   /db_xref="GOA:P96664"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96664"
FT                   /protein_id="BAA19354.1"
FT                   /translation="MMLDKDSVKAIDVQTASLQSYISSPEKQKSLYKRTLFVVSISQIF
FT                   GGAGLAAGVTVGALIAQQMLGTDAFAGLPSALFTLGSAGSALIVGRLSQRYGRRTGLSA
FT                   GFMIGGLGAIGVIMAAIINSIFLLFISLLIYGAGTATNLQARYAGTDLANHKQRATAVS
FT                   ITMVFTTFGAVAGPSLVNVMGDFALSIGVPSLAGPFILAAAAYMLAGVVLFIMLRPDPL
FT                   VIARTIEAANEEPGDKGHLAATEHTENKKGIIVGATVMVLTQIVMVAIMTMTPVHMRHH
FT                   GHDLGAVGLVIGFHIGAMYLPSLVTGVLVDRLGRTAMAISSGTTLLLAGVIAAFAPGES
FT                   MILLVIALSLLGLGWNFGLISGTALIVDSTDTATRAKTQGTVDVLIALSGAAGGALSGM
FT                   IVAGSSYLALSLIGGILSLLLIPVVVWSRGR"
FT   CDS_pept        100881..101327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydeH"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="GOA:P96665"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96665"
FT                   /protein_id="BAA19355.1"
FT                   /translation="MNHIKWLSDLKKAGLLALGKGVITLLKRFSLVIVTLMMSIVVVLA
FT                   AAKESPGDHVISFDEPIILMISIGIVVFLLIPPLVMSFFGNLVVRIISGVYQCFIVFTF
FT                   LGLIPIGFLIPNGFLTILVSIAGTLVSIASVAVTLCIGKNKKDI"
FT   regulatory      101546..101555
FT                   /gene="ydeI"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        101564..102157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydeI"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="InterPro:IPR014922"
FT                   /db_xref="InterPro:IPR016786"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96666"
FT                   /protein_id="BAA19356.1"
FT                   /translation="MTNSRTNPKVDEFLSKAKKWKEEFEKLRTIILDCELTEDFKWMHP
FT                   CYTYHNKNIVLIHGFKEYCALLFHKGVLLQDTDGILIQQTENVQAARQIRFTNVQEINE
FT                   LENILKAYIHEAIEVEKAGLKVDVNKNIELNIPEELQNKFDEIPALKIAFEALTPGRQR
FT                   AYTLYFSQAKQSKTRESRVEKYVQKILDGKGLKD"
FT   regulatory      102220..102249
FT                   /note="PROBABLE RHO-INDEPENDENT TRANSCRIPTIONAL TERMINATOR"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(102509..103168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydeJ"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="GOA:P96667"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96667"
FT                   /protein_id="BAA19357.1"
FT                   /translation="MKKRRKICYCNTALLLMILLAGCTDSKDGEAQQPSNQASAVQTDE
FT                   KHTEPEESTKIRKDEAEPITESEESATKAANDTSSAEEKSKEDNVLAAYSSEKIEYARV
FT                   WLQLGPNQEIDELNVRHIAAGEPINPNDDTSASYPENVTQLAGSRLVDGSVTYHGNGDG
FT                   TIHVYNVPLRWDSADDIEKGVMREVTESIIKNRKTVYVDTGDDEKIKRLIDIMMIH"
FT   regulatory      complement(103173..103182)
FT                   /gene="ydeJ"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(103590..104453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydeK"
FT                   /note="FUNCTION UNKNOWN, SIMILAR PRODUCT IN E. COLI."
FT                   /db_xref="GOA:P96668"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96668"
FT                   /protein_id="BAA19358.1"
FT                   /translation="MNKTTNGWINGFIGVLIFSGSLPATRLAVSDFDPLFLTVCRAAIA
FT                   GVLAGGLLLIFRQQHPAKRDLISLLVVAFGVVIGFPLLTALALQHVTSAHAIVFIGLLP
FT                   LATAVFGVLRGGERPRPVFWIFSAAGSLLVAGFALIQGGGSSPLGDAYMLASIVVCGLG
FT                   YAEGAKLSRRLGNWQVISWALVLSLPLMLPLSFFFTPDSWSAIGVPALLSLAYVSLFSM
FT                   LIGFVFWYRGLAQGGIAAVGQLQLLQPFFGLLLASVILHEKVGWALVAVNIAVIMCVAA
FT                   ARRFAK"
FT   regulatory      complement(104459..104465)
FT                   /gene="ydeK"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      104591..104595
FT                   /gene="ydeL"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        104608..105999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydeL"
FT                   /note="SIMILAR TO THE RHIZOPINE CATABOLISM (MOCR) GENE OF
FT                   RHIZOBIUM MELILOTI."
FT                   /db_xref="GOA:P96669"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96669"
FT                   /protein_id="BAA19359.1"
FT                   /translation="MDITPFLNRTLDIPLYQQLYRYFKENMHRGRIQKGMKLPSKRLLA
FT                   NQLSISQTTVERAYEQLAAEGYIVSKPRSGWFADYHDSDFAYDRMPSTTPIQQEAEENK
FT                   QWIDFHYGNVDSSYFPFSAWRKSMVNSLDQYGHELYRPGHVLGEFELRTLIAEYLYQSR
FT                   GVHCGPEQVIIGAGNPILLQILCQVFEPNISIGYEDPGYPRARKIFEANRMNIVPIPVD
FT                   DEGICIQKIKEQQPNLVYVTPSHQFTLGTIMTINRRIQLLKWAAENQSFIIEDDYDGEF
FT                   RYTGQPVPSLQGLDQHNRVIYMGTFSKSLLPSLRISYMILPSPLLKKGHEITSLYKQTV
FT                   SCHSQLTLAEFIKNGEWQKHINRMRKLYRKKRAIVLEAVQRELGEHVRIRGENSGLRIL
FT                   LDVYLPFGEKELIEKAKKHGVKIYPVSLSYQHHPPTKTVSLGFAGVSESDIREGIKKLK
FT                   AAWKI"
FT   regulatory      106181..106188
FT                   /gene="ydeM"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        106193..106618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydeM"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96670"
FT                   /protein_id="BAA19360.1"
FT                   /translation="MKLDEFTIGQVFKTKSLKVSKDDIMRFAGEFDPQYMHVDEEKASK
FT                   GRFNGIIASGIQTLAISFKLWIEEGFYGDDIIAGTEMNHMTFIKPVYPDDELFTIVEVL
FT                   DKQPKRNELGILTVLLSTYNQKEVKVFEGELSVLIKR"
FT   CDS_pept        complement(106671..107243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydeN"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="GOA:P96671"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="PDB:1UXO"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96671"
FT                   /protein_id="BAA19361.1"
FT                   /translation="MTKQVYIIHGYRASSTNHWFPWLKKRLLADGVQADILNMPNPLQP
FT                   RLEDWLDTLSLYQHTLHENTYLVAHSLGCPAILRFLEHLQLRKQLGGIILVSGFAKSLP
FT                   TLQMLDEFTQGSFDHQKIIESAKHRAVIASKDDQIVPFSFSKDLAQQIDAALYEVQHGG
FT                   HFLEDEGFTSLPIVYDVLTSYFSKETR"
FT   regulatory      complement(107248..107254)
FT                   /gene="ydeN"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      107894..107901
FT                   /gene="ydeO"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        107908..108780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydeO"
FT                   /note="SIMILAR TO YQFU, YXKD, YITB OF B. SUBTILIS."
FT                   /db_xref="GOA:P96672"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR019264"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96672"
FT                   /protein_id="BAA19362.1"
FT                   /translation="MNTPKKHKKFKAKMILQIIMVIIGGIIAAYGLETVLIPNSVSDGG
FT                   VTGLSIVGSQLFNLPLGILIAVINIPFVWLGYKQIGKSFALLSIIGIVSLAAGTSFFHH
FT                   TPAIIEGDTLLITVVGGIILGFGMGLALRNGGALDGIDMLAVLLSRKLPFGTSDLILFL
FT                   NLFVFIFVSTVFGLQGALLSVIAYYIASKVIHVVEEGLSGSKTFQIITTQPELMVETIR
FT                   DQLGRSATYKEAYGGFSHEKFKEITCVINRLEETKLKEIINDIDKTAFVTVYDVAEVKG
FT                   SNFRNLNHH"
FT   CDS_pept        complement(108930..109358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydeP"
FT                   /note="FUNCTION UNKNOWN, SIMILAR PRODUCT IN E. COLI, H.
FT                   INFLUENZAE AND SYNECHOCYSTIS."
FT                   /db_xref="GOA:P96673"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96673"
FT                   /protein_id="BAA19363.1"
FT                   /translation="MYIVSKSILLGVNSLRNRKLGIDYSSDDFEGCPVETTLDIIGGKW
FT                   KGILLYHLIDGKKRFNEFRKLYPKITQRMLTLQLRELERDGVIHREVYKQVPPKVEYSL
FT                   TEFGRTLEPVILHMKDWGEKYKDRIDKLEAARKAEDKI"
FT   regulatory      109413..109421
FT                   /gene="ydeQ"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        109427..110020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydeQ"
FT                   /note="PROBABLE NAD(P)H OXIDOREDUCTASE."
FT                   /db_xref="GOA:P96674"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96674"
FT                   /protein_id="BAA19364.1"
FT                   /translation="MDHMKTLVLVVHPNIESSRINKKWKEAVLSEPDVTVHDLYEKYRD
FT                   QPIDVEFEQQQLLAHDRIVFQFPLYWYSSPPLLKQWFDEVFTFGWAHGPGGNKLKGKEW
FT                   VTAMSIGSPEHSYQAGGYNLFSISELTKPFQASAHLVGMTYLPSFAEYRANTISDQEIA
FT                   ESANRYVKHITNIELNPKVRLQRYLKQLESVDLT"
FT   regulatory      110110..110155
FT                   /note="PROBABLE RHO-INDEPENDENT TRANSCRIPTIONAL TERMINATOR"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(110164..111351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydeR"
FT                   /note="PROBABLE INTEGRAL MEMBRANE PROTEIN, SIMILAR TO
FT                   CHLORAMPHENICOL RESISTANCE PROTEIN OF STREPTOMYCES
FT                   VENEZUELAE."
FT                   /db_xref="GOA:P96675"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96675"
FT                   /protein_id="BAA19365.1"
FT                   /translation="MANGNKQAGQRISPSLTLLLATACGIIVANLYYAQPLVGLISKAI
FT                   GLSPSGAGLIVTLTQIGYVAGLLFLVPLGDIIENKKLIVVSLLLSAAALTLTAFVKHGT
FT                   LFLAAAFFVGLGSIAAQVLVPFASYLASDAARGRVVGNVMSGLLLGIMLSRPISSLVAD
FT                   IWGWNAIFALSAVVSVILAIVLSKVLPARKPTANTNYTALLGSMWKLLRTTPVLRRRAI
FT                   YHAFVFGAFSLFWTTVPLLLSGPDFHFSQKAIALYALVGIAGAVTAPIGGRLADRGLTR
FT                   LATGIALGVVVVSLLLPLMIQSSSPVGITVLVAAAILLDMGVSANLVLSQRAIFSLAPE
FT                   IRSRLNGLFMAIFFLGGAIGSSIGGWAYASGGWSTALWIGIAFPVIALLYFITEK"
FT   regulatory      complement(111360..111367)
FT                   /gene="ydeR"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      111539..111549
FT                   /gene="ydeS"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        111555..112151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydeS"
FT                   /note="PROBABLE TRANSCRIPTIONAL REGULATOR, SIMILAR TO
FT                   REGULATOR OF ANTIBIOTIC TRANSPORT COMPLEXES IN STREPTOMYCES
FT                   HYGROSCOPICUS."
FT                   /db_xref="GOA:P96676"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96676"
FT                   /protein_id="BAA19366.1"
FT                   /translation="MQSKRGRPRDEGTHKAILSAAYDLLLEKGFDAVTVDKIAERAKVS
FT                   KATIYKWWSNKAAVIMDSFLSTATDRLPVPDTGSSVQDIVTHATNLARFLTSREGTVIK
FT                   ELIGAGQLDEKLAEEYRTRFFQPRRLQAKGLLEKGIQKGELRENLDIEVSIDLIYGPIF
FT                   YRLLITGDEVNDSYVRDLVMNAFKGVQATSATESM"
FT   regulatory      112745..112753
FT                   /gene="ydeT"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        112759..113094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydeT"
FT                   /note="PROBABLE TRANSCRIPTIONAL REGULATOR, SIMILAR TO
FT                   ARSENICAL RESISTANCE OPERON REPRESSOR."
FT                   /db_xref="GOA:P96677"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96677"
FT                   /protein_id="BAA19367.1"
FT                   /translation="MTIDVAAMTRCLKTLSDQTRLIMMRLFLEQEYCVCQLVDMFEMSQ
FT                   PAISQHLRKLKNAGFVNEDRRGQWRYYSINGSCPEFDTLQLILHQIDQEDELLNHIKQK
FT                   KTQACCQ"
FT   regulatory      113093..113099
FT                   /gene="ydfA"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        113107..114414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfA"
FT                   /note="SIMILAR TO ARSENICAL PUMP MEMBRANE PROTEIN."
FT                   /db_xref="GOA:P96678"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96678"
FT                   /protein_id="BAA19368.1"
FT                   /translation="MTSMILAVFIFLLTLVLVIWQPKNLSIGWSACGGAVLALIAGVVN
FT                   FHDVLTVTGIVWNATLAFVAIILISLILDNIGFFEWAALHMAKAAKGYGVRMFVYVSLL
FT                   GAIVAALFANDGAALILTPIVLAMVRALHFNEKLVFPFIIASGFIADTTSLPFVVSNLV
FT                   NIVSADYFHITFIDYASRMVVPYLFSLLASIIVLYLFFRKSIPKRYDLTEVKKPVEAIK
FT                   DQNMFRLSWYILGLLLIGYFASEFFSIPVSVVAGSIAIIFLIAAQKSPAVHTKKVVKEA
FT                   PWAIVFFSIGMYVVVYGVRNAGLTDVLSDVIQAAADQGLFAGTIGMGFIAAILSSIMNN
FT                   LPTVMIDALAIAGTDTHGMMREALIYANVIGSDLGPKITPIGSLATLLWLHVLSHKGMK
FT                   ISWGTYFKTGIILTIPTLLITLVGLYIWLLIIHSCF"
FT   regulatory      114889..114894
FT                   /gene="ydfB"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        114912..115697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfB"
FT                   /note="SIMILAR TO BACILLUS CEREUS ZWITTERMICIN A-RESISTANCE
FT                   GENE."
FT                   /db_xref="GOA:P96679"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR027365"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96679"
FT                   /protein_id="BAA19369.1"
FT                   /translation="MSVLQELTKKKYSSLKTMFDDKYCPTFVYSILDQTIPGAVYADDQ
FT                   TFPKSFFIGTESGIYFIAGDQGNRDFHDFIAGYYEEQVKSSKRFTLFSSSDTWDSVLKP
FT                   ILKDDLNQMRRAAFSYQPKSFKKTLQLPKGLVLKRIDEDIISHSTAFNSAYYEEYWNSV
FT                   SQFASKGFGFAVLHGNHVVSECTSIFLGHNRAEMDIYTLEEYRGLGLAYCVANRFIAFC
FT                   MENGIVPSWDCDICNNSSIALAAKLGFKTVTEYTIYYSG"
FT   regulatory      115722..115745
FT                   /note="PROBABLE RHO-INDEPENDENT TRANSCRIPTIONAL TERMINATOR"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(115754..116674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfC"
FT                   /note="FUNCTION UNKNOWN, SIMILAR PRODUCT IN E. COLI."
FT                   /db_xref="GOA:P96680"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96680"
FT                   /protein_id="BAA19370.1"
FT                   /translation="MRKKTVQIMISHSLMIGLWASAFPGIRAGLEGYTPEHLALFRLLI
FT                   GSMALLLFAVLTQMRLPDLKDIPAIFLLGFLGFAFYHILLNIGEKTVSAGVASLLVTTA
FT                   PIFSAMLSRLFYKEHFGFTKWLGSMISLLGVLLIAFGAGDFTYSMSGILVILLAAFSES
FT                   IYFVFQARYIKKYGFIPFVTFTIWGGTIPMLVFLPGLGEEMMNASISATLSIVYLGLLP
FT                   TVIPYFALAYVTSFVGASEATLSLYVTPALALIISWLWIGEIPTLLSLLGGVVTVGGVC
FT                   FTYLKVNKMNKIFITHFSAKRVKKL"
FT   regulatory      complement(116678..116688)
FT                   /gene="ydfC"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      116792..116798
FT                   /gene="ydfD"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        116807..118255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfD"
FT                   /note="SIMILAR TO THE RHIZOPINE CATABOLISM (MOCR) GENE OF
FT                   RHIZOBIUM MELILOTI."
FT                   /db_xref="GOA:P96681"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96681"
FT                   /protein_id="BAA19371.1"
FT                   /translation="MSFPEEKKMKKLPKYRQIVHFIKEKIGNGEWPIGSKIPSQRTLAK
FT                   DFQVNRSTVITALEELMADGLIEGTMGKGTVVINNTWTLMAKNSAPDWDQYVTSGIQMP
FT                   SRKIVQEINQSESNTDLIQLSKGELSAEIFPLAVMKEMMGKVSQHMEAFGYEEPKGYLP
FT                   LREALSNYLKTIGINVSSSSILIVSGALQALQLISMGLLQRGSTVYLDQPSYLYSLHVF
FT                   QSAGMKLTGLPMDNEGLLPENVHLTRGERGRAILYTNPCFHNPTGILMSKKRREEILAV
FT                   SENTQLPIIEDDIYRELWIDEIPPYPIKTIDKNGHVLYIGSLSKTLSPGLRIGWIVGPE
FT                   PVIERLSDIKMQTDYGSSSLSQRVAAEWFTSGHYQQHVEKVRQQLKVRRELALSALETH
FT                   LKEVATWNIPKGGFFVWIKILPSISMKLLYTKALSKGILINLGSIYAQEKGNYIRLSYA
FT                   YASLEDLQKGIYELGLMIKELASR"
FT   CDS_pept        complement(118373..118996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfE"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="GOA:P96682"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96682"
FT                   /protein_id="BAA19372.1"
FT                   /translation="MDIKKQDTRRFKEIKPKIMYYGTSTFLLTTLNEDGTTNISPMSSS
FT                   WALGHYIILGVGLGGKAIDNLERHKECVINLPGPDLWENVERISSYSGKKSIPPLKKQI
FT                   GFTYKKEKYEAAGLTPLQSKTVSPTRIKECPIQIEAEVKHIRLPEYESSFAIVETQALH
FT                   FHAEESIILDENHINPSKWSPLIYNFRHYFGLGREVGKTFRSET"
FT   regulatory      complement(119005..119011)
FT                   /gene="ydfE"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      119073..119079
FT                   /gene="ydfF"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        119086..119766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfF"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="GOA:P96683"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96683"
FT                   /protein_id="BAA19373.1"
FT                   /translation="MNPNIAKISSLLSDPSRSSILLSLMDGRIHPAGELAYLANIKPQT
FT                   ASFHLNKLLEAKLISVEKHGRHRYYRLADSDAANVIEQLLHIAPKAKVKSLKESKEKKD
FT                   LHFARTCYDHLAGYVGVQMAHSLVEQGMLKKVDLNFEVTSEGALFFSKLGINEEQQRNK
FT                   RRAFARCCLDWSERQHHIAGALGNALLVRMLEEEWIVRMPKTRAIRITQSGKIAFEKHL
FT                   NVKI"
FT   CDS_pept        complement(119846..120289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfG"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="GOA:P96684"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96684"
FT                   /protein_id="BAA19374.1"
FT                   /translation="MSQRVSYYEIAPEGMKIMMDMEKYTKQSSINRTTRELIKIRVSQM
FT                   NGCAFCIDMHTSDARKMGETEQRIYCLHAWNECDFYSPEEKAALELSEHITLIPSKRVP
FT                   DELYHRVREHYDEEQYVDLVLIINQINSWNRISIAMGNRAASK"
FT   regulatory      complement(120298..120305)
FT                   /gene="ydfG"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      120944..120953
FT                   /gene="ydfH"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        120962..122185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfH"
FT                   /note="POBABLE SENSORY TRANSDUCTION HISTIDINE KINASE."
FT                   /db_xref="GOA:P96685"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96685"
FT                   /protein_id="BAA19375.1"
FT                   /translation="MLIRNPFKDKYYSHDRRALNMLALRVPGLAFILMIYIASIVLQFV
FT                   SGGWSILLLYAFTILIAIFALLHWHSYRWVKKRVILYFAVQGLITFALANLMTGFFILV
FT                   IIGLYAFLIGQIIGMADRRRTFLILYLLLLLVINSAYHLHKGEVLHFIVIAAPIMIVII
FT                   TYAATFFAQVDEKIKAQLTLERLELAHQQVEQLTLQNERQRMARDLHDTLAQGLVSLNM
FT                   QLDAIHVHLAKGNTERAKEIIQQSMKRVKSTIADARSAIDDLRSKSEEIGVLKERITSL
FT                   MDHFIESTGMACLLDYRLHQVLDVRTAENCYYIIGECMTNAAKHAEAKTIWISIWDDEK
FT                   GRLHLTVKDNGKGFDVEKGKKKRGHYGLLGIQERVRAINGQFNIKSTKLKGTQIEITVP
FT                   IQGEMQDE"
FT   regulatory      122163..122170
FT                   /gene="ydfI"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        122178..122819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfI"
FT                   /note="PROBABLE REGULATORY COMPONENT OF SENSORY
FT                   TRANSDUCTION SYSTEM."
FT                   /db_xref="GOA:P96686"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96686"
FT                   /protein_id="BAA19376.1"
FT                   /translation="MNKVLIVDDHLVVREGLKLLIETNDQYTIIGEAENGKVAVRLADE
FT                   LEPDIILMDLYMPEMSGLEAIKQIKEKHDTPIIILTTYNEDHLMIEGIELGAKGYLLKD
FT                   TSSETLFHTMDAAIRGNVLLQPDILKRLQEIQFERMKKQRNETQLTEKEVIVLKAIAKG
FT                   LKSKAIAFDLGVSERTVKSRLTSIYNKLGANSRTEAVTIAMQKGILTIDN"
FT   regulatory      122842..122867
FT                   /note="PROBABLE RHO-INDEPENDENT TRANSCRIPTIONAL TERMINATOR"
FT                   /regulatory_class="terminator"
FT   regulatory      122922..122928
FT                   /gene="ydfJ"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        122935..125109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfJ"
FT                   /note="PROBABLE TRANSPORT PROTEIN, SIMILAR TO ANTIBIOTIC
FT                   TRANSPORT-ASSOCIATED PROTEIN ACTII IN STREPTOMYCES
FT                   COELICOLOR."
FT                   /db_xref="GOA:P96687"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96687"
FT                   /protein_id="BAA19377.1"
FT                   /translation="MSKMLYTLGGWVARNRIKAICAWIVVLVAAIGLAVTLKPSFSEDM
FT                   SIPDTPSEKAMDVIQKEFPHGPDKGSIRVIFGAGDGEKLTGKPAKKAIEDTFKEISKDD
FT                   SVDSIASPFVTGTIAKDGTVAYADIQYKSSADDIKDYSIKHLKDSLKMADDEGLQTELS
FT                   GDVPGAEMEIGGVSEIVGIILAFVVLAITFGSLLIAGLPILTALIGLGVSIGLVLIGTQ
FT                   VFDIASVSLSLAGMIGLAVGIDYALFIFTKHRQFLGEGIQKNESIARAVGTAGSAVVFA
FT                   GLTVIVALCGLTVVNIPFMSAMGLTAGLSVLMAVLASITLVPAVLSIAGKRMIPKSNKK
FT                   IEKQSTETNVWGRFVTKNPIMLSVCSILILIVISIPSMHLELGLPDAGMKAKDNPDRRA
FT                   YDLLAEGFGEGFNGQLTIVADATNATENKAEAFADAVKEIKGLDHVASVTPAMPNKEGN
FT                   FAIITVVPETGPNDVTTKDLVHDVRSLSDKNGVDLLVTGSTAVNIDISDRLNDAIPVFA
FT                   VLIVGFAFVLLTIVFRSLLVPLVAVAGFMLTMTATLGICVFVLQDGNLIDFFKIPEKGP
FT                   ILAFLPILSIGILFGLAMDYQVFLVSRMREEYVKTNNPVQAIQAGLKHSGPVVTAAGLI
FT                   MIFVFAGFIFAGEASIKANGLALSFGVLFDAFIVRMTLIPSVMKLMGNAAWYLPKWLDK
FT                   IIPNVDIEGHQLTKEIQPEIDHEQKKQISV"
FT   regulatory      125424..125456
FT                   /note="PROBABLE RHO-INDEPENDENT TRANSCRIPTIONAL TERMINATOR"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(125521..126423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nap"
FT                   /product="CARBOXYLESTERASE NP"
FT                   /db_xref="GOA:P96688"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="PDB:2R11"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96688"
FT                   /protein_id="BAA19378.1"
FT                   /translation="MSNHSSSIPELSDNGIRYYQTYNESLSLWPVRCKSFYISTRFGQT
FT                   HVIASGPEDAPPLVLLHGALFSSTMWYPNIADWSSKYRTYAVDIIGDKNKSIPENVSGT
FT                   RTDYANWLLDVFDNLGIEKSHMIGLSLGGLHTMNFLLRMPERVKSAAILSPAETFLPFH
FT                   HDFYKYALGLTASNGVETFLNWMMNDQNVLHPIFVKQFKAGVMWQDGSRNPNPNADGFP
FT                   YVFTDEELRSARVPILLLLGEHEVIYDPHSALHRASSFVPDIEAEVIKNAGHVLSMEQP
FT                   TYVNERVMRFFNAETGISR"
FT   regulatory      complement(126432..126437)
FT                   /gene="nap"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(126625..127314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfK"
FT                   /note="FUNCTION UNKNOWN, SIMILAR PRODUCT IN E.COLI."
FT                   /db_xref="GOA:P96689"
FT                   /db_xref="InterPro:IPR007563"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96689"
FT                   /protein_id="BAA19379.1"
FT                   /translation="MFGTIFNTVMIIAGSIIGGIFKKGIKDEYQDILMQAMGFAAVALG
FT                   INAITQHLPDSKYPILFIVSLAIGGLLGQIINLELRFNKLVNKFSKSNLAEGLSTAVLL
FT                   FCIGSLSILGPVEAALHGDYTYLLTNGMLDGITSIVLASTFGFGIAAAALVLFSWQGSI
FT                   YLFAQVMESAINTDLINEITIVGGILILSSGLSILGIKKFKTLNLLPSLLIPPVVIFVI
FT                   HAFGLRF"
FT   regulatory      complement(127321..127328)
FT                   /gene="ydfK"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(127404..128216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfL"
FT                   /note="PROBABLE REGULATORY PROTEIN, SIMILAR TO
FT                   MULTIDRUG-EFFLUX TRANSPORTER REGULATORS IN B.SUBTILIS."
FT                   /db_xref="GOA:P96690"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96690"
FT                   /protein_id="BAA19380.1"
FT                   /translation="MKEFFSIGEVSKLFNVKISALRYYDEIGLLKPEYKDEQTNYRYYS
FT                   TQQFERLDTIKYLRALGLPINKLLDFYNSQNTNTLLHLLKSQQVEIDRKKKELERIERK
FT                   ISRRITHIEDAVNMPLHQISKIKLPAMRVAYLQHEYVLGHDIEHSLAELRTHLNVNEDI
FT                   FIGKIGLSISAANVKAKQFDKYSSIFMILEDENEKTSSEIIFPSREYLQIRFKGSHPEA
FT                   EPYYKKLLAYMKEHHYEVAGDSIEITLIDYGITNNLDNYVTEILLPIK"
FT   regulatory      complement(128221..128229)
FT                   /gene="ydfL"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(128327..129220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfM"
FT                   /note="FUNCTION UNKNOWN, SIMILAR PRODUCT IN SYNECHOCYSTIS
FT                   AND E. COLI."
FT                   /db_xref="GOA:C0SP78"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/Swiss-Prot:C0SP78"
FT                   /protein_id="BAA19381.1"
FT                   /translation="MASEREQISRKVALIALIANLILMAGKVFFGLVGDSEAVFADGIH
FT                   SAADVVASIAVLAVIGISNKPPDQDHPFGHGKAEVISEAIVGIILVIVSVYILIEAILS
FT                   FVKGPSVPQYSALFAALISYVAKEILYRYSIKQGKKWNSKAIIAIAYDHKGDIVASLAA
FT                   FIGVLLAIIGNSRGWSYLLYADAIASAIVAYLIFKISMELIRPSVGVLMEKSVDPELIE
FT                   EYKAVIFQCDQVKRIDRIRAREHGHYKLLDVRLSLDHDLTIKQGHDIAREIRNEIKRQF
FT                   SDVEEVLIHVNPYFEE"
FT   regulatory      complement(129226..129233)
FT                   /gene="ydfM"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        129603..130316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfN"
FT                   /note="FUNCTION UNKNOWN, SIMILAR PRODUCT IN SYNECHOCYSTIS."
FT                   /db_xref="GOA:P96692"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="PDB:3BEM"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96692"
FT                   /protein_id="BAA19382.1"
FT                   /translation="MFNRCQFFYTIFNMIFYNIISRIRDKRECSVMAEFTHLVNERRSA
FT                   SNFLSGHPITKEDLNEMFELVALAPSAFNLQHTKYVTVLDQDVKEKLKQAANGQYKVVS
FT                   SSAVLLVLGDKQAYQQAADIYEGLKVLGILNKQEYDHMVQDTVSFYENRGEQFKRDEAI
FT                   RNASLSAMMFMLSAKEKGWDTCPMIGFDAEAVKRILNIDDQFEVVMMITIGKEKTESRR
FT                   PRGYRKPVNEFVEYM"
FT   regulatory      130316..130324
FT                   /gene="ydfO"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        130332..131270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfO"
FT                   /note="SIMILAR TO PENTACHLOROPHENOL-INDUCED PERIPLASMIC
FT                   PROTEIN IN FLAVOBACTERIUM SP"
FT                   /db_xref="GOA:P96693"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="PDB:3OAJ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96693"
FT                   /protein_id="BAA19383.1"
FT                   /translation="MAKKTMGIHHITAIVGHPQENTDFYAGVLGLRLVKQTVNFDDPGT
FT                   YHLYFGNEGGKPGTIITFFPWAGARQGVIGDGQVGVTSYVVPKGAMAFWEKRLEKFNVP
FT                   YTKIERFGEQYVEFDDPHGLHLEIVEREEGEANTWTFGEVTPDVAIKGFGGATLLSEQP
FT                   DKTADLLENIMGLERVGKEGDFVRYRSAGDIGNVIDLKLTPIGRGQMGAGTVHHIAWRA
FT                   NDDEDQLDWQRYIASHGYGVTPVRDRNYFNAIYFREHGEILFEIATDPPGFAHDETQET
FT                   MGEKLMLPVQYEPHRTQIEQGLLPFEVRELD"
FT   regulatory      131359..131366
FT                   /gene="ydfP"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        131372..131761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfP"
FT                   /note="FUNCTION UNKNOWN, SIMILAR PRODUCT IN E. COLI AND H.
FT                   INFLUENZAE."
FT                   /db_xref="GOA:P96694"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96694"
FT                   /protein_id="BAA19384.1"
FT                   /translation="MEDAGLLLIRIMIGVVFLFYGTQKLFGWFGGYGIKGTGQWFESIG
FT                   VKPGNVAAALSGLGELVSGILFILGVFLPLGAAIITIIMLGAIVKVHGAKGFANGAGGF
FT                   EYNLVLIAVSIGVALIGSGAYALHF"
FT   regulatory      131775..131804
FT                   /note="PROBABLE RHO-INDEPENDENT TRANSCRIPTIONAL TERMINATOR"
FT                   /regulatory_class="terminator"
FT   regulatory      131934..131940
FT                   /gene="ydfQ"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        131947..132285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfQ"
FT                   /note="SIMILAR TO THIOREDOXIN."
FT                   /db_xref="GOA:P96695"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96695"
FT                   /protein_id="BAA19385.1"
FT                   /translation="MKEMTGLHSLVSIENFIKQHKFSFIYISRPGCTVCHAVLPQLRIV
FT                   LDQFPNIKLGHINADDVAEVAGRFSVFTVPVLLLFIDGTEFLREARFVHFEQLEQKLKR
FT                   VYRLYEGE"
FT   regulatory      132297..132326
FT                   /note="PROBABLE RHO-INDEPENDENT TRANSCRIPTIONAL TERMINATOR"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(133447..134124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfR"
FT                   /note="SIMILAR TO YDFS GENE PRODUCT OF THIS ENTRY
FT                   (YDFS_BACSU)."
FT                   /db_xref="GOA:P96696"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96696"
FT                   /protein_id="BAA19386.1"
FT                   /translation="MNRLPFGYIKLRLAGRKANPMTNLIHHWSGGSMNFTWESLVLIVA
FT                   GVILLRISGRKSIAQMTSTQTVVMISIGTIIVQPIIEYSLFKTLIAAAIFTSTLIVMEW
FT                   IQMKSNTIEKMLTGKAKIVIENGQLHIENLKKMRLTADQLEMQLRLHGVTAIQDVKIAT
FT                   LEANGQLGIELTDDAKPLTVRDLKKLIHPDFINKDGQAQSGNQNIFDEVGKKNKKNVPK
FT                   KLH"
FT   regulatory      complement(134125..134132)
FT                   /gene="ydfR"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      134222..134227
FT                   /gene="ydfS"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        134237..134944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfS"
FT                   /note="SIMILAR TO YDFR GENE PRODUCT OF THIS ENTRY
FT                   (YDFR_BACSU)."
FT                   /db_xref="GOA:P96697"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96697"
FT                   /protein_id="BAA19387.1"
FT                   /translation="MIELEVVIRTVASFGLLLIAERILGKQTISQMTIFDFIAAITLGA
FT                   IAAGLAYNTSIKPHNMAISFSIFVLTIFLISFLSIKNRKLRKFFAGDPTVLIQNGKILE
FT                   SNMRKMRYTLDYLNQQLREKEIFNIEEVLFAILETNGQLTVLRKPQFRHVTKQDLMIAV
FT                   NQEQRLPIELIMDGEIIENNLKQNRLTESWLLEELRKRDIKVKETVYAVLLGNGDIYVD
FT                   QYKDHISVPMDKE"
FT   CDS_pept        complement(134959..135390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydfT"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="GOA:P96698"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96698"
FT                   /protein_id="BAA19388.1"
FT                   /translation="MDFEKIRKWLEITNEYKQSDFWTNVLKYKAPEHFFDSEASTFVYD
FT                   FYQDEEYNFIIVEMPGVYEEELTIRLLSKTQLLIKGTITPVFPAEMEVLRERYYGEIER
FT                   IIQLPEAAETHLLQIQLLNGLLHISYPRQVETVAFNKGL"
FT   regulatory      complement(135399..135404)
FT                   /gene="ydfT"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(135403..135645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydgA"
FT                   /note="SIMILAR TO YDGB GENE PRODUCT OF THIS ENTRY
FT                   (YDGB_BACSU)."
FT                   /db_xref="InterPro:IPR019618"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96699"
FT                   /protein_id="BAA19389.1"
FT                   /translation="MPYQINIANIKINGVTQNGNIDVGPTVHNSHTANSKYFGANFSLG
FT                   DLSPTSSLLNTGNIDSDVSDQDQIGNPSAPISNQI"
FT   regulatory      complement(135653..135660)
FT                   /gene="ydgA"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(135659..135931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydgB"
FT                   /note="SIMILAR TO YDGA GENE PRODUCT OF THIS ENTRY
FT                   (YDGA_BACSU)."
FT                   /db_xref="InterPro:IPR019618"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96700"
FT                   /protein_id="BAA19390.1"
FT                   /translation="MPSTVINLYYLKINSISGNGSITIGEAAYNSPTNNQKSQGTNSSF
FT                   GDTSPTESVMENFLNDPDVNDQTSIGNSDTSNVNAPPIAPPPILD"
FT   regulatory      complement(135939..135949)
FT                   /gene="ydgB"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      136217..136223
FT                   /gene="ydgC"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        136230..136817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydgC"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="GOA:P96701"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96701"
FT                   /protein_id="BAA19391.1"
FT                   /translation="MKSKGVESRKRLLKAAANEFSVRGFHDAKVSEIVKKAGFTQPSFY
FT                   LYFQSKEAIFAELITDFHSRVRKLTESLLLENGLNTEDVSKRVLLAVETVFQFLDEDKD
FT                   LTKIGFFLNPEAKQMKKDLAMVLKENLEAEQRLGYFHSELDMETVAECLVGMIEHLTES
FT                   FLLTGIKDPASLAAEVVNLLIYGMLPKGNDVR"
FT   regulatory      136797..136802
FT                   /gene="ydgD"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        136814..137158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydgD"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="GOA:P96702"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96702"
FT                   /protein_id="BAA19392.1"
FT                   /translation="MISIMMKVSLAVFMLAGGIIKVSRVPFQVEHWRHYQYPLWFLTVT
FT                   GILEIAGALAMTAGIWNRYAAIGAGVLFVVLMAGAIHAHMFRARQSVIMAIQAMICLIV
FT                   SIMIIMGSYT"
FT   regulatory      137305..137312
FT                   /gene="ydgE"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        137321..137794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydgE"
FT                   /note="FUNCTION UNKNOWN, SIMILAR PRODUCT IN SYNECHOCYSTIS."
FT                   /db_xref="GOA:P96703"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96703"
FT                   /protein_id="BAA19393.1"
FT                   /translation="MAFTLEDMTEEEFEAFRGMSVQNFAKQNITSGTWTEKEAFEKSEQ
FT                   AYENMIPNGRDSSNHYFWNITNDQGERMGWLWLYADPLHPQKEAFIYSFGLYEAFRGKG
FT                   LAQLALQTLDERARELGAERLALHVFAHNETAVYLYQKMGYAMTNIRMRKQLC"
FT   regulatory      137903..137931
FT                   /note="PROBABLE RHO-INDEPENDENT TRANSCRIPTIONAL TERMINATOR"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(137954..139597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="expZ"
FT                   /product="PROBABLE ATP-BINDING TRANSPORT PROTEIN"
FT                   /db_xref="GOA:P39115"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="PDB:6HA8"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39115"
FT                   /protein_id="BAA19394.1"
FT                   /translation="MKEIVTLTNVSYEVKDQTVFKHVNASVQQGDIIGIIGKNGAGKST
FT                   LLHLIHNDLAPAQGQILRKDIKLALVEQETAAYSFADQTPAEKKLLEKWHVPLRDFHQL
FT                   SGGEKLKARLAKGLSEDADLLLLDEPTNHLDEKSLQFLIQQLKHYNGTVILVSHDRYFL
FT                   DEAATKIWSLEDQTLIEFKGNYSGYMKFREKKRLTQQREYEKQQKMVERIEAQMNGLAS
FT                   WSEKAHAQSTKKEGFKEYHRVKAKRTDAQIKSKQKRLEKELEKAKAEPVTPEYTVRFSI
FT                   DTTHKTGKRFLEVQNVTKAFGERTLFKNANFTIQHGEKVAIIGPNGSGKTTLLNIILGQ
FT                   ETAEGSVWVSPSANIGYLTQEVFDLPLEQTPEELFENETFKARGHVQNLMRHLGFTAAQ
FT                   WTEPIKHMSMGERVKIKLMAYILEEKDVLILDEPTNHLDLPSREQLEETLSQYSGTLLA
FT                   VSHDRYFLEKTTNSKLVISNNGIEKQLNDVPSERNEREELRLKLETERQEVLGKLSFMT
FT                   PNDKGYKELDQAFNELTKRIKELDHQDKKD"
FT   regulatory      complement(139604..139613)
FT                   /gene="expZ"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      139877..139911
FT                   /note="PROBABLE RHO-INDEPENDENT TRANSCRIPTIONAL TERMINATOR"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(139917..141293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydgF"
FT                   /note="PROBABLE AMINO ACID TRANSPORT PERMIASE."
FT                   /db_xref="GOA:P96704"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96704"
FT                   /protein_id="BAA19395.1"
FT                   /translation="MTDDMTKDNINQQTLQRGLKNRHIQLIAIGGAIGTGLFLGSGKSI
FT                   HFAGPSILFAYMITGIICFLIMRSLGELLLSNLNYHSFVDFVQDYLGDMAAFITGWTYW
FT                   FCWISIAMADLTAVGLYTQYWLPGVPQWVPGLIALIILLIMNLATVKLFGELEFWFALI
FT                   KVIAILALIVIGLVMIFKGFSTSSGVSSFTNLWSHGGLFPNGMHGFILSFQMVVFAFVG
FT                   IELVGLTAGETENPEKVIPKAINNIPVRVLLFYIGALLVIMSIYPWDIINPSESPFVQV
FT                   FVAVGIVGAASIINFVVLTSAASACNSAVFSTSRMVYSLAKDHNAPESMAKLTQRKVPR
FT                   NALFFSAIVILIGVTLNYIMPEGVFTLITSISTVCFIYIWGITVICHMKYRKTRPELAK
FT                   TNKFKLPLYPFTNYLILAFLAFVLVVLALAQDTRVSLFVTPVWFILLIVIYKVRKAKHQ
FT                   "
FT   regulatory      complement(141303..141308)
FT                   /gene="ydgF"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(141465..141983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinB"
FT                   /note="DNA DAMAGE-INDUCIBLE DINB PROTEIN, SIMILAR PRODUCT
FT                   IN SYNECHOCYSTIS."
FT                   /db_xref="GOA:Q02886"
FT                   /db_xref="InterPro:IPR007837"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q02886"
FT                   /protein_id="BAA19396.1"
FT                   /translation="MSDFAFKLYEYNVWANQQIFNRLKELPKEIYHQEIQSVFPSISHV
FT                   LSHVYLSDLGWIEVFSGKTLSDALALAEQLKEQTEAKEIEEMEDLFLRLSERYILFLQQ
FT                   KEQLNKPLQIQNPSSGIMKTTVSELLPHVVNHGTYHRGNITAMLRQAGYASAPTDYGLY
FT                   LFMTKTEKA"
FT   regulatory      complement(141993..142000)
FT                   /gene="dinB"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      142138..142143
FT                   /gene="ydgG"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        142152..142610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydgG"
FT                   /note="FUNCTION UNKNOWN."
FT                   /db_xref="GOA:P96705"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96705"
FT                   /protein_id="BAA19397.1"
FT                   /translation="MNEQKLCQAINLFVEVLLEGTEFVHREINQDVFKHISREQADLLK
FT                   ILKVKGPTSPGSLAMYQNVHKSAISNRLKKLLEKGLVQWDDCPEKSDRRSKLINITPSG
FT                   EHILEELDSAIFNALKPLIDDIDEEHLHSIIEIFTILKSKFKGGDSAE"
FT   regulatory      142587..142596
FT                   /gene="ydgH"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        142607..145264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydgH"
FT                   /note="PROBABLE TRANSPORT PROTEIN, SIMILAR PRODUCT IN
FT                   MYCOBACTERIUM LEPRAE."
FT                   /db_xref="GOA:P96706"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96706"
FT                   /protein_id="BAA19398.1"
FT                   /translation="MRAIIKFKWAIAAIVLALTVVLSLFSPNLTELANQKGQAQLPADA
FT                   VSERANAILKQAGEDNNSISVVFTLDNAIKKETENQLRIIIDKIKKIDGVEEVTSPLSA
FT                   EKEVKDQLMSKDKKTVLMPVTITGSDKKAEKIADEIYQIVPDDLTAYITGASLINQDFA
FT                   HSSEEGLKKTEVITVCLIIGLLLIVFRSVVTPFIPIVVVGFSYLISQSILGILVYNVDF
FT                   PISTFTQTFLVAILFGIGTDYCILLLTRFREELANGHDKKEAALIAYRTGGKTLFISGF
FT                   AVLIGFSALGFAKFAIFQSAVGVAVGVGILMIILYTLLPLFMVTLGEKLFWPSKKVLSH
FT                   SDNKLWAFLGRHSVARPFLFIVITVVITLPFILTYDDQISFDSTAEISSDYKSIKALEA
FT                   IKDGFGEGKAFPINVVVKGDKDLTTADTIPYLGNISKAIEKVDHVDSVMTITQPTGKKI
FT                   KDLYIDNQLGSVSDGLDKTVKGIADVQSGLTDIENGLNQMAGQTGSASNGGSGGSLGDA
FT                   ADGLGKINQQLQLVSKQISQTGNTAQTVQQLTAISGQLGQIQTGLEQANQQLSGQQAQA
FT                   GTLTESLKKLSEGVKSANEGLTKVSDGITASSDILEDMSKSPTVRDTGIFIPDQVMKDK
FT                   DFKKSIDQYSFADGKGVQLSVVLDSNPYSEQAITTINQIKKAVANEVDGTPLENAQIVY
FT                   GGVTSMNADLKELSTTDFSRTMVIMIIGLFIVLTILFRSMIMPIYMIASLLLTYYTSIS
FT                   ITELIFVNGLGNAGVSWAVPFFSFVILIALGVDYSIFLLDRFKEEVHLGIEQGVVRSMS
FT                   KMGSVIITAAIILAGTFAAMMPSGVNTLMQVASVIIIGLLLYGLVILPLFIPAIIATFG
FT                   EGNWWPFGRKKGKE"
FT   regulatory      145272..145297
FT                   /note="PROBABLE RHO-INDEPENDENT TRANSCRIPTIONAL TERMINATOR"
FT                   /regulatory_class="terminator"
FT   CDS_pept        complement(145410..146039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydgI"
FT                   /note="SIMILAR TO NITROREDUCTASE."
FT                   /db_xref="GOA:P96707"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96707"
FT                   /protein_id="BAA19399.1"
FT                   /translation="MIKTNDFMEIMKGRRSIRNYDPAVKISKEEMTEILEEATTAPSSV
FT                   NAQPWRFLVIDSPEGKEKLAPLASFNQTQVTTSSAVIAVFADMNNADYLEEIYSKAVEL
FT                   GYMPQEVKDRQIAALTAHFEKLPAQVNRETILIDGGLVSMQLMLTARAHGYDTNPIGGY
FT                   DKENIAETFGLDKERYVPVMLLSIGKAADEGYASYRLPIDTIAEWK"
FT   regulatory      complement(146049..146056)
FT                   /gene="ydgI"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(146055..146549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydgJ"
FT                   /note="SIMILAR TO SALMONELLA TYPHIMURIUM SLYY GENE REQUIRED
FT                   FOR SURVIVAL IN MACROPHAGE."
FT                   /db_xref="GOA:P96708"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96708"
FT                   /protein_id="BAA19400.1"
FT                   /translation="MTCQSLIYQLIVLTGKKGWVLASFCSEEAEILYQLQGVNKVIGVK
FT                   FEACTGISQSRLELLTLLYHADEISQSDLQKKVNIDSAAVTRHLKQLESKGMVSRRRKP
FT                   EDNRITLVRLTDQGRERIESSKKEKERFMKEMLANVSAEERRLLIDVLARMRNNINNIE
FT                   A"
FT   regulatory      146842..146850
FT                   /gene="ydgK"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        146860..148068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydgK"
FT                   /note="SIMILAR TO BICYCLOMYCIN RESISTANCE PROTEIN."
FT                   /db_xref="GOA:P96709"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:P96709"
FT                   /protein_id="BAA19401.1"
FT                   /translation="MLHNPTGKERLALAFLLGMLAILGPLNIDMYLPSFPEIAKDLSAS
FT                   ASLVQLSLTACLVGLTIGQLIVGPVSDAQGRRKPLLICIFLFALSSLFCALSPNITTLV
FT                   AARFLQGFTASAGLVLSRAIVRDVFTGRELSKFFSLLMVITAVAPMVAPMTGGAILLLP
FT                   FATWHTIFHVLMIIGFLLVLLIALRLKETLPLEKRIPSSIGTSVKTMGSLLKDRSFMGY
FT                   ALTVGFIHGGSFAYVSGTPFVYQDIYGVSPQVFSILFGINGLAIISGSFIIGRFGGIIH
FT                   EKSLLRIAVITAMIATAVLLTMTMIHGPLATLVISIFIYMITIGMVLTSTFTLAMEKQG
FT                   HRAGSASALLGMLPLLLGSIVSPLVGINETTAVPMGAIMFVTAVIGSLAFFGLTKERVG
FT                   QNS"
XX
SQ   Sequence 148068 BP; 45164 A; 28420 C; 32882 G; 41602 T; 0 other;
     taaaaagcat cagtttacca gctgatgctt tttcaatatt gtcacaccgc ttagtgccaa        60
     attaccattt ataagtgatt gattctttct tgaaagcgtt ttatattaaa aggaaacctc       120
     tctatatcct ctactgcatc tccttgcgac ttcatccgca catcaagatt ggctaggagg       180
     tcttttttat gtatatgact gccagagaac aaaagctgtt aaagcactta ttattacaaa       240
     acagatatat aaccgtaact gagcttgctg agctgatgca agtcagcacg agaaccattc       300
     acagggaact caaatcaatt aaaccgctga tggaaaccgt ggggcttacg ttagataaac       360
     agcccggtaa agggttgaaa gcagtgggaa gtcccgaggg taaacaaaag ctgcttactg       420
     atttatcata tgaacagcat gaatacagcg ccgacgaacg gaaactgctc attctttgtt       480
     cgttattaga gtctcaggag cccgtcaaac tgtacacgct tgctcatgat ctccaggtga       540
     cgaatgccac ggtcagctat gacttagatg agctcgagaa gtggatttct ccctttggac       600
     tgacactgat ccgcaaaaga ggttttggca tccagctcat agggccggag aatgcgaaac       660
     ggaaaattgt cggcaacttg attgtgaacc gtctcgacat ccaaatgttt ttggaagcgg       720
     ttgaattaaa catcaaagga aaaaccgatt cttcagagaa aatgttcggg gttgtcagca       780
     aaggtgagct gttaaaaatg gagcgcatct tatttcagct caaagaaaaa atcgcttttt       840
     cattgtccga cagctcctat atagcgctcg tcgtccatct gacgtatgcg atcgaacgaa       900
     ttaagcttgg ggaaactatc accatggagc aaaatgagct tgaggaactg atgaatgcga       960
     aggaatacag ctccgctctt gaaatcgcgg gcgagcttga acgtgccttc ggcgtgacga      1020
     ttccagaggc ggaggtcggc tatattacaa tccatcttcg aagcgccaat cgaaaataca      1080
     aaacagaata caaagcgcag gaaattgagc tggaaacagc cctgcaaaca aagcggctca      1140
     ttgcttttat ttcagacaaa atcagaatgg atctgacgaa aaactactct ttatatgaag      1200
     gcttgattgc ccatttggag ccggccgtca gccgcataaa agaaaatatt gagatataca      1260
     atccgatgaa ggaacagatc aagcgcgatt attttctgct ttatatggcg atcgaagaag      1320
     gtgtcgaaaa gtattttccg ggcatgtcct tttctgatga tgaaatcgct tttatcgttc      1380
     ttcactttgg ctcggctctt gaaatcaaaa aagaagaagc aaaagtgaaa gcgcttgtcg      1440
     tctgctcaag cgggatcggc tcctcgaaaa tgcttgcctc cagactgaaa aaagagctgc      1500
     cggaaattga atcgtttgat atgtcatctc tgatcgagct aaaggggaag gatgttcaag      1560
     cctatgatat gattgtgtcc actgtaccga ttccttatga aaacattgat tacatcatgg      1620
     tcagcccact attaaatgag gaagacgcaa accaggtcaa gcagtatatc aagcggaaga      1680
     ttccccttat tcttaacaaa aaaagaagct cgaaggaaga ggcgcagcaa gctgatgtac      1740
     ctgacatgct ggaggcggcg gaaagcatag ggcggtatat ggaagttatc caagatgttc      1800
     tgcgccattt tacgctagct caactcaaaa caaacccgga ccatagcatg cttctgctag      1860
     agctttttca acagctgaag aaggatggcc tgatccgtga tccggaaaaa gccgcggttt      1920
     gcctggctga gcgggagaaa caagggggat tgggaatccc cggaacaaac atggcgcttt      1980
     atcatctcaa aaatgatgaa atcgtcctgc cttttttcaa aatgtttgat ctcagcaccc      2040
     cctatgaagt ggatggcatg gacggaaata ccctcaggat gacacgcatt ctcgtcatga      2100
     tggcgcctgg ctcattatct gctgaaggct cggagatttt aagcgcgatc agctcggcaa      2160
     ttatcgagag cggagaaagc atggcggggt ttcaggaaga aggaggacaa gaattgtatc      2220
     agcggttaaa ccgcatattt ttcacatgga tgaaagaaaa aaacatactg taaacctgca      2280
     tggcacacgt caaaaatttg gcgtgtgttt ttctgtggat ggggaacaaa ataagaaaat      2340
     gtgggactat tttatcattc agtattggaa taattccaaa atgaaatagt tttacaagtt      2400
     atcttttttg ggttaaaatg ggtgaggtaa ggaagaaaat ctaacaaatt attgaagatt      2460
     caagagaata tagagatgac gatatggaaa cattacagca tctgattctg catgacatgc      2520
     cgaatagcga agaaatagag gctgtaaaaa gcggagacca tacactgaca tataaaggtt      2580
     accgtaaacg gattaatcag ctggcgaatg ccatgcttca aaaaggaatt caaaagggcg      2640
     accgtgttgc attgctttgc aaaaacggcc atcccgcctc aactgttatg ttcgccgcac      2700
     ttgaaatagg tgctgttgtc gtacctgtca gctggcagct gaaaccatat gaaatgacag      2760
     gcattttaaa agcaagtgaa ccaaaagcga tgttttacgg agcggagttt aaagagatac      2820
     tggatgaagt tcttcctgaa ttgtcctcac tgtgtgtaac aatggaaaca ggaacagctt      2880
     acgaaacatc tgctgaattt gaagcgctgt ttgcaggtcc tgatcatttg ccagagacgg      2940
     aaatggtttc acctgatgat acagcacttc tgatgtttac atctggaaca acgggaaacc      3000
     cgaaaagatg catgattaca catggcggca tatacagata cgttaaaaaa tccaacagct      3060
     caatagcacg tatgaagggc cttcgttttc tcgcgtgcca tccgatttat catacgagtg      3120
     cgctcatttg catcatgctt ggaacgtttg cagaaacaac atttgtgttt acaaaggatc      3180
     aagatcctgt tcacatgctg aaggtcattg aagaagagaa gattcagacc gtgatggctc      3240
     ttcctgtgtt ctacacgtat ttgcttgagg cgtgggaaaa gcaccaaact gacttatctt      3300
     cgcttgttat tttaatgaca ggcggaacaa aagtgccgag cagcctaata agccgctatc      3360
     ttgatattgg cattccgctt gcgcatggct atggaagtac tgaggcttgg ggcatcagca      3420
     catggacgcc tgatatggga atggataaag cggcatctgc aggaaaacct gtggcaggtg      3480
     ttaaagtcaa agtggaagat cctctgaccg gagaagaact tcctcaagga gaaatcggcg      3540
     aaatcgttgt tcatactcca ttcttattta aaggctatga agacaatcct gaagcaacag      3600
     cgaaagtgct gcaaaatgga tggtttagaa ccggagattc aggatatgta gatgaagatg      3660
     gctttatttt catcacggga cgctacaagg atgtcattat ttacggaggc gataacgtct      3720
     atcctgatca ggttgaagaa gttatccagc agatcccggg aatccttgaa acggctgtgg      3780
     tcggtattcc tgacccgctt tacggtgaaa aaccgaaagc ttttatcgtg aaaaatggcg      3840
     gccagcgcat cacggaagag gatgtcatcg catttttgta aagaacgcct gtccgcttac      3900
     aaaatacctg aagttgaatt tgttaacgaa ctgccgaaaa acaaccttgg caaggtgaaa      3960
     aaagacgtcc tgcgcaatca ggctgtacat tcataaaaga agaagcccgt ccactttatg      4020
     tggcgggctt ctttgcagtt gcacagacgg aaagctcagg cttaatgttc ttaaattgta      4080
     tatcaatgtc ttcgaagccg gctgctttaa agtcagcaat catctgtctt ccaaatgatt      4140
     tggttttctc aggactggca tccgcttccc gcggctgcat cgtaatggct gctttgccgc      4200
     ctggctttaa tgcccgataa atctgtttta tgccttttgt ttggtcattc caaatggtgt      4260
     agttgttaac ggaaatcact ttatcataaa acgaggcggg gagaggaaat gtctcgatgc      4320
     ttccttgtat caggcgtacg ccctttggtt tcactctgcg ggcggccagc ttcagcatgg      4380
     cctctgatac atcaatccca tgaagatgaa catccttctc gcgtttcagc atctgctgca      4440
     tgcagtatcc cgggccaaac ccgacttcta aaatgctgtc cccgcgcgtg atacccagct      4500
     gattgattgt ccactgattc agtgtttgat tttcagcagc catgatgtac ccggcaatca      4560
     tgccgatgac gccctttggc ctgctgaaat cttctagaaa gcatgttaat cattcagcaa      4620
     ccaaccccct ttttgagtta atttcctctc agcgttccat gtgaaacatt tttctgataa      4680
     agcaatgcga aggtgccaag ccatgtttat ccaaagagtg tgtgaggtac acaacaaata      4740
     gacatgaaaa caaaggagga gaatcatcat ggcaaattat ccaaaagaac tgccggcaca      4800
     aactcaaagt cgccagccgg gaattgaaag cgaaatgaat ccaagtccgg tgtatgagta      4860
     cgaggattat aaaggagcag acaaattaaa aggaaaagta gctcttatta caggcggcga      4920
     cagcgggatc ggacgcgcgg tttccgtcgc ttacgcaaag gaaggcgcag acatcgccat      4980
     tgtgtataag gatgagcatg aagacgctga ggagacgaag aaacgtgttg aacaagaagg      5040
     cgtaaaatgc ctgctgattg ctggtgacgt aggtgaagag gaattctgca atgaagcggt      5100
     tgaaaaaacg gtcaaggaac taggcggcct tgacatcctt gtcaacaatg caggtgaaca      5160
     gcacccgaag gaaagcatca aagatattac gagcgaacag cttcaccgca cattcaaaac      5220
     aaatttttat tctcaatttt atttgactaa aaaagcaatt gattacctga aaccgggcag      5280
     cgccatcatc aatacgacat ccatcaaccc gtacgtaggg aacccgacac tgattgatta      5340
     tacagcgaca aaaggggcga tcaatgcctt tacaagaaca atggcgcagg cgcttgtcaa      5400
     agacggcatc cgtgtaaatg cagtcgcgcc gggtccaatt tggacgccac taatcccagc      5460
     tacgttccct gaagaaacag ttgctcaatt tgggcaagat acgccgatgg gccgtcctgg      5520
     acagcctgtt gagcacgtcg gctgttatgt gcttctggca tcagatgagt cctcttacat      5580
     gacaggtcag accctgcatg tcaacggcgg aaactttgtg acgacataag agggagtgag      5640
     acatatgggc atcacgaaag aagaagtgaa cagctactat caaaaagcag ggattgtatt      5700
     aacggacgag gaagtagacc aaatccagct gatggattac ggcttaggaa aagaaagaaa      5760
     agtcgggctc cagctcttcg tctacgtcaa tacagaccgt tattgttcaa aggaattggt      5820
     gctgtttccg ggacagactt gcccggaaca ccgccatcca ccggtcgacg gccaggaagg      5880
     caagcaggag accttccgct gccgctacgg aaaagtgtat ctttacgtag aaggagaaaa      5940
     aacgccgctt ccaaaagttc tccctcctca ggaagacaga gaacactata cggtctggca      6000
     cgaaattgag ctagaaccgg gcgggcaata cacgattcca ccaaacacaa agcattggtt      6060
     ccaggccggg gaagaaggtg ccgtcgtgac ggaaatgtca tcgacgagca cggataaaca      6120
     tgatatcttt accgatccaa gaatataagg atggcttaac agcccatcct ttttgtattg      6180
     aaaaaaacag aatcatcgct ataatgggta aaaaaggaaa gagggcgagg caatgttcac      6240
     ttgcaaggta aatgagcaca tcaccatccg attattggag ccgaaggatg cggagcggct      6300
     ggccgaactc attatccaaa atcagcagcg gcttggcaag tggctgtttt ttgcggaaaa      6360
     tccaagcagc gctgacacgt accgagaaac aatcattcca gattggcggc gccagtatgc      6420
     cgacctgaac ggcattgagg cgggtctcct ttatgacggc agcctatgcg gcatgatcag      6480
     cctgcataac cttgatcaag tgaatcgtaa ggcggaaatc ggatattgga ttgccaaaga      6540
     atttgaaggg aaaggcatta ttacagctgc ctgccgaaaa ctcattacgt atgcttttga      6600
     agagcttgag ctgaatcgtg tggcgatctg tgcggctgtc ggaaacgaaa aaagcagagc      6660
     ggttccggag cggatcgggt ttctagagga aggaaaggca cgggatggct tatacgtaaa      6720
     cggcatgcat cacgacctcg tctactacag tctgttaaag cgtgaatggg aaggcgaaaa      6780
     ataaagagca cactttcttg tttaaatctt ccccggatgt ggaaaagtaa cagcggagac      6840
     gttaaaaagg agtgattcga gatgaatcag caagacatta aacaaaaagt gcttgatgtt      6900
     ctagatcacc ataaagtagg ttcgctcgca acagttcaaa agggcaaacc gcattcccgc      6960
     tacatgactt ttttccatga cgggctgacg atttacacac cgacaagcaa ggaaactcat      7020
     aaagcggaag aaattgagaa caaccccaat gtccacattt tattaggcta tgattgtgaa      7080
     ggttttggcg acgcatatgt cgaagttgcc ggaaaagcaa agatcaacaa ttcggcagaa      7140
     ctcaaggaca aaatatggag ttccaaatta gagcgctggt ttgacggcaa ggatgatccg      7200
     aatctggtga ttcttgaaat tgaaccggag gatatcagat taatgaatgc cggggagaaa      7260
     acaccggtct cactcgaact ataaaaaatt tgtgttttca ggggcgatat gttattatga      7320
     atagctagta agaaaaataa gcaaataaaa aagaaagtaa acttcttttt tctgttttga      7380
     gagagaagct taccgcttcc caagcagcat aaccagctgc ccttattctt ttccttcata      7440
     acaaatcgcc cctaacgatg agatggaaaa aagacttttt tgttttacaa ttcacaccgg      7500
     cgcggcttcg gagccgcagt gacgattgag aggtagggct ttcgttgtct tgtgttcaag      7560
     aaatttccat ggtgtttact ttccagaatg attcttcgga acaatgcttt atgaatctaa      7620
     cccgcctgac ttggcggatg atataatctt tatttgcgta tagaaaagaa taagacaaac      7680
     cgcccggcgt acgccggacg gtttttttat tgcaaaaaac acatcgtact gaaacctcct      7740
     tgtcttcttt ccagtcttat ctctaggatg aaattggagg aagaataacg tgcatgtcat      7800
     tacaacacaa gtacttttta ttttttgttt tttattgctg attcactcga tagaaacctt      7860
     agcctatgcg acaaggcttt ccggagctcg cgttggattt attgcgtccg cgctttctct      7920
     gtttaatgtc atggtcatcg tatccagaat gtcgaatatg gtgcagcagc cctttactgg      7980
     gcatttaatt gatgatgctg gaaaaaacgc actggcgatt gtaggggagc agttccgctt      8040
     tttaattttc ggatcgacag tcggcaccat tttgggcatt atcctgctcc cgtcttttgt      8100
     cgctcttttt tcacgggcga ttattcactt ggcgggcggc ggcggctccg tttttcaagt      8160
     attccgaaag ggattctcga aacaaggatt caaaaatgcc ctttcctatt tgcgtctgcc      8220
     gtccatttca tatgtaaaag gatttcatat gcgcttgatt ccgaagcgtt tgtttgtcat      8280
     caacatgctg atcacatcga tttatacgat tggtgtgctt tcggctttat acgcaggcct      8340
     tttggcgccg gagcgcagca cgacagccgt catggcttcg ggtttgatca acggaattgc      8400
     aacgatgctg ctggctattt ttgttgatcc taaggtatcc gttcttgctg atgatgtggc      8460
     aaaaggaaaa cgaagctata tctatttaaa atggacctct gtcacaatgg tcacatcaag      8520
     ggtggcgggc acactcctcg cccagctcat gtttattccc ggggcctact atatcgcgtg      8580
     gctgacaaag tggttttaat aagaaaggct ggatcataaa gatccagcct ttttgcgctt      8640
     ccttatttat agttccttaa tccgcggtcg tacaaaaaat ttccgaatgg gacgaaagcg      8700
     gcgatgaagc cggcagctga ccatttcagc ggccatttga cagagaaggt tgcataagcc      8760
     aagacaagca aatacaaaat gaacaacccg ccgtgaaccg aaccgacaat tgtcaccgca      8820
     agcggaaggc ctgcccaata tttaagcggc atagcgatga acaacaggat taagagtgac      8880
     attccttcaa taaaacccat cgtgcgaagt cttccgatcg gcgtgtgcag cataaatcgc      8940
     cctccttgtg gacacgtttt cattttatac tataaacaat ccgggggggc atatgacagc      9000
     tttcaaaaaa tgttcggaaa acattcattt ttacatgcct tttctaggga actgtacttg      9060
     tcatttacaa aaatacccga gataatgtgt acaaaatcaa aaaagaagga tgttgaaatg      9120
     aaacttgacc agattgatct gaatatcatt gaggagctga agaaggacag ccgtttgtcg      9180
     atgagggaat taggcagaaa aattaagctg tcgcctccat ctgtaacaga acgggtaaga      9240
     cagcttgaat cgtttggcat catcaagcaa tacacgctgg aggtcgacca gaaaaaactg      9300
     gggcttcccg tttcctgcat tgtggaagca accgttaaaa acgcggatta tgagcggttc      9360
     aaaagctata ttcaaacatt gccgaatatt gaattttgct accggattgc gggtgcagcc      9420
     tgctatatgc tgaaaatcaa tgccgaaagc ctcgaagcgg tagaagattt cattaacaaa      9480
     acatcgccct acgcgcaaac cgtcactcac gtcattttct cagaaattga cacgaaaaac      9540
     gggcgcggtt agagagtgcc gcgcgaagtc tgttataata acaggatgag cgtgaaagaa      9600
     agagaagtga tcaagcatgt caaaaacagt tgtattagct gaaaaacctt cagtcggccg      9660
     ggatttagcc cgggtactga agtgccataa aaaaggaaac ggttatctcg aaggcgatca      9720
     atatattgtg acttgggctt taggccattt ggtgacgctt gctgatccgg aaggctacgg      9780
     aaaagaattt caatcatggc gcctagagga tctgccgatt atcccagaac ccttgaagct      9840
     tgtggtgata aaaaaaaccg gaaagcagtt caatgcagtc aaatcccagc ttacccgtaa      9900
     agacgtcaat cagattgtca tcgcgactga cgcaggccgg gaaggtgagc ttgttgcgcg      9960
     ctggatcatt gagaaagcga atgtccgaaa accaatcaag cggctgtgga tttcatctgt     10020
     gacggataaa gcgatcaagg aaggttttca aaagctgcgc agcggcaaag aatatgaaaa     10080
     cctgtaccat tctgccgtcg ccagagcgga agcggattgg attgtgggga tcaacgccac     10140
     ccgtgcactt accacaaaat tcaatgccca gctctcatgc gggcgtgtgc agactccgac     10200
     gcttgccatg attgcaaagc gcgaggcaga cattcaggcg tttacgcccg ttccgtatta     10260
     cggcatacgt gctgcagtcg acggcatgac gctgacgtgg caggataaga aatcaaagca     10320
     gacgagaacg ttcaatcaag atgtaacaag ccgtttgcta aaaaatctcc aaggaaagca     10380
     agcggtcgta gctgagctga aaaaaacagc gaaaaaaagc tttgcgcctg cgctttatga     10440
     tttaacggag ctccagcgtg acgcccacaa gcgcttcggt ttttctgcca aagaaacgct     10500
     ttctgtcctg cagaagctat atgagcagca taagctcgtc acatatccgc ggacggactc     10560
     tagattttta tccagtgaca tcgtcccgac gttaaaagac cgtctggaag gcatggaagt     10620
     aaaaccgtat gcccaatatg tcagccaaat taaaaaacgc ggcattaaat ctcataaagg     10680
     atatgtcaat gacgcgaagg tgtcagacca ccacgcgatt atcccgaccg aagagccgct     10740
     cgttctcagc agtctgagtg ataaagaacg aaagctgtat gacctgattg cgaaacgttt     10800
     cctggctgta ttaatgcctg cattcgaata tgaggaaaca aaggtcatcg cagaaatcgg     10860
     cggagaaacc tttacggcga aaggcaaaac cgtgcagtcg caagggtgga aagccgttta     10920
     tgatatggcg gaagaggatg atgagcagga ggatgacaga gatcagacac ttcctgcgct     10980
     tcaaaaaggc gacacacttg ccgtccgcac gttaacggaa acaagcggcc aaacgaagcc     11040
     gcctgcccgc tttaatgaag ggaccttgct gtcagcgatg gaaaacccaa gcgcgtttat     11100
     gcagggagaa gaaaaaggcc tcgtcaaaac gcttggagaa acaggcggcc tcggcacggt     11160
     ggcaacgcgt gccgacatta ttgaaaaact gttcaacagc tttttaatcg agaaaaaagg     11220
     ccaagatatt tttatcacat ctaaaggaaa acagctcctg cagcttgttc cggaggatct     11280
     gaaatcaccg gccttaacag cagaatggga gcaaaagctg tctgcgatcg cggccggcaa     11340
     attgaaatcg gctgttttta ttaaagatat gaaggcttac gctcaccaaa cggtaaaaga     11400
     aatcaaaaac agcagccaaa ccttccgaca tgacaacatt acgggaacgg catgtccgga     11460
     atgcggcaaa atgatgctga aagtaaacgg caaacgcggg acgatgctcg tgtgccaaga     11520
     tcgtgaatgc ggaagcagaa aaacgattgc ccgaaaaaca aacgcacgct gcccaaattg     11580
     ccataaaaga atggagcttc gcggccaagg cgagggccaa acctttgcgt gtgtgtgcgg     11640
     tcaccgtgaa aagctctctg tatttgaaaa acgaaaaaac aaagacaaag cgcgtgctac     11700
     caaacgggac gtatcctctt atatgaaaaa acaaaataaa gatgagccga ttaacaacgc     11760
     gctggcagaa cagctgaaaa aactcggttt ggataaataa taaaaaaacc tgtgcctatc     11820
     gcacaggttt tttattggac ttaggtcctg ttttcttaat gttcaaaaag ggaaaaaaaa     11880
     gctagcaatc tgcatttttt ttcttttata gtaaatgtac tttgtaacat ggcagtcata     11940
     ttttcgtcta taactatttg tgagcgtctg atttgcttca ggcgacaaag ggggatttgc     12000
     ctgtgaggca tgtactaatt gctgtcatct tattcttctt atctatcgga ctttccgcag     12060
     ggtgtgctga agctggaaac aagacccaaa atcagtcggc gacagaagtg aatgccagcc     12120
     cgctccagcc ggcggaatat ttcatctatc acaatttaat gaatgacaaa gggctgatca     12180
     aaaccgattt ttcagaccag ccttcttact tgtcggaatc tctcggactg tggatggagt     12240
     ttctgctcag caaaaatgac gcaccacatt tccaggatca atatcagcat ctgactgatt     12300
     catttctgat gagcaatcac ttggtgacgt ggaagattca aaatggccaa gcgagcggga     12360
     cgaatgcgct gatagatgat atgagaatta tgctgtctct tgaccaagcc gccgcaaaat     12420
     ggggccgcag cgactacgcg caaacggcta gggatatcgg cacgtctttg aagacataca     12480
     atatgaacaa cgggtttttt acagactttt acgactcaca ggccgcttca aaggatgtga     12540
     cgctttcata cgtcatgcct gatgccttag ctgtcttaaa gaagaatgga atcatagacg     12600
     aagaaacaga acagcggaat gccaatgttc tctattcagc tcctttaaaa aatggctttc     12660
     tgccgaagac atacagctcg gagacgaagg aatacacata tgatagtgaa atcaacctga     12720
     ttgatcagct ttacgctgct tggcatttgc cggaagggga tgaaaaagca tctgttttag     12780
     cggactggat caagcaggaa tttcagaaaa acggaaagct gtacgggcgg tattcggcat     12840
     atacgaagga gcctgccgtc caatatgagt ctccatccgt atatgcctta gccgtattgt     12900
     ttttgacaaa acagcatgaa aacagttctg tcatcaaagc catatatgat agaatgaatg     12960
     actttgaaat tcatgatccg gtgaaatcgt attatggagg ctatatgagc ggcactcaga     13020
     cgcattcatt tgacaatctg ctgccgctgt tagccgaaag gaagcttttt aatgaaaata     13080
     tcattcagtg aatcacaaaa attatttgct tatttttcag ggctcatcgc ggccctgtct     13140
     ttgtttattt attatgtgtc agcccagcaa tcagaaggtg ctctgatcct ttgcatcaca     13200
     tttggcgtca tcgccgcagg catctggttc ggcccgattt acgcgctggc agtgacctta     13260
     atcgtactct ttgttctcgg caccttaatg atgtttttcc agactggaca gacatcgctc     13320
     tttccggctg aggaagggct gcgaatgctt gtcgtgtggg gaatcgcgct tttgctgttt     13380
     tcttttattt ctggaagaat ccacgatatt acagcagagc ttcggcgctc aatgacacgg     13440
     cttcaatccg aaattaaaag ctatgttgct gttgacagag tgactggttt tgataacaag     13500
     caaaggatga agctggaact ttcagaagaa atcaagcggg cggagcgcta cggcaattct     13560
     tttgtgtttt tgctgctcca tatgcattat ttcaaagagt ttaagtcttt gtacggtgaa     13620
     aaagaaacgg accgcctctt ccaatatgtc ggtcagcaaa tcaggacaag cgttcgggaa     13680
     acggataaga aattccgtcc ctctgacgag cgtatcggga tcgtgctgac gcacacgcct     13740
     gctgaacata tgccggccgt tctgactaag ctgaagaaac aattggatac atatcagctg     13800
     gaaaatggaa agtatgtgtc gcttacgttc cacgtttgct atttgcccta ccgcaacgat     13860
     atccaaacag ctgatcaatt tttagaagaa ctggaaaacg agatgatgat gaatgaacta     13920
     taaaggaatc acattgctat gcgtcatgat gcttctattt tcagctattg cgtcttttcc     13980
     cgtttctgcg caagcgaaag atcaggatgc cggcattctc atcatctact caaccttgga     14040
     cggcaaagag tcgtcacaag tcaaaatgct cgatttgctt gcgggccact ttacatccca     14100
     tgtgacagtc aaaaaagatt cagacgttga agcgtcggat ttcaaaggga aagaccatgt     14160
     gatttattac ggccaaacga aaagaaagct cagccaaaaa ttgctgtctc ttatcagcgg     14220
     cgtgaaaaaa ccggttgtcg ccattggcta taacgcaggc caaatcagcc aattttctgg     14280
     gctttcatta gcccgcaaag aaaatgtgtt tcaggttcac agcaggtcag aaaaggccga     14340
     tgtgtctctg gaaagcgggc ttaacgtgct gagtgtatca ggcctgaaag gaacggcgct     14400
     ttacaccttc aaagcggatg aaggcacaac gcattctttt atatggaaaa caaaaaaagg     14460
     gaatgtgtac attggattaa caaatttgtt aaatgacaat ttgatcgtgg cgaaacagct     14520
     cagagaagct ttcggagaga aggcggggac gacgttattg tatttgcgtc tcgaggatat     14580
     cagcccgatg tctgatgaaa aactgctgct tcaagccggt acatacctgc ataagcggca     14640
     tattcctttt atcctggcgg tcattccggt ttacttgaat ccggaaacag gcgacaaagt     14700
     gtatttgtct aatcaaccga agatggtcaa ggtgctgaag aagctgcaaa gcatgggcgg     14760
     cagtatcata gttcacggct atactcacgc ttatcgctac agtgaaacag gagagggatt     14820
     tgaattttgg gatgcaaagg cggatcagcc gattacatcc ggaaatgccg aagacccccc     14880
     gtccattttg gagaaagaac aggacttccc gaacgaacaa gcctatcaca gctatcttga     14940
     accatttcgg gaaaaggaag aaacgtatac aaaacaaaaa ctgacgcgtg ccattgagga     15000
     tttgacatca tcgggtcttt acccgctggc gtttgaagcg ccgcattaca cgatgtccga     15060
     atatggctat caaatcgcct cgcagtattt tacaagcatt ttcggccagg tccagctcag     15120
     cagcacaaca tggaaaacat ccggtgcacc tccgtttgtg actgctcctt cgatgctgca     15180
     cggaatgacg ctttatccgg aaacgatcgg ctttgtcgac acatcgaagc aaaacccgct     15240
     cggtgagatg gaggagcata tctcccagat gattgatttt gaaggcggag tagccggagg     15300
     attttatcac ccgtaccttg ggatgaaata tctgcctgag ctggttgatc agatggaacg     15360
     cattccagac agtgaatggc ttgatttaaa gaaaacgaaa caaaccgtca aaacagacaa     15420
     agtggaaatt catacaagcg gtgacggaac gattcaggtg aaaaacggcg taagccccat     15480
     ttacgagttt ttcgatcatc accggcaaac ccctctggaa aaggcgttat ggattctctc     15540
     cgctgttgtg ctcttatttg tcatcatgtt tgtcagttat acgttttact tgagagccac     15600
     attgaaaaaa cgaattttta aggagagaag aagccttggg taatacgctg ttctttatct     15660
     cgctaagttt aatatgggtt atgcttctct accacatgtt cctcatgcag ggcgggtttc     15720
     gccactatat gaccttcgaa cggaatatcc cgaagtggag agaaaatatg aaggaactgc     15780
     cgaaggtcag cgtcctcatc ccggcgcata acgaagaggt tgtgattcgg cagacgctga     15840
     aggccatggt caacctttat tatccgaagg accggctgga gattatcgtc gttaatgata     15900
     attcatcaga ccggacgggt gatatcgtca atgaattttc cgagaaatac gatttcatca     15960
     aaatggtgat tacgaagccg ccaaatgcag gaaaaggaaa atcctctgca cttaactcgg     16020
     gttttgccga atcgaacggc gatgtgatct gtgtgtatga cgccgacaac acgcctgaga     16080
     aaatggccgt gtattacctc gtgctcggcc tgatgaatga cgaaaaggca ggcgccgtgg     16140
     tagggaaatt ccgcgtcatc aatgcggcaa agacgctgct gacgaggttt attaatatcg     16200
     aaacgatctg ttttcagtgg atggcccagg gaggcagatg gaagtggttc aaaatcgcca     16260
     cgatcccagg caccaacttc gcgatccgca gaagcattat cgaaaagctc ggaggctggg     16320
     atgacaaagc gctcgctgag gatactgagc tgaccatccg ggtatataat ctcggctatc     16380
     acatccgctt tttccctgcc gccatcacgt gggagcagga accggaaaca tggaaggtat     16440
     ggtggcgcca gcgcacccga tgggcgcgcg gcaatcaata tgtcgtgctc aaatttttgg     16500
     cgcagttttt taagctgaaa cgaaaacgga ttatctttga tttgttttat tttttcttta     16560
     cgtacttcct gtttttcttt ggcgtgatca tgtcaaatgc gatttttgta gtgaatttgt     16620
     tttatgattt gcatttgtct gttggatttt tggcaatgat tctctggatt ttggcgtttt     16680
     tcttatttat gacagaggtc atgattacgt tgagcattga aaaaacagaa atgaacaagc     16740
     aaaacttttt tatcgtattt ctcatgtact tcacatactc gcaggcatgg attgtgcttg     16800
     ttatctactc tttattcgta gaaatcaagc accgtttatt caagcaagag gtcaaatggt     16860
     acaagacaga acgatacaat caacataaaa gcgggtgacc tttttgaaac aaataatgat     16920
     ttttctcaca agcttcatgc tgctggcgat gactggacaa acggctcttg ccaaagacgt     16980
     acaggtcagc ggttcgctcc ttgggaaaag cagccaagaa caagccaaac agcaggtgct     17040
     gacaagcgag ctgattacac tgtatggatc aaaagacagc gcagagctga cgtatcagat     17100
     cccggcaggc gcctcttcgg gcaatcagca attggtaatc gaatacgagg catcaaatct     17160
     tttaatttct ccatcatcgt taacggttgt cattgatgat gaaccggtca agacgttaaa     17220
     gcttgatggt gattccaaac ggaaaacagt gaagctgaat ctgaataaaa gccagtctgc     17280
     gcaaggctat cacaacgtat cgctgaaatt ctacggcgta atgaaagagg gcgtgtgcgt     17340
     cagacaggat acatcaggca actggatcaa aatttatccg gacagccggc tgacacttgc     17400
     tgacagcagt gaagcgaagg gaacgtcgct ggaccattat ccgtatcctt tcgcccaatc     17460
     tggaaataca gcggaagaaa cagctatcgt cattccggat aacccaagtt cagcagaaat     17520
     agaagctgct gttaaaacag aaggctattt gaaaacggtg gacagcagtg tcagtattgc     17580
     gtatgtcacg gaatctgaac tgaaaaaaat cgataagccg acgattgtta tcggcgtgga     17640
     caagcattgg aacggcaaag tgaaaaaact gttgaaacaa gccgggctac aggcaaaagg     17700
     agaaaacctt ctgcttgcgg agcgggtgct gaaagcagag ggcaaacagc agccggttct     17760
     gtttgcgcaa gcggcgtccg aggacgcgct cacaaaaaaa atcagcgtga tgacagatca     17820
     gacatataca ggccagctca gcggcgatac actttcaatc agcaagcttc agcagactga     17880
     aaaaaaagaa agcgataagc tgacccttga gaattttgga gcgggtgata tcacaattgg     17940
     agccgacaaa acatcttcag cacattattt ttatccggct tcggctgttt tagatgaaaa     18000
     ccaatcggcg aagctgtcgc ttaaactgaa aaagtctgaa acgattcaag cctcaacggc     18060
     tgaaaacgag tcagcctctc aggctgcaga actgaaagtg atgatcaacg gccagccgca     18120
     ctcggtccgg cttgatgaat taggaaaaga agataaaaac ggattctatc atgtcacagt     18180
     gaaagtggac cctaagctgc tgcaaaaaaa ccgctacatt gatattcagt tcgtcacgac     18240
     cggtttaaag gaaaacaacc cttgtaacac cactgatgaa gaaaagtggg tttttatcga     18300
     taaaaacagt acattatcat acgccatcaa aggcatgtcc ccgtcagcgg attttcaaga     18360
     gtggccgctg ccttacgccg gaaaccagga tcaaacaacg ttaatcgtgc ttcctgacac     18420
     cgtaagccaa tcgaagctag aggagctttc tctcgtaaca gaatcctttg gcaacgaagc     18480
     acagcattca tatacggtaa agaaatcatc tgacgttaca gcaaatgatg cgaaaggacg     18540
     aaacctcatt ttcataggag ggatcaatca attttctctt ctgaaggaga aatcatcaga     18600
     tctgcttgtg ccgcaggaaa agaacggctc gtttgatgta tctagtttcg agatgctgaa     18660
     tgagacgaca aaacaagtgg tatttaccca agcatcggtt tgggattcac gctatacaat     18720
     ggctgtcttt gcaccgtcaa aaggagatgg cacggctgtc acaaaagaga tcatcagtta     18780
     tctgaacagc aacgatgagt cggcaaccgt ccttaatgaa acaaacagcc agcaggtgtt     18840
     tacaaaccac cagcagctca aatcggaaac aaacagttcc gatgcagaac aaccaacaca     18900
     ggatcatagc cagaaatgga tgtatattgg tgtgctggca ctcattatgg tggttgcggc     18960
     agtgttcatt tggattgccg taagacgcaa aaaaagaaag acagatacag aataaaacag     19020
     aggcgatttt agcctctgtt tttttatttt tggtaagtaa attccatttg tggaacctgt     19080
     cattttattt ttttctctca gccaataagc ctctttacaa cgtgcgggaa cgggagtatg     19140
     atctctttta gaaaacaaat cgcttaatct gaaatcagag cgggggaccc aatagaacgg     19200
     ctttttgccg ttggggtgaa tcctttttag gtagggctaa ctctcatatg cccgaatccg     19260
     tcagctaacc tcgtaagcgt tcgtgagagg agatgaatga aacctgtgtt cgatgttatg     19320
     gcacaggggc atccgtttgc ctctgtgttt tttgttgttc atttttgaat gcaaatcgca     19380
     tacagagaca tcatagcaga aaggactatc atcaacatgt gagagcaaga cactgatgga     19440
     tgttttattg ttttaattga aaaatgagaa attaaaaggg gaagacatcg atgtatcatt     19500
     caatcaaacg ttttttgatt gggaaaccac taaaatccca agcagctgga gagcaaaaac     19560
     tgacgaaatt aaaagccttg gctatgcttt cctcagatgc gctgtcatct gtcgcatatg     19620
     ggacagaaca aattctaatc attttggcaa caatcagtgc agccgcattt tggtactcca     19680
     ttccgattgc ggttggcgtt ctcatcttgc tgctcgcact gattctttca tacaggcaaa     19740
     ttatttacgc ttatccgcag ggcggcgggg cgtatatcgt ttctaaagaa aatctcggtg     19800
     aaaaaccggg attgattgcg ggcggttcat tgcttgttga ttatatttta acagtagcgg     19860
     taagtatttc cgcaggcacg gatgccatca cgtcagcctt tcctgcattg catgattatc     19920
     atgtgccgat cgctattttt ctcgtgttag tgattatgat tttgaacctg cgcgggcttt     19980
     cggaatcagc atccatactt gcctacccgg tttatctgtt tgtggtggcg cttttggttc     20040
     tcattgcagt cgggttgttt aaacttatga caggacaaat agaccagcca gcccatcata     20100
     catcgctcgg cacacctgta gccggcatta cgctattttt gctgcttaag gctttttcct     20160
     ccggatgctc agcgttgacc ggggttgagg ccatttctaa tgcgattcct gcattcaaaa     20220
     acccgcctgc gcgaaacgcg gcaagaacgc ttgcgatgat ggggattttg ctggcgattc     20280
     tgttttccgg catcacggtt ctcgcgtacg ggtatggtac ggcgccgaaa cctgatgaaa     20340
     cagtggtttc acaaattgcg tccgaaacct ttgggcggaa tgtgttctac tatgtcatcc     20400
     aaggtgtcac atcgcttatt ttggttcttg cggcaaatac gggattctca gccttcccgc     20460
     agcttgcctt caacctggcg agagaccagt atatgccgcg aatgtttaca gtcaggggcg     20520
     accgcttagg cttctcaaat gggattatct ttttaggctt tgcctccatt gttctcatta     20580
     tcttattcgg gggacagacg gagcacttaa tcccgttata tgctgtgggc gtatttattc     20640
     catttacgct ttcacaaacc ggcatgtgca tgaaatggat caagcaaaaa ccaaaaggct     20700
     ggatcggaaa aatgctgatc aactcctgcg gcgctctgat atcatttatg gttctatcca     20760
     ttctgtttgt gacgaagttt aatgtcgtat ggcctgtgtt aatctttatg cctatcgtcg     20820
     ttttgctgtt ttttgcgatt aaaaatcact atactgcggt tggtgaacag cttcgcatcg     20880
     tagacaaaga gccggaagaa atcaaaggca ccgttgtgat tgtgcctgtg gccggtgtca     20940
     ccaccgtcgt gcaaaaatcg attcactatg cgaaatcact gtccgatcag gtgatcgccg     21000
     ttcacgtgtc atttgacaga gaacaggaaa agaaattcga aaaacgttgg gaagagctta     21060
     ataacggagt gcgtctcgtg acgcttcact cctcttacag aagccttgtc catccgtttg     21120
     ataagttttt ggaaacagtt gaggcaaaag cgaagaagga gcagttttcc gttatggtgc     21180
     tgtttccgca atttataacg aaaaaacgct ggcacaccat ccttcacaac caatcggcct     21240
     tcctcctcag agtccggctg ttctggaaaa aggacataat ggttgccaca ctgccgtatc     21300
     attttaaaaa gtaaagctct aggaccaagg gaatcacctt ggtccttttt agcgggaaaa     21360
     ggaggtatgg gggtgtatac acaaggtgct tttgtgatcg tattgaacga aagtcagcaa     21420
     attctgctgg tgaaacgaaa agatgtccct ctatgggatt tgccgggcgg cagggttgat     21480
     cccggggaat cggctgagga agcggcagtg cgggagatat tggaagaaac gggatacaat     21540
     gcagcgcttt ctgcgaaaat aggtgtttac caaaggccaa agtttcaaga tgaacagcat     21600
     ctgtttttcg gaagcattac aggcggacaa gcaatggctg acggcacaga gacagcggga     21660
     ttaaagtggg tttccccggg gcgtttgccg ctttttatgg tgccgaatcg aaaaaggcag     21720
     atcaatgatt tcaagaacgg cgctcaagat gtaaatgtca ccgtcaagga tagcgggttg     21780
     ctcgcggcga tcgacctgtt gaaaagaaga ctgggcaagt gattcaggtc tccgggtttt     21840
     aaagcctttc tcctgtggta ttgaaaaaag gaaaaaggag gatacgttat ggcacacaaa     21900
     actgcaggac aagcaatgac agagctgctt gagcaatggg gagttgatca tgtatacggc     21960
     atccccggag acagtataaa tgagtttatc gaagaattaa gacacgaaag aaatcaactg     22020
     aagttcattc aaacccgcca cgaagaggta gcggcactgg cagccgcggc tgaagcaaaa     22080
     ctcaccggca agatcggagt ctgtctgtca atcgcagggc cgggagcggt gcacttatta     22140
     aatggtttat atgatgctaa agccgacggc gcccctgtgc tggcgattgc aggacaggtt     22200
     tcttctggcg aagtcggacg ggactatttc caggagatta agctggagca aatgtttgag     22260
     gacgtggccg tgttcaacag agaggtacat agcgcggaat cacttccgga tctcttaaat     22320
     caggcgatca ggaccgccta cagcaaaaaa ggcgttgcgg tattgagcgt gtcagatgat     22380
     ttgtttgcgg agaaaatcaa acgggagccc gtgtatactt caccggtgta tattgaaggg     22440
     aacctagaac cgaaaaaaga acagctcgtc acctgcgccc aatatattaa taacgctaag     22500
     aaaccgatta tcctggcagg gcagggaatg aaaaaggcga aacgggagct cttagaattt     22560
     gcggacaaag ccgccgctcc gatcgttgtt acactcccgg caaagggtgt tgttcccgat     22620
     aagcacccac attttctcgg caacctcggt cagatcggaa caaagccggc ttacgaggca     22680
     atggaggaat gtgatttatt aatcatgctc ggaacgtcat tcccgtaccg tgattatttg     22740
     cctgatgaca cgccggcgat acagctcgat tcagacccgg caaaaatcgg aaaacggtat     22800
     ccggtgacag cgggccttgt ctgtgattcg gctctcggtt tgcgcgaatt gacagagtat     22860
     attgaacgca aggaagacag aagattcctg aatgcctgca cagaacatat gcagcattgg     22920
     tggaacgaaa ttgaaaaaga tgagacagag gcaacaacac cgcttaaacc tcagcaggtc     22980
     gtggcccgtc ttcaggaagc ggcagccgat gatgcggtgc tctctgtaga tgtcggcact     23040
     gtgacagtct ggatggcgcg tcatttcaaa atgaacgcga atcaggattt catcgtttcc     23100
     agctggcttg cgacaatggg ctgcggcctg ccgggagcga ttgcagcgag cttgtccgaa     23160
     ccggaacgcc aggcgatcgc cgtctgcggt gacgggggat tttccatggt catgcaggac     23220
     cttccgaccg ccgttaaata taagctcccg atcacagtcg ttattttaaa caacgaaaat     23280
     ctcggcatga ttgagtacga gcagcaggtc aaaggcaata tcgactatgt cacaaaactt     23340
     caaaatgtcg actatgccgc atttgcagaa agctgcggag caaagggcat caaagtgacc     23400
     aaagcggaag agcttgcgcc ggcttttcat gaggcgctgc actctgacca accggtcgta     23460
     gtggatgtca tgattggaaa cgaaccgccg cttcctggca aaatcaccta cgggcaggcg     23520
     aaaggcttta gcaagtacat gctgaaaaac ttcttcgaaa accaaaaatt tgaaatgccg     23580
     tcactgaaga aaagtttgaa acggttattt taaaaaaaca ggggccctaa gagcccttgt     23640
     tttttttttt tttttggaaa caaatgtatt tcagcatgtt tgaattcata aaatgatcgg     23700
     tatatgtatt aggaactgat ttcgccatac tcgaaacaga caaaaggaca aatgcatctt     23760
     gtttcaaagg aagatgcatt tgtccttgca tgcttattct tatcaaatct tacagaactc     23820
     ttctcataat aggttatttt tcttttttct tcagcccgaa gaagaaagga aaagcagaac     23880
     cgaccaagaa ggtgccgaat aaaaacatgc cgccgataaa cacgtggaaa tttgtgtgtc     23940
     cggccgtaaa cgccgtgatt agggaaatga tactgagcac gatcatggca atgccgggcg     24000
     cgactctcat ttttcccttg gatttatggg cagcaacaga acataaaatg ccgataacaa     24060
     taggaacaat ccacaaataa aacagaataa atactgacat catcaaaact ccgatttttc     24120
     ttctatcata acaaatttct gtcaaaaagg gtatcaatga gcttttgcgg aaaaataaaa     24180
     accggcttta gaagccggtt tttttatcga aacgtatcta caattaaaaa cacattcaaa     24240
     gcaacgatca atacagcaat cagccaagac accactgtga tccatttggc gttgatcaga     24300
     gatcccatga tccgtttatt gcttgtaaac ataataagcg gaatgagggc aaaggcgatc     24360
     ccgaaggaca gcacgacctg gctcagtacg agagcggtcg tcggattaac acctgacgcg     24420
     atgatcaaga tcggcggaat gatcgtgata aaacgccgta catacagcgg aatgcggtag     24480
     ttgataaatc cttgcataat cacgtcgcct gaaagtgtgc cgacagacga actggataga     24540
     ccggcaacga gcagcccgat cccgaacaaa gccgcagaca tagggctgac aagatgtccg     24600
     aattgctgaa atgcgacgtc gagatcctca acaaacaggc cgtttttgaa gaataatgcg     24660
     gcagccacaa tcagcatact tgcattaata gcccctgcaa tcagcatcgc tattaaaata     24720
     tcaataaatt caaacctaaa gatttttttc cgttctgcat cagttttgcc aaccacccgc     24780
     cgctgtgtaa gggcagagtg taaataaatg gcgtgcggca taacagttgc gccaagaata     24840
     cccgctgcaa gaagcacact gtcggtgcca tgaaacgccg ggacaaaaag gcccttcatc     24900
     actgacacgg catcaggctt tgcgaaaaag gtctgcaacg caaaggcgat cacgaccaca     24960
     aacagcatac cggcaatacc tgcttcaagt gagcgataac cacggcgctg aagctccaat     25020
     atcgcgaaag aaccgatcgc cgcaataata gacgcttcaa gcatcggaat gccgaacagc     25080
     aaatacagtc ccagagccgc tccgataaat tccgccagat cagttgcgat aatgaccaac     25140
     tcgccctgaa tccataatcc gatcgagaca ggcttcggga attcttcacg ggcaacctca     25200
     ggcagatttt tgcctgtcgc aataccgagt ttggcggata gggattgaat taaaagcgcc     25260
     atgatattgg aaaataagat cacccataag agcatatatc cgtatttaga acccgccgaa     25320
     atattcgttg cgaagttgcc gggatcaata taggcaatgg ctgctataaa tgcagggccg     25380
     agaaaaggga gcagccctct gaatcctctg attttcccgt caagcgcatc ttggacggct     25440
     ttggaacggg gagattgtgc tgtgatgtcc ttgttcatca tgtctcacct gaattctgtt     25500
     tgtttttgcc gtacaacaaa gagtttcctt aaggcaaatt attttatcta catcatatga     25560
     ccatcccggt ttcttgtcaa ccgaaaatgt tcaaaataca cttctgaatt tttccctgtt     25620
     atgtaacatg atatgtaggg attcgtgata aggtcccata taaaaagaca tcgtttcatt     25680
     tcgaaacgat gcctcctgta tctaatgagt ctaggcttcc ttccgcagcc cgcggaatat     25740
     aaggcccagc aagaacacga agatggctgc cccgatgatg gccgggaaaa tagcaaagcc     25800
     ggcgaggctc ggtccccatg tgccaagaag tccgtgccca atccaagcgc cgatcagccc     25860
     ggcaatcata gagccgaaaa ttcctcccgg cagccggttt cctacaatgg cgctcccaat     25920
     taatccgata acaattgcaa caactaatga aaccaaaaag ctaagcatca tgatcacctc     25980
     tcataaatga tttaccaatc aataaccgct cctgatcatt tcgaaacact tgaaagcata     26040
     ttcctttatg atcctgtttt aatctttctc tgcacactgc cgtcagctaa atgaacaatg     26100
     acctcagtgc ctttatgcgc cgcgatttcc tttgcccgtt caatcgcttc tttctttgta     26160
     tccttgattt cagacacacg tttggcgccc tcggctttga ctgcccagcc ttttttatgc     26220
     ttaataacat gctctgcttt attcatgagc tcggggccgc tgccgctgct tggatcagca     26280
     tcgcgttctg tctcatcatc atgcgtcagg aaatcatcaa tttcatctgt agaggcgttt     26340
     tccgcccatt ccttcgcttt gcttgtcgca attggaatcg cgcgcccttc ctcatagcct     26400
     tcatcaatca tcgcattcgc aatgtctatc gccttttttc tcaccggctt ctcaagattt     26460
     tttaatgaag caggataatc cttcatcgac caaggcatgt ctatcactcc ttttcctttt     26520
     ataaaaatgg tacccgcagg tgaaaaataa aaacgcatcc gaaaaaatga aggtatacta     26580
     tatagtagaa aaaacggaag ggaagtgcgg gttgggtgcc aacagaacga aaagaagact     26640
     tacatcagca attaaaagag atagagaaat gggaaaaaga tcagcaaaaa gtctggtttt     26700
     gggaaaagct cagccgtctc ccgtttcaac tcctggacaa gctgacacca gaattcatcc     26760
     agaaaaagat cggcaagctc ttggatgagg tcggcagctt tgttcaaaca ggcggacagt     26820
     acctgacatc tgaaaaacag attatcagga tgtttcaaaa gaaactgccg gaggagatct     26880
     ttgaatcgct ggaggacatc cggaaagcgc ctcttcctgt catggatgaa attgcggaag     26940
     gaatgggcaa aaacagaacc aacgcagcaa ccgttcaagg cgcgacaacc ggtgtgggcg     27000
     gcgtgtttac gctggcggca gacattccgg cagtgcttgg cttatcacta aaaacattac     27060
     aggatatcgc agtcgcatac ggctatgacc caaaggagaa aaaagaacga gtcttcattg     27120
     tgaaatgcct gcagcttacg tcggctgatg ttgtcggcaa aagatcgatt ttgcaggaat     27180
     taaaacacta cgatcaagac cgtacatata agaatgtcgc ttctcaaatc caaggctggc     27240
     gagaagtcgt tttgggctat cgagacacgt ttggctggaa aaaacttttc cagatagtgc     27300
     cggttgccgg aatggttttt ggcgccgctg ccaatcgctc aacattaaac gacattaccg     27360
     agacaggcat gatgctgtac aaaaagaggc gcattcttga acgactgaaa gaaacagaac     27420
     gagagatgga atagcagaaa gcagacggac accgcgatcc gcctgctttt tttagtggaa     27480
     acatacccaa tgtgttttgt ttgtttaaaa gaattgtgag cgggaataca acaaccaaca     27540
     ccaattaaag gaggaattca aaatggcaga caataacaaa atgagcagag aagaagcagg     27600
     tagaaaaggc ggagaaacaa caagcaagaa ccatgacaaa gaattctatc aagagattgg     27660
     tcaaaaaggc ggagaagcca ctagcaaaaa ccatgacaaa gaattctatc aggaaatcgg     27720
     cgaaaaaggc ggagaagcca ctagcaagaa ccatgacaaa gagttctatc aagaaatcgg     27780
     tgaaaaaggc ggagaagcca ctagcgaaaa tcatgacaaa gaattctatc aagaaatcgg     27840
     ccgaaaaggc ggagaggcaa caagcaaaaa tcatgataaa gaattctacc aagaaattgg     27900
     ctcaaaaggc ggaaacgccc gcaacaacga ctaatcaaaa gcataaaggc agacaacctg     27960
     taaataaaaa agcgatccgg cacatcagct ggatcgcttt tttttggaat cttctcaatt     28020
     tatgccgcta ttgagataca ataagtgaaa aaggggtttt cgctaatgtc caagatgcaa     28080
     aacttgctcg ccatcgcaaa tgaagtcaaa gaaaagcacg ccaatttttc aatctcagag     28140
     gtcaacgacc actgcgtgcg ccttgcggtg tttacgggag aatatgactg gcaccatcac     28200
     cctgactcag acgaattgtt tattgttctt gaaggggagc tgctgatcga ttttaaggac     28260
     aaagaaaccg cggtgctcaa agcaaatgac agcctgctga tccctaaagg cacggttcac     28320
     cgcacacgct cttacgtcag aacggtaaat ctctgtgtgg agcataaaca agccgaaacc     28380
     gtcatcatag aggagcagcc atgctaatca aaaagatgat atgtgaagta gatgctgcaa     28440
     acgctgaagc atttgcaaaa gcgcagtcac agtgggaagc gttatcgcat ataagcggct     28500
     ttatcaaaca ggccggcggc tggcgaaaaa cgatagacga gccgctcacc gcagaaatca     28560
     tcagtgtatg ggaaaacaga gaagcctatg atcattttat ggagaacgaa catgacagca     28620
     tatacgagga aaacgatcag aaggctgtaa ttctttcgat agaggtgacg gtgtacgaag     28680
     aggataaacc gttcgttcac gatctgttac ataaccccga tatccggtac gaaccaaact     28740
     ggacggttct gaaggcataa tcaaagccca aaacatcatg ttttgggctt gtctctttac     28800
     tcgcgtcccg gaagtgtatt atgaacaaaa ggcggtgctg gttttaactc cggtttttct     28860
     ccaaacgttt ttgcttcttt cacatattca aaggcttctc cgtccggcgc tttttcattc     28920
     agccagtttt gctcggcgct tacttcgcct tcagagaaat tgataagctg atgtgagaac     28980
     tcttgttttt cgagcgcttt cgggaatgta cccggcacaa ccggaccttc ctgtgcttct     29040
     aattctttaa tggcggcgag ccattggttc tggtgcatcg tgtcacgcgc cagcaggaag     29100
     ctgagcatat ctttgacgcc tttgtcatcc gtcatttcaa acaggcgtgc gacctgcaga     29160
     cggccctgag attccgcatt caggttggcg cggaagtctg ccagcaggtt tccgcttgct     29220
     acgatataac cgccgctcca aggtacgcct gtactgcttt ccggcatggc gccaagtcct     29280
     gatacaatcg catggtgagg gttcatgccg cctaggatgg agccgatgac cggatcttca     29340
     gcagcttttt cctgctgatc aagaggggca tcctcaagaa gtctggcaat catcgttgcg     29400
     atcatttcaa catgcccgag ctcctcagtt gccgtatcca tcagcaagtc cttgtatttt     29460
     tcatttcctc ttgtgttcca gccttgaaat aagtactgca tggcaactga aatttctccg     29520
     aattgcccgc ctaaaatttc ttgcattttt ttagcgaata atggatctgg acgatctggt     29580
     ttagcaggat gctgcagcat ttttgtgtgc ttaaacatgt acccatctcc tttttcgttt     29640
     atctcttttt atatttccga tcgatagaaa gataaacgaa aaacagcgtc agcgtatcga     29700
     gatgggaact atgaatcttt tcgcagctcc aacagttccc ggatcagctc ccggccaaag     29760
     atgggctcat actgccggta aacagggtca agacgcttca tccattcttg tttctcttta     29820
     tctgacagct cataaatatg tatagcagaa ttctttttga tttcttccag ctgctccttg     29880
     ttcatttgtt cggcatacgt ttcattccac tccgttgtct ccttcatcgc ttcagtcaaa     29940
     atgcgtcttg tttctggtgt ttgcgccttc cagaagtgtt catcagtcat gacagcgtag     30000
     ccgagataac cgtggctgct tattgtcaaa tagtcctgaa cattataaaa ttttttagaa     30060
     tagatgtttg aaattgtatt ttcttcgcca tcgactacat tgttttctaa cagctgaaag     30120
     gtagaattga aggattcctg atgaggtgtt gcgccaagca gcttgaactg atcctcaatc     30180
     acatcgcttt gcataatgcg cagatcctgc ccttttaagt catccggtgt tttgaccggc     30240
     ccttgatttg ttgtgatttg cttaaagccg ttcgtccaat aggccaatcc tttcaattgg     30300
     tttttcttta gagaatcaaa cagctgtgtg ccgatgcttc cgttcagccc ttttttgacg     30360
     gcgttgtaat ctgtaaatgc atacggcaga tccagcactc cccattcagg cgagagcatg     30420
     ccgagcttcg atgtggaggg ggcgataaat tgaacatcgc cgttttgcaa tgcttcaatt     30480
     tcttcaatgt ccgagtacag gcttccattc ggaaatactt ctatttttat ttttccgcct     30540
     gatttttcgt tcaccagatc agcgaattta ttggcggcca gcccttttgg cgtattttca     30600
     gcaaccacgt ggctgaattt aaacacgatt tgatcctgca ggccttcctg gtcgtcatca     30660
     taaacaatct ttttattgcc ggtatgatca tggaatccga taaataaagc ggttgcaatt     30720
     ccagcgatca tcagtgcgag acatgcaagc aaactcttca tgaaaagccc tcccctatgt     30780
     taaggataat gggggctatg acattcgtaa agacctgaaa ggagaagctg atgaacaaaa     30840
     agaagctctc aatccgttgg aaaatcacga tcttatccta tatactcgtc attttctcct     30900
     ttttgatcgg cggcattgtg ctcatcggca acattcagca tacagaggag cgggagctga     30960
     aaaagcggct gatgaatacg gcccggacgg tgtcagagat gacagaagtg aaagaagcct     31020
     tggcgcgaaa aaaacaaaca gaagcggttc gccatgcggt tgaagaaatc aggatgatta     31080
     atgaagcaga ctatattgtc gtcatggata tgaatcacat ccgatatacg catcctgtca     31140
     gcacaagcat tggcaagaaa tcagaaggtg cagacgagga ggcagctttt gcggagcaca     31200
     tttatttctc tgaagcaaag ggcgagatcg gcacggcggt tcgcgctttt tatccggtaa     31260
     aggatcaaga cctgaaccaa ataggcgtgg tgcttgtcgg aaaaacgctg ccggggatcg     31320
     ctgacatcct gcttcattta aagcgtgata tcgccttcat cgttgtgctg acactcggct     31380
     ttggccttgc tggttccttt ttgctggccc gccatatcaa aaaacaaatg tttcagcttg     31440
     aaccccatga gattgtccga atgtatgaag aacggacagc gacgtttcac tcgatgaatg     31500
     aaggggtgat cgctattgac aatcgtctcg tcattacgat cttcaatgaa aaagcgaaac     31560
     agatctttga agtgcagggg gatctaatcg gcaaggtgat ttgggaggtt ctcaaggatt     31620
     cgcgcctgcc cgaaatcgtg gagcggaaca aagcggttta taatgaagaa attcgtgtca     31680
     gcggtaaggt gatcatgagc agcagaattc cgatcgtcat gaagaaaaaa gtgatcggcg     31740
     ccgttgcgat ttttcaggac agaacggaag cggccaagat ggcagaggaa ttgactggtg     31800
     tcagaaactt tgtggaggcg ctccgtgtcc aaaaccatga gcatatgaat aagctgcaca     31860
     cgatcgccgg tctcatccag ctggggaaat ctgaaaaagc cttgcagctt gcattccagg     31920
     cgtcaactga gcaggaaaat gtgactgaat ttctgcaccg ctcgattcaa aatgacgctg     31980
     cggcaggcct tctattaagt aaaatcagaa ggggaagaga gctcggcatt gctgttcata     32040
     tagatgaaaa cagcagtctt cagcaatttc ccgagcatgt tgatcagcat gatattgtcg     32100
     tgcttttggg gaatctgatt gaaaatgcct tcggctcatt tgaaaccgtt caatctgaag     32160
     acaaacgaat tgacattagt atcgaacaaa cagatgatat ccttgctatt ttaatagaag     32220
     ataacggctg cggaattgaa ccgacacata tgcctcgcct ttatgacaaa ggttttacgg     32280
     tcaataaaac tggcggcaca ggctatggcc tgtatctagt gaaacaaatc atagacaaag     32340
     gatcgggcac gatagaagtt gattcacatg cggggcaggg gacatctttt tctatcgttt     32400
     ttccaatgaa gggggaggaa gcacagcatg gctcgtaaag aatggaaggt tctgctcatt     32460
     gaagacgatc cgatggttca agaggtcaat aaggatttca ttacaactgt taaaggcgtt     32520
     actgtctgtg caacggcagg aaacggagag gaaggcatga agctgattaa agaagaacag     32580
     ccagatctcg tcattctcga tgtgtacatg ccgaaaaaag acggcatcaa gaccttgcag     32640
     gagatcagaa agcaaaagct tgaagtggat gtcattgtcg tctccgctgc aaaagacaag     32700
     gaaacgatct cactcatgct gcaaaacggg gcggttgact atatcttaaa gccgtttaag     32760
     cttgagcgaa tgagacaggc actcgaaaag tacaagcaat ataaacaaaa aatcgaagcg     32820
     aatgatacgc tgtcccagga acagctcgat gcgatcctga atattccgca gcaggccgta     32880
     caggatctgc cgaaagggtt gaatcacttc acgatgaatg aagtcactgc ttttttgaaa     32940
     cagcaaaccg catccctttc tgctgaagag gttgccaagg cgctcggcat cgccagagtg     33000
     acagccagac gatatcttga ttacttagaa aaaaccggga tcatcaaatt ggacgttcaa     33060
     tacggcggag tcggccggcc ggtcaaccgc tacgtgttaa aaggataaac ctgagaccaa     33120
     aaagaccaaa atgtccgtta tgatcataaa cttccccaga ctgtatgaaa acgctatcat     33180
     tctagtaaga aagacacaaa aggcgaatag gacaggggga tgaaggatat gaaactgttt     33240
     aaaaatttaa cagttcaggt cataaccgcg gtcatcatcg gggtcattgt cgggctggtc     33300
     tggccggatg tcggcaaaga aatgaaaccg cttggtgata catttatcaa cgctgttaaa     33360
     atggtgatcg caccaatcat tttcttcaca atcgttctcg ggattgcaaa aatgggcgat     33420
     atgaagaagg ttggaaaagt agggggaaaa gcgtttatct atttcgaggt tgtcaccacc     33480
     ctcgcactca ttatcggttt atttgtcgtc aatattatga agccgggtgc gggtcttgat     33540
     tacagcaagc ttgaaaaagg agatgtatca caatacacgc aaaatggcgg tcagggaatc     33600
     gactggattg aatttattac acacattgtt ccgtccaaca tggttgatgc cttcgcaaaa     33660
     ggggacattt tgcaggtctt attcttttct attcttttcg gagtgggtct tgcggcatta     33720
     ggcgaaaaag gaaaaagcgt cattgatttc ttcgacaagg tttctcacgt ttttttcaaa     33780
     attatcggct acattatgcg tgccgcgcca atcggggcat tcggggcgat ggcgtataca     33840
     atcggacact tcgggctcga ttccatcaaa ccgctggcaa gcttaatgat gtctgtttat     33900
     attacgatgt tcctgttcgt atttgttgct ttaaatatca tctgcaagct ttacggattc     33960
     agcctgtgga attaccttcg cttcattaag gatgagcttt tgatcgtgct tggcacaagc     34020
     tcttccgaat cggtgcttcc gcgtatgatg gataaaatgg agcgctacgg ctgttccaaa     34080
     tccgttgtcg ggcttgttat tccgacgggc tattcgttta acctcgacgg cacatccatc     34140
     tatttatcaa tggcgactgt ctttttggca caggtgtttg gagtagacct cagcatcggc     34200
     cagcaaatta cgattatcct cgttctgatg ctgacatcga agggagcggc aggtgtgacg     34260
     ggaagcggat ttatcgtcct tgcctcaacg ctgtcagcgc tgcaggtcat tccgctggag     34320
     gggcttgcac tcctgctcgg ggtcgaccgt ttcatgagtg aaggaagagc cattgtgaac     34380
     ctgatcggaa acggaatcgc cacgatcatt gttgccaaaa gcgaaaatga atttgatgaa     34440
     gcaaaaagca tagaggctgt tgaaggcatg aaaaaaatga aaacagcagt ctgaaaaaag     34500
     aacggcccat ccatgggccg tttttttaat tgtttaagaa ttattaaggt aaggacagag     34560
     acctcagcat ttttttgtta tataatttac aaatggatac tatattgaat gaaggacgtt     34620
     tgtcctaaca ggagtgtata aatggccgct ttagttaaat tttttcagca cccgggagta     34680
     aggcgtttct ccatctttgt cgtgttaact ggtgtgttat atctatttaa gagcatgatc     34740
     aacttaatat tgcttacctt cattttcaca tttctaatgg atcgtttgga gcttgtcgtg     34800
     cggcagtttg taagccagtt cttccgcgtg agccagcggg ttgtcattac gtttctttac     34860
     atgttgctgg ctgtgctgct tacagtcggg ggctttgtgt tttatccggt cgtcgcggcg     34920
     cagatccagc agctggtaaa gcagattaaa catattgcgt atcatcctga cagcatccct     34980
     ttctttgatg agatcaccag tgtcttcgga gatattaaca tcagttcata tgtcaaagag     35040
     ggcttcaatg tagtgtatac gtatctggcc gatatcagca cattcggctt gcaggtcgtg     35100
     atggcgctca ttcttagcat gtttttctta tttgagaaaa aacggctttc tgaattcatg     35160
     gcgaaattta aaacgagcaa acttagggtc ttttatgagg agattgcttt tttcggaagc     35220
     aaatttgcaa gaacgttcgg caaggtgctc gaggctcaat ttatcattgc gctcgtcaac     35280
     tgtattctga cgtttatcgc gctttggatt atgcattttc cgcagctgtt tgggctttcg     35340
     attatggtgt tcttccttgg attgatccct gtagcaggcg tcgtcatttc cctgattccg     35400
     ctcagcatta tcgcctacag cactggcggt ggaatgtatg tgctctacat tgtccttgtc     35460
     atattcgcca ttcatgcgat cgaaacctat ttcttaaatc cgaagctgat gtcggcgaaa     35520
     acagagctgc caatcttttt caccttcaca gtactcattt tctctgaaca cttcttcggc     35580
     atttggggtt taattatcgg gattccgatc tttgtgtttc tccttgatat tctggatgtc     35640
     accaacaagg aagataggtc taaaggaccc cgagagaata gcgataaaaa gtagtttaaa     35700
     atcgaataat gagtgtgcct cgatctgccg gcctgcctgt tcagggcatg gaattaagac     35760
     tcggaatcgg agcttggcat tgccttgcac agtggtgaac acaacaggtg acaatgcttg     35820
     tcatcagtac ggaaactgaa aagaacaaac agtcggagca aacgctcatc atcggtttaa     35880
     ccaaacattt ggaagcaaca aatgctataa tacaaacagt gcctaatgtt gggcactgtt     35940
     tattttttgt cgaaaaagga ggaaggcttt atggctgagc cgattttaca tattgaaggc     36000
     ctcgataaaa aaattgggtc taaacagatt ttaaaacaga tcagcatgga cgtcatggag     36060
     ggtgaaatca tcggccttct cggtccgaat ggttccggaa aaacaacact catccgtatc     36120
     atcgtcgggc tgttgaaaca aaacagcgga agcgtgacaa tcagcggatt ccagcatgat     36180
     acagagtttg aaaaagcgat ggaagcggtt ggagcgattg ttgagaaccc tgagttctat     36240
     ccgtacctga caggctggga aaacctcaag cactttgcga atatgcacaa aaaaatagcg     36300
     gatgaacggc ttgatgaagt ggtggaacgt gtcgggctga cgtcagcgat tcatgataag     36360
     gtgaaaacct attcccttgg gatgcgccag cgtctgggaa tcgcccaggc aattcttcac     36420
     cggccgaagc ttctcattct agatgaaccg acaaacggcc tcgatcctgc ggggatgaag     36480
     gattttcggg atcatattaa ggaactcgca gaaatggaag gaacagctgt cctgttcgcc     36540
     actcatttat tgcgcgaggt tgaagacttg tgcgaccgtg tcatcatcat tcaaaaaggt     36600
     gagatcaaag cggaagtcag cttacaagga accgatcaaa ccacagaaaa agcgattata     36660
     gaagtgcagc cgcaagaaaa agcgctcaat tggctgacag gcaatcaata tcaagctgag     36720
     agccaagacg ggacgattgt agttgaggtg gcaaaagaaa acataccgga gctgaaccga     36780
     tcacttgtcg gacaagatct gaatgtattt tccattacgc cttacacgca gtcactggaa     36840
     gacgaattta taaaagcgac aacagctcat caagaggagg gagaagagct tgtctaaatt     36900
     aatttggaat gaacatatga aactttttaa tcggaaggtc actttggttt ctcttatcct     36960
     gatggctgtc tttcaattct tcatggcatt gatcattaaa cggattgtca tcagtgccgg     37020
     aacagatgaa aacttcatcg gctatttatc gtatacaccg agcctgaaca ttttgctgca     37080
     ggctttaacg atcgtaattg cagcaacaat tgtttcgatg gaatttgata aaaagacgat     37140
     caaatttttg ctcattcgtc cggttaaacg ccaaaaggtc ttttggtcaa aattaatcac     37200
     agtcgtgatg gtcagcttct atttgtattt ggcatactac attctggcat tattattcgg     37260
     tctcttgttt tttggcacat cggtgactgc ggaatcaaag acattgctgg tcaacacctt     37320
     ggcgctgatc gggtcaaact ggcttgaagc tgtaatgatg ggattattcg ggctgctttg     37380
     ttcttcgctg ttccgcaata gcgcggtagc agttgttgtt tcttttgtcg ttttatacgg     37440
     agcgagtaca cttgttcagc tcatgaagtt gtttgaaaac aagtggggca gctttttgct     37500
     ttttgcgaac actgacttta cgcaatacag aagcggagag acagcgttgt tttcaggcat     37560
     gacgccattg ttttcaattg gaattctcat catacatgcc atattcttca tcgttgttgg     37620
     ctggtggtgc ttctgtaaac gggatgttcg ggtctaaagg caaggaatga catttttgtg     37680
     aaaaagctca cgtaaatcaa tatcatttga tattttggtt tatactaaag gtactgacgg     37740
     aggtgtctcg attgaggaac tttattaccg ctttaccgat cgtattgctg cttggattct     37800
     catttgtgtc attcatgttt cagtttgaac atcttgttta tttcaggctc gcgcttgggt     37860
     tgttttctct cgtgggactg tacatgatat ataaaatgaa gacgggcatc cgctatttta     37920
     tcatctatct gtatgccagc tggattgtgt tggccgcagt gaccgctttt gaagagccga     37980
     ttttctcaag ctttttcttt ggcggcctgg tgatgacgat gggttacctg acatatatgc     38040
     tgatttatct cggcatgaaa caagaccggg atgcaaatcc tgtgtaatcg cgctgttccc     38100
     ttggggaacg gcgtgttttt ctatactggg caaaaggtta acagttgcgg aaaaatggca     38160
     ggaaatctat aatacatatt aaatttatcg gaattaaaac tggggggctg ccggatgtca     38220
     ttatttatac aaaacgatca acagcggcaa tggatggaga aaatcggacg gattgcggat     38280
     gaatttcagc aaacagctgc tgaagatgac gaacagggac gttttcctgc agagaaaata     38340
     caaaaactgc gtgatgctgg gtatacagca ttaacattgc cggcatctca tggcggaggg     38400
     ggcatttctg tttacgatat gctcttgttt caagaacggc ttgcacgggg agatgctccg     38460
     acggctctta gcatcggctg gcatttgagc gtgatcgggg agcttggaga aggcaacagc     38520
     tgggatgaag acgtatttgc atttgttgcc aaggaagtcc aaaacggagc cgtcattaac     38580
     agggcggcga ctgaagcgaa aaccggaagc ccgacaagag gagggcgtcc cggtacacac     38640
     gccgtcaaaa aggatggcaa atgggcagtg aacgggagaa aaacctttac gacgatgtca     38700
     caagctctgg attatttttt agtaaccgca tggattgagg acaaacaaac aacaggcgtg     38760
     tttctcattc ataaagatga tcccggcttg tcgattgaag aaacgtggga tatgatggcg     38820
     atgcgggcga ctgggagcca tgaccttgta ctgaacgaag taatgcttga tgagaataag     38880
     ctggtggaac tgcttcaagg gcctcgtgga gctaagccga atggctggct gcttcacatt     38940
     cctgcgattt atcttggtgt ggctcaagct gctcgtgact atgcagtgca atttgcatct     39000
     gagtattctc caaacagctt gaatggaccg atcaagaatg tcccggccgt acagcaaaga     39060
     acaggcgaaa tggagcttga actgctcaat gccagacact ttcttttcca tatcgctcaa     39120
     ttgtatgacg atccggtgcg gcgtccacac ttgaccagcg agctcggtgc ggcgaaacat     39180
     atcgtcacaa acgctgcgct gtctgttgtt gataaagcga tgagaattgt cggggccaaa     39240
     agcctggaac gaaccaaccc gcttcagcgc tattaccgtg atgtgcgcgc cggtcttcac     39300
     aacccgccga tggatgacgc cgtgatacac aagctggcag ctgaagcgtt tgagtcataa     39360
     aaaaaagagc cttaccggct ctttttatgt attgttttgc tcttgcagat ttttttgatg     39420
     cttgcggtcg atcctgtcat aaataacgtt catcagcttt ggattgccca taatcgcctc     39480
     tttgttttcc tggatcagct gttggtaagt tttcacttta cgcttcggca tgctccggcg     39540
     ccctcctgac atgtttgtat tcactttcta actccgtcag cgacaattca tacagatgac     39600
     gctttgactt tttgtatata ccattctgta ttaacagatg aatgagctgt ttttttctga     39660
     tttctgcaga ctgaggtgtc attgtgtcac caacctccaa tcaaacgata ttgataatca     39720
     ttatcaatta acttcagtat acaatgtccg caatagcctg taaagatgaa aagagtccta     39780
     ttcttggcca atttacaaac attcaacaaa tcgacaaaaa gtttcccggg caataatttg     39840
     ctgtcgaaat attccgcttc attgaacgca ccctgctatt tttcatgttt tgaaccatac     39900
     tatgtaatag aatggaggct ggtattcaat ggagcggaca gaaaatctga aaaagggaga     39960
     aaaaggggcg ctcctcaata tttttgcata tgtcatcctt gctgttgtaa agctagttat     40020
     cgggattcta tatcattctg aagcgctgag agcagacggg ttaaataatg gaacagatat     40080
     tgttgcgtca gtagcagtgc tgataggatt gcggatttct caaagaccgg ctgacagcga     40140
     tcatccatac ggccattatc gggctgaaac aatttcgtct cttgttgcgt cttttattat     40200
     gatggcagtc ggcattgaag tgttaatcgg cggaggaaaa gcgattgcgg gcggcacaac     40260
     ggaaacgcca aatcttatcg cggcatggac ggcgttaggc agtgctgtgt ttatgtatgg     40320
     catctattta tataacaaaa ggctggcagc gtccattaaa agctctgccc tgatggcagc     40380
     ggcaaaggac agcaggtcag acgcttttgt aagtgccggc gcgtttatcg gtgttttttc     40440
     gtcccagctg aagctgccgt gggttgatcc ggtaacggct tttatcatcg gcatcatcat     40500
     ttgcaaaact gcgtgggata tctttaaaga cgcttcacat tccttaacag acggcttcca     40560
     tttaaaagat cttgagcctt acaaacagac cgtcggcagg atcgaaaatg tgcatcgcct     40620
     aaaggatgtg aaagcgaggt atttaggcag tacagttcat atcgagatgg tgattacggt     40680
     tgatccgaag cttacagtag aagaaggcca tggagtggcg gatgaagtag aagacaaaat     40740
     aaaacatgaa cacgatgtca ctcatgttca tgttcatgta gagcctgacg acataaaata     40800
     aggctgttta acgaattagc ttatatgttc agataaaaat tcagtcactt cttcaggcgt     40860
     tttggcattg gcgctgtgaa ggtgagctgt tttttcaccg ttcttgaaaa taagcaggct     40920
     gggaatgccc attacttggt atttttcagc caggtcagga agctcgtcct tattcagctc     40980
     ataccagtcg ttttggttgt attcttccaa aatatcgccg atgaacatat tcatgcgtgt     41040
     gcagtctggg caccaatcag cataaaactt tacaatgatt tctttatcag attgaatcag     41100
     ttcattaaat tgttcgtttg ttgtgatttt tttcatatgt cacatctcct tttcaatgcc     41160
     attttaatat aaaataaaaa ggaattacat acaaatgcat tcaacatcag catgcccaaa     41220
     aataattaga tcattttccg gtgaaaatga taagatagta aagatgaatt gtagtggggg     41280
     gagtatccat tgaaaacaag tctaggatta gtgtacggag gaaagtcggc agaacataat     41340
     gtttccctgc agacagctct ggctgtaatc aaagcgctaa atactgagaa gtttgatata     41400
     catccgattt atataacaga aaaaggcgaa tgggttagag gcgcccgttt aactgaacct     41460
     gtttcaaacg tgaaaatgct tcaatttgag caaggaggca gtgctttttc tccagctgcc     41520
     ctgaaccagg agatgtttcc gcaggaagcg tcacagcaaa atgaagccat cgacgtcgta     41580
     ttcccgctcc tccacggacc gaacggagaa gacggtacga tccagggaat gctcgagctg     41640
     ttgaacattc cttatgtcgg caacggagtg cttgcttcct cagctggcat ggataaagtt     41700
     gtcatgaaac atttatttgc gcaggttggc cttgctcagg ctaaatacgc agctttcctt     41760
     aagaaagact ggactcgttc tccgaaagaa agctgtgagg aggttgaaca ggaattaggc     41820
     tacccttgct tcgtaaaacc ggcgaacctc ggctcaagtg tcggaatcag caaatgccga     41880
     aaccgtgaag aactgcaaaa agcgtttgag cttgctttcc aatatgaccg caaagtcgtc     41940
     gttgaagaag gaattaacgg ccgcgagatc gaaatcggcg ttcttggaaa tgatgatcct     42000
     aaatgctctg ttgtgggaga aatcgcaccg aagacagatt tctacgatta caaagcgaaa     42060
     tatgaggatg gagatactga tctgatgatt ccggcgattg tgactgatga ggaatacgca     42120
     acaatcagtg atatggcgat caaagcgttt aaagcgatcg acggttcagg actcgtcaga     42180
     gcggactttt tcctgacagc tgacggcgaa gttctgatca atgaagtcaa cacaatgcct     42240
     ggctttacac ctttcagcat gttcccgttg ctctggaaag aagccggagt ggaatatgct     42300
     gacctgattg aacagcttgt ggagcttgca aaagaacgcc acgctgaaaa acaattgatt     42360
     aagcatacat tctaatgaag aaggacactg ccggtaaaag ggcagtgttt tttcccgtat     42420
     atacaaaaga aagagaggga ccttacttga ttaagcgaac agtaaaaaac attgccgaaa     42480
     tggttaaagg cacactagca aatccgcaat atgaacaaac agtcattcat ggagtggcaa     42540
     ccgatacaag aaaactggaa caacatcagc tctttattcc gctgaaaggg gaacgttttg     42600
     acggccactc ttttgtggag caggcctttg aagctggtgt agcggctgtt ctttgggatc     42660
     ggtcagtacc aaatccgccc gagaatcacg ccgtcatttt agtggacgat acccttactg     42720
     cacttcagca gcttgcaaaa gcttatttgc aggagcttgg cacgcgtgtc atcggagtaa     42780
     ccggaagcaa tggcaaaacg acaacaaaag atatgattca cgccgtattg gggacccagt     42840
     accgtgtcca caaaactgga ggaaacttca ataatcatat cggtttgccg ctgacggttt     42900
     tagcgatgcc tgaaaatacg gagatcgccg tattggagat gggaatgagc gccaaaggag     42960
     aaattgacct cttgagccga ctggcaaacc cggatgcggc agtgattacg aatatcggcg     43020
     aatcgcatat gcaagacctc ggctctagag agggcatcgc ggaggcgaag cttgaaatca     43080
     taaacgggct taaagaagac ggagtgctga tttatatcgg ggacgaaccg cttcttcaaa     43140
     atgcatacag ctgccagacg aaaacgtacg gtacgggaac gcataatgat tatcagcttc     43200
     aggatgtcag ccagagtgag gaaggaaccc attttacaat caaagggata gaaaacacgt     43260
     tttttattcc aatactcggc aagcacaatg tgatgaacgc catggctgca attgctgcag     43320
     gggcttattt tggcatcgcg cctgaggatg cggcaaaagg actgagcggc ctaaaggtaa     43380
     ccgggatgag gcttgaactc atcaaaacag acagcggcct ttcgataatc aatgacgctt     43440
     ataatgcgag cccgacttcc atgaaagctg caattcaatt gacagaaagc cttgaaggct     43500
     acggcaaaaa aatgctcgtg ctcggtgata tgcttgaact cggcgatctt gaagaaacgt     43560
     tccataaaga gtgcggcgct gtgatcagcc ctgataaaat tgaccgcgtc tttacgtacg     43620
     gaaaactggg agcttttatc gcggaaggcg ccctgaaaca ctttgagaaa gaccgcgtca     43680
     gccattacac tgagaaaaaa gatctccttc aagctgtgaa ggaaaacgca tcaaaaggcg     43740
     atttgatttt attcaaagcg tccagaggta tgaagcttga agaaatcgtt aaagatttaa     43800
     tagagagccc gctttcataa gaaaatattt tgcgaaaaaa cgcatattgc atcataaaat     43860
     aacctgatat gcaaacacta atgtatgccg gccgaaaatt atgtatatct ggccggctgc     43920
     ggctatgata caatatatat aggttatttc gcgatacgaa catattcgtc cggacttttc     43980
     atcgtgaccc gaagttctcc gctggattct tgggagcgga tggagcagca gccggcatat     44040
     tcgagatgcc gatctgcttc tcatcttatt gaaaaacaaa tagtgtaatg gtaagataaa     44100
     acttaaagta attcgggctt tgtatacgga tggatcctgt ccttcttgtc taaagggcag     44160
     ttttataagt ggtaaatcac gacattactg aaacagcaat tagaaggagt ttgaataatt     44220
     tgactataac gtttcaagat tttaatttaa gttctgatct catgaaagca attaatcgta     44280
     tgggatttga agaagcaaca ccgattcagg cacaaacgat accgctcgga ctttcaaata     44340
     aagacgtcat tggacaagcg caaacaggta caggtaaaac agctgcgttt ggtatacccc     44400
     ttgttgaaaa aattaacccc gagtctccta atattcaagc aatcgtaatc gcgccaaccc     44460
     gtgaattagc cattcaagta tctgaagaat tgtataaaat cggacaagat aaacgtgcga     44520
     aggttcttcc tatttacggc ggacaggata ttggacggca aatccgggcg ttaaagaaga     44580
     atccgaatat tattgtcgga acacctggac gtcttcttga ccacatcaac cgccgcacca     44640
     ttcgtttaaa caatgtaaat accgttgtaa tggatgaagc ggatgaaatg ctgaacatgg     44700
     gattcattga cgatattgaa tctatccttt caaacgtgcc aagcgagcat cagacacttc     44760
     tgttctctgc cacaatgcct gcgccgatca aacgcattgc agagcgcttc atgactgagc     44820
     cggaacacgt aaaagtaaaa gcgaaagaaa tgacggtttc taacattcag cagttctatt     44880
     tggaagtgca agaacgtaaa aaattcgata cactgactcg ccttcttgat attcagtctc     44940
     ctgagcttgc gatcgtattc ggacgtacaa aacgccgtgt cgatgagctg gctgaagctc     45000
     tgaaccttcg cggatatgca gctgaaggta ttcacggtga cttaacgcag gcgaaacgta     45060
     tggttgcgct tcgtaaattt aaagaaggcg caatcgaagt tctagtcgca actgatgttg     45120
     ccgctcgcgg acttgatatc tcaggtgtta cacacgtata caacttcgac gtgcctcaag     45180
     atcctgaaag ctacgttcac cgtatcggaa gaacgggccg tgcaggaaaa acaggtatgg     45240
     cgatgacgtt cattacaccg cgtgagaaaa gcatgcttcg cgcaattgaa caaacaacaa     45300
     aacgcaaaat ggaccgcatg aaggagccta cacttgatga agcgttagaa ggtcagcaac     45360
     aggttactgt tgaacgtctt cgcacaacaa tcagtgaaaa caacctgaac ttctacatga     45420
     cagcggcagc tgagctgctt gaagatcatg atgcagtaac agtggttgcg gcggctatca     45480
     aaatggctac aaaagagcca gacgacacac cggttcgctt aacagacgaa gcgccgatgg     45540
     tcagcaaacg ctacaagaac cagcgctctt ctaaacgcag agacggtcaa ggcggcggct     45600
     accgcggcgg aaaagggaaa agcaacaacc gttcttccta tgacaaaaag cgttcaaacg     45660
     atcgccgttc ttcaggtgac agacgccaga aaaaatctta ctaatttgat cgattcagag     45720
     cccaaaacat gatgttttgg gcttttttat gttcgtgatt tgttattcag caaactttca     45780
     gctgacggaa gccatttttc tctgtatgct taagaatgaa acctttctgt aaaagagacg     45840
     tataaataac gacgaaaaaa agggaggtag gtatttttga gagagcagcc aaaaaaccaa     45900
     atcagtccag acggattaaa ggtttggcga cttcaagaga tcatcatatc cgctgtttgc     45960
     ttgcttattg tcattgcagt tgcagtgtta agctattatt ttcattggcc gtactggatc     46020
     agcggcgtgc tcggcgctgt ttggctgctg ggatcgattg tgacggtctt tatcattccg     46080
     aaggtccgtc ataaggtgtg gcgatatgaa gtccatgaac atgaaataga tattcagtca     46140
     ggtatttttg tggtgacacg tgtgattgtt ccgatggtca gagttcagca cgtcgatacg     46200
     tcacaagggc cattattaaa aaaatacaac ctggcaacgg tgaaaatttc cacagccgcg     46260
     accgttcatt cgatccccgc tttagagatg gaggaagcgg atcggctaag agactccatt     46320
     tcccgtctgg cgagggtgac tgacgatgat gtctgaaccg aaacgcctgc acccggtggc     46380
     agtcattttg aatttatgcc ataccattat tcaaacgata aaaaatatca ttctgccatt     46440
     cttttttgtg tatattgtca attcaaacca tactgtccgt ttttacggag ccattgcgct     46500
     cggtgtgctg ttcatctggc ttgtagcggc aagcattatc aaatggagaa ggtttaccta     46560
     tcgaattgaa gatgatgaat ttagaattga agaaggctta tttgttacga aaaaacgata     46620
     catatcgatt gatcggattc aaacaatgaa tacgagcgcg ggccttgtcc agcaaatctt     46680
     taagcttgtg aagctgcaaa ttgaaacagc aggcggaggc aaggaggcag aagccgttct     46740
     ttctgctatt tctgttgaag aagcggaacg catcaaagaa gctgtcttta agaaaaaagc     46800
     gcaaagacga gaaaatgaac ttgatgaaga acggcttgaa gctgaagagg agttggatcc     46860
     gtccgttgag gtgcaagagc actatcgcat gaacgcgaaa gaattgctca tggccgcttc     46920
     tacctccggc ggaatcggag tcattatctc cgctgtattt gcacttattt cccagcttga     46980
     tgaagtgctg ccgatggatt ggttattcga taaattttcc ttccttcagc acgccagcat     47040
     cggtatttat gcggtactca tttttatcgg tttatttatc gcctggattt tcagcatcgc     47100
     gggcatgatg tttagatacg cgaactttca aatcataaaa aaagagcagg aactggtgat     47160
     ttcaagggga attattgaaa aacatcaagt cacgattccg ctgcgaaaaa tacaagccat     47220
     taaaatcaaa gaaaatatca ttcgccagct tttcggcttt gtaacggtgt ccatcgtcag     47280
     cgcaggaggc ggcgaccggg aaaaagaaga aggcgctttg accattctct ttccaatgat     47340
     tcataaaaaa aagcttccgc acatgctccg aacatttacg ccggaataca cgctggaaga     47400
     aaactgccgc cgcctgccgc ggcgcgcgtt gaaacgctat ttgttccgtt ctgtcatttt     47460
     ttcactcttt ttgatcatcc cgttatgtat cttctttcag ccatggggct atctgtcagt     47520
     gatcctgctg ccgatagaat tgctcttcgg ctatctcgcg tataaagagg ctgcatggac     47580
     gatcaacggg gaccgtcttc agctgacgtc tagatttata ggcagaacaa ccgccattgt     47640
     actgaaaaaa cgaatgcagg tctgcaagtt cagccaatcc tatttccaaa agaaaggccg     47700
     cttgtatacc atttctactt cggtgaaatc atcgagccat atggaagagt taacggtgag     47760
     ggacgtaggt gaagaggatg cagccttcat tttaaagtgg tactcatatg aaaaagcgga     47820
     cggttaatac cgccgctcca gcgtgtcggc aaaccctcgc attcgttgtc aggactgcgc     47880
     ttcggtgctc aatgcgaagt ggatcaacgg ctaaattctc aggcgtcctg cctaaacgcc     47940
     gtcgtcatca catcctgtga aagtccgctc ctatgctcgt ccttcctaga cttcatgggt     48000
     tttcaatcac gctgaaaaga tgacaaaatc ctaaaatgaa aaccatttta ggattttgtc     48060
     aacaatctga agcggcggtt aataccgccg ctcttttttt tgcacgcata aaaacgaaag     48120
     aagaaacccg ccgcatagtc caaacaaatg ggccatcatg ttaatattgg agttgataaa     48180
     cgacatgaga acggcaaatg cgagcagtgt gatgatcatt ttggaatgct cctgcccaat     48240
     taactcattg cgaaaaagaa ccataaacag gtatacgcca aatagcccga aaatggcgcc     48300
     tgaagccccg acatgcacgt aatcaagcgg ctctgtaaca taagtgccga tattgccgat     48360
     gatgccggag ccggcgtata caagaaggaa acgcgctttt cccagcatgc gttccaaagc     48420
     cggggcaaat aaaaagatgg acatggaatt aaacagcaga tgtgtgaaac cggcgtgcag     48480
     caaaatcggt gtgataagcc gccaccattc accgtttgcg acacctagat tatagcctgt     48540
     gacggtatcc ctccataaca cgactgaatg ggcaggaagt gaaaaaaaca gccagagaac     48600
     agcttgcaaa gccaatataa aggtgacaac ggggtaaagc ctgataaatg tttgaaaatt     48660
     ttcagtccgt ataaacattc cgagcccctt ttcttcattt tggtatatct atagtaacac     48720
     gtttatgaga caaaccattt aaatagtacg tacgcaaagg aggttatcat acatgattta     48780
     cggcattggg ctggacatta ccgagcttaa acggatcgcc tctatggctg ggcgccagaa     48840
     aaggtttgcc gagcggattt tgacgcgaag cgagcttgac caatactatg agctttcaga     48900
     gaaaagaaaa aacgaatttc tcgcgggcag attcgcggca aaagaagcgt tctcgaaagc     48960
     atttggcacc ggcattggga ggcagctcag ctttcaggac attgaaatta ggaaagacca     49020
     aaatggcaag ccctatatca tttgtacgaa actgagccag gccgccgttc acgtatcgat     49080
     cactcataca aaagaatacg ctgccgcgca ggttgtgatt gaaaggttgt caagctagtc     49140
     tgcatattag ggaaacccca ctcatatatt tgatagtgca ttaagggaga caagttgttt     49200
     gaggctttta tggtacgcat ctgttctgcc taaacgtgta ccgagcgtac cgttaaagtc     49260
     aaacaagcga tttcttcctt ttacatcaat tgagaaaaag gggttgaaaa aggtgagaaa     49320
     aagctttgtt ttgcttttaa cgggactgct tgctgttctt attctttctg cctgcgggca     49380
     aaaaacacag caagatattg tggccgggtt agatgaaaag gcgaaagaat acacctcgta     49440
     caaagcaaaa gcgaaaatga ccatcgagac agggagtgag cctcaagtat acaatgtgga     49500
     aatctggcac aaaaagccgt ctctgtacag ggtttattta gaaaatccga aaaaggacca     49560
     aaaccaagtc attttacgaa atgaaaacgg agtattcgtt ctcacgccgt ctttaaataa     49620
     gagcttcaga tttcaaagcg attggccgaa caacagcagc caggtttatc tgtttgaatc     49680
     gctcgtaaag gatgttcaaa acgattcgga tgcagttttc acagcgaaag aaaagaaata     49740
     cgtatttgaa acaaaaacaa actatcagca taacaaaatg ctgcccacgc aagaaatcac     49800
     atttaacaaa aaagatatga gcccgtcatc tgtcaaagtg atggatactg accggaaagt     49860
     gatggtcaaa gtagaattca gcagctttga atttaataaa caatttgata aagaatcatt     49920
     tgatgaaaag aaaaatatga ccctttctca aatggatgtc gccacaagcg caaagccttc     49980
     cgatacattt gcggtcaaaa cgccgctgga actgccgctt ggcgtcaagc tgcttgaaga     50040
     aaaagatata tctactgaag acgggaagcg catcatcatg acgtacggag gagaaaaatc     50100
     atttacgtta attcaggaaa aagcccagat tgccaaggct tcctcctccg ttacgctgaa     50160
     cggcgaaccg gtaaatctcg gctacaccat cggcgccctg tcggatgcat cattatcatg     50220
     gacatatgac ggcgtagatt accttctctc ttctaaagat ctttctaaag aggaaatggt     50280
     gacagtagcg aaaagcatgc agggacaatc atcgaaataa ccgccaaagg ccaaacatga     50340
     tttggccttt ttttcgttag acatcgtttc cctttagcct ttaattttag tatgatatgt     50400
     aaatgatatt gaataaaagc taggaagtgt cgtaatgagc acaaaacctt tttacagaga     50460
     tacgtgggcg gaaattgact tgtccgcgat aaaggaaaat gtcagcaata tgaaaaaaca     50520
     tatcggtgaa catgtccact tgatggcagt tgtgaaagca aacgcctacg ggcatggtga     50580
     tgcagaaaca gcaaaggctg ctcttgacgc aggtgcttca tgcttggccg tggccatttt     50640
     ggatgaagcg atttcactgc gcaaaaaggg attgaaggcg cctatattgg tgcttggcgc     50700
     ggttcccccg gagtatgtgg caatcgctgc tgagtatgac gtgaccttaa caggttattc     50760
     tgttgaatgg cttcaggagg cagcccgcca cacgaaaaaa ggttctcttc attttcatct     50820
     gaaggtcgat acggggatga acagacttgg tgtaaaaaca gaggaagaag ttcagaacgt     50880
     gatggcaatt cttgaccgca accctcgttt aaagtgcaaa ggggtattta cccattttgc     50940
     gacagcggat gaaaaagaaa gaggctattt cttaatgcag tttgagcgct ttaaagagct     51000
     gattgctccg ctgccgttaa agaatctaat ggtccactgc gcgaacagcg ccgctggact     51060
     ccggctgaaa aaaggctttt ttaatgcagt cagattcggc atcggcatgt atggccttcg     51120
     cccgtctgct gacatgtcgg acgagatacc gtttcagctg cgtccggcat ttaccctgca     51180
     ttcgacactg tcacatgtca aactgatcag aaaaggcgag agcgtcagct acggagccga     51240
     gtacacagcg gaaaaagaca catggatcgg gacggtgcct gtaggctatg cggacggctg     51300
     gctccgaaaa ttgaaaggga ccgacatcct tgtgaaggga aaacgcctga aaattgccgg     51360
     ccgaatttgc atggaccaat ttatggtgga gctggatcag gaatatccgc cgggcacaaa     51420
     agtcacatta ataggccggc agggggatga atatatttcc atggatgaga ttgcaggaag     51480
     gctcgaaacc attaactatg aggtggcctg tacaataagt tcccgtgttc cccgtatgtt     51540
     tttggaaaat gggagtataa tggaagtaag aaatccttta ttgcaggtaa atataagcaa     51600
     ttaacttacc taaatggaga attcataaaa cagctttgct tgaagagtga ataatggtat     51660
     cattatcact ggatggataa aagagtcgta tccgtaagtt tggtggaggt gtatgttttt     51720
     tgtctgaatc cagcgcaaga accgaaatga aaatcagctt gcccgaaaac ctagtagctg     51780
     aattggatgg tgtagcgatg cgggagaaac gaagcagaaa cgaactgata tcacaagcag     51840
     tgagagcgta tgtcagcgaa cgaacaactc gtcacaaccg tgatttgatg agacgcggct     51900
     atatggaaat ggcgaaaatc aacctgaata tttcttctga ggctcacttt gcggagtgcg     51960
     aggctgaaac gacagttgag cgcttagtca gcggaggata atcatttgat tgtgaaacgc     52020
     ggcgatgttt attttgctga tttatctcct gttgttggct cagagcaagg cggggtgcgc     52080
     ccggttttag tgatccaaaa tgacatcgga aatcgcttca gcccaactgc tattgttgca     52140
     gccataacag cacaaataca gaaagcgaaa ttaccaaccc acgtcgaaat cgatgcaaaa     52200
     cgctacggtt ttgaaagaga ttccgttatt ttgctggagc aaattcggac gattgacaag     52260
     caaaggttaa cggataagat tactcatctg gatgatgaaa tgatggataa ggttgatgaa     52320
     gccttacaaa tcagtttggc actcattgat ttttagacat atttgcaggt tgctcaaata     52380
     gagcaacttt ttttgttttc aaaaaacata aacgatataa tagtgaaata acgaaaaaat     52440
     atgttgtttt ttattgggag gtaagcgaat ttgatgtcga accagactgt ataccagttc     52500
     attgccgaaa atcaaaatga actgctccaa ctgtggactg acacactaaa agaattaagc     52560
     gagcaagaat cctatcagct gactgaccaa gtgtatgaaa atatatctaa agaatatatc     52620
     gacattctgc tgctgtctgt taaggacgaa aatgctgctg aaagccaaat cagcgaactg     52680
     gcgcttcgag cggtccaaat cggactgtct atgaagtttt tggctactgc acttgccgaa     52740
     ttctggaagc gtctctacac gaaaatgaat gataagagat tgccagatca agagagcacg     52800
     gaattaatct ggcagattga tcgctttttc agcccgatta acacagaaat ttttaatcaa     52860
     tactcaatct catgggaaaa aacagtatcc ctgcaaaaaa tcgcgctgca agagctgtct     52920
     gcgccgctta tcccggtgtt tgaaaatatc actgtgatgc ctcttgtcgg aacaattgat     52980
     accgaacgcg cgaaacgaat tatggaaaac cttcttaatg gcgtcgtcaa acaccgttcc     53040
     caagtcgtgc tgattgacat tacaggtgtc cctgtcgtcg atacgatggt tgcccatcat     53100
     attattcagg catcagaagc tgtaaggctt gtcggagcaa aatgcctgct ggccggaatc     53160
     cgtccggaaa ttgctcaaac aatcgtcaac ctggggattg atttatccca agttataact     53220
     aagaataccc tgcaaaaagg aattcaaaca gcattggaaa tgacggatcg aaaaatcgtt     53280
     tcattggggg aataacattt tgagacatcc gaaaatcccg atcttgaaac tgtataattg     53340
     cttattagtg tccattcagt gggaacttga tgaccagaca gcattaactt ttcaagaaga     53400
     cttattaaat aaaatatacg aaacaggtgc taacggagtc gtcattgacc tgacatctgt     53460
     ggatatgatt gattcattta tcgcgaaagt gctgggggac gtcattacaa tgtctaagtt     53520
     aatgggggct aaagtcgtct tgaccggcat tcagcccgct gtggcagtga cgctgattga     53580
     acttggaatc gcgcttgagg aaatcgaaac tgcgctcgac ttagagcagg ggcttgagac     53640
     attgaagcgg gaattggggg aatagcgaat gaacgaccaa tcctgtgtaa gaatcatgac     53700
     agaatgggat attgtggccg ccagacagct gggacgaaac gttgcgaaag aactgggttt     53760
     cggcacggta gaccaggcta gaattacaac ggctatttca gaattagcca ggaatattta     53820
     tttatatgcc ggcaaagggc agattggaat tgaacaggtc gcagacagag gaaaaaaagg     53880
     cctgaaaatc atagcggaag accaagggcc gggaattcct gatatccgaa aagtcatgga     53940
     agacgggttt tcaacgtctg gaggacttgg tgcgggactt cccggggtca aaaggctgat     54000
     ggatgaattc agcttaaatt ccgtagcggg ggaaggaaca gagatacaag ccatcaaatg     54060
     gcttcggtag gaggtaagaa cgtggatttt agggaggtta ttgagcagcg gtatcatcag     54120
     ctgcttagtc gatatatagc cgaattaaca gaaacatctt tatatcaagc ccaaaaattc     54180
     agccgaaaaa caatcgagca ccaaattcct ccggaagaaa tcatcagcat tcacagaaaa     54240
     gtgctgaagg agctgtatcc aagtctcccg gaagatgtgt ttcattcgct ggatttttta     54300
     atagaagtca tgattggcta tggaatggct tatcaggagc atcaaaccct tagagggata     54360
     cagcaggaaa tcaaatcaga aattgaaatc gcggcaaatg tccagcagac gcttctcgga     54420
     actaaagttc ctcaggagga agcgctggat atcggcgcca tcagtgttcc cgctaaacag     54480
     atgagcggtg attactacca ctttgtcaaa gacaaggaat ccatcaatat cgcaatcgcg     54540
     gacgtgatcg gaaaaggcat tccagcggct ttatgcatgt ccatgattaa atacgcaatg     54600
     gactctttgc cggaaacggg catacaccct tctcaagtgc tgaaaaattt gaatcgtgtt     54660
     gttgaacaaa acgttgatgc cagtatgttt attacgatgt tttatgcgaa ttacaatatg     54720
     gacaagcatc aatttacata tgcttcagcg ggacatgaac cgggattcta ttattctcaa     54780
     aaagacaaca cgttttacga tttagaggcc aaaggactcg ttctcggcat ctcgcaggac     54840
     tatgactaca aacaattcga tcagcatctg gaaaagggcg atatgattgt tttattttct     54900
     gacggcgtca cagaatgcag aacggaaaac ggtttcttgg agcgtcctga tctgcagaag     54960
     ctcattgagg aacatatgtg ttcctctgcg caggaaatgg tcaaaaacat ttatgacagc     55020
     ctcctcaaat tgcaggattt tcagcttcac gatgatttta cgttaattgt tttgcggaga     55080
     aaggtttaac gtctgtcaga cgagggtata aagcaactag tgatttgaag gaaaatttga     55140
     ggtgatacga atgaatataa atgttgatgt gaagcaaaac gagaatgata tacaagtaaa     55200
     cattgcagga gaaattgatg tatactcagc cccggtgctt agagagaagc tcgttcctct     55260
     ggcagaacaa ggagctgact taagaatttg cctgaaagat gtcagctaca tggacagtac     55320
     cggattgggc gtttttgtag ggacctttaa aatggtgaaa aaacaaggtg gttcgctgaa     55380
     acttgaaaat ctttctgaac ggctgatccg actgtttgac attacaggct tgaaggacat     55440
     cattgatatt tctgcaaagt cagaaggtgg agtgcaatga agaataatgc tgattacatc     55500
     gaaatgaaag tgccggccca acctgaatat gtgggaatta taagactgac gctgtcaggg     55560
     gtcgcaagca gaatgggcta tacgtacgat gaaattgaag acttgaaaat cgcagtcagt     55620
     gaggcgtgca caaatgcggt tcagcacgct tacaaagaag ataaaaatgg ggaagtgtca     55680
     atacgattcg gtgtgtttga agaccgttta gaggttattg tggcggatga aggagacagc     55740
     tttgactttg atcaaaagca gcaggatcta gggccgtaca caccttcgca cacagttgat     55800
     caattatcag aaggagggct cggtctatat ttaatggaaa cgctcatgga tgaagtcaga     55860
     gtgcaaaacc actccggcgt caccgtagcg atgacaaagt atttaaatgg ggagcgagtt     55920
     gatcatgaca caaccatcaa aaactacgaa actaactaaa gatgaagtcg atcggctcat     55980
     aagcgattac caaacaaagc aagatgaaca agcgcaggaa acgcttgtgc gggtgtatac     56040
     aaatctggtt gacatgcttg cgaaaaaata ctcaaaaggc aaaagcttcc acgaggatct     56100
     ccgccaggtc ggcatgatcg ggctgctagg cgcgattaag cgatacgatc ctgttgtcgg     56160
     caaatcgttt gaagcttttg caatcccgac aatcatcggt gaaattaaac gtttcctcag     56220
     agataaaaca tggagcgttc atgtgccgag acgaattaaa gaactcggtc caagaatcaa     56280
     aatggcggtt gatcagctga ccactgaaac acaaagatcg ccgaaagtcg aagagattgc     56340
     cgaattcctc gatgtttctg aagaagaggt tcttgaaacg atggaaatgg gcaaaagcta     56400
     tcaagcctta tccgttgacc acagcattga agcggattcg gacggaagca ctgtcacgat     56460
     tcttgatatc gtcggatcac aggaggacgg atatgagcgg gtcaaccagc aattgatgct     56520
     gcaaagcgtg cttcatgtcc tttcagaccg tgagaaacaa atcatagacc ttacgtatat     56580
     tcaaaacaaa agccaaaaag aaactgggga cattctcggt atatctcaaa tgcacgtctc     56640
     gcgcttgcaa cgcaaagctg tgaagaagct cagagaggcc ttgattgaag atccctcgat     56700
     ggagttaatg taatgatcca ggttgaagaa aacgagcata ttcaaactct agtatatcaa     56760
     ctgaataaag aagggaaatc gatttgcggt gacagttttt ttatgaaagc tgatgataag     56820
     gagttaattt gcgcggttgc tgacggactg ggaagtggat cacttgctaa cgaatcctct     56880
     gcagccatca aagacttagt ggaaaactat gcgagtgaag acgtagaaag cattatcgaa     56940
     cgctgtaatc aggcgatgaa aaacaaaaga ggcgctacag catctatcct gaaaatcaat     57000
     tttgagcaaa ggcagtttac gtactgctct gtcggaaatg tacggtttat tctgcattcc     57060
     ccgtctggtg aaagctttta tcctctgccg atttcgggct atttatcagg caagccgcaa     57120
     aaatacaaaa cgcacaccgc cacctatgaa aagggttcaa agttcattat acatacagat     57180
     ggactcaacg tacctgatat ccgctcccat ttgaaaaaag gccaatcggt agaagaaata     57240
     tcgaattcgc tgaaaatgta tacgacatcg agaaaagatg acctgaccta tattctcgga     57300
     cagctgtcct aaaaaaccag aaaaagaagc tggacatccg gcttcttttt tttgcggttg     57360
     actattaata agtgcgctta ttataattaa taagtgaact tatcattctg ggagcttatg     57420
     ggatgtggaa ttatgaatac acagcgatag ctgatgtgga tgtgggaaaa cctggaactg     57480
     ttatcaggaa acagaaacaa tggatcaatg ggagacgggt attgcatcag attctttgaa     57540
     aggacaattt caaaatggaa cggaaggaac attgcttctg caaggaaaaa caattctctt     57600
     atggcttgag catgtggaga aacatcgggc gttttctgtc atggtcaaca tgcccgcata     57660
     gcaatgtaat aatggagttt tttcacgtgc ttcaaaagca aaaagaagat ttgtgtatca     57720
     catatggaat tgtattagaa ggcgctgaag caaaaaagtg gggagaaatc attgggactg     57780
     aactgtctaa agacatgccg acggctgtca gcaggcttgt ccatctttac ggaggagtga     57840
     taaaatgaac acaaattact ggatcggcgt tgtgtcagag caacatgtat taaaaggcgc     57900
     tgccggcggt tttgcacagc tgtgccatgg aaaaaaagcc ccgctcgcca aaatgaaaga     57960
     gggagattgg ctgatttatt attctccgag agacgcatat ccagacggca aactgctgcg     58020
     aagctttact gcgatcggca aagtaaaaag cggaaacatc tatccgtatc aaatggctcc     58080
     gaattttatt ccataccgat tagatataga ctattatcca tgccataaaa tcggttttta     58140
     cgacattaaa tcaaagcttg aatttgttca ggaaaccaag catcttggct ttttatttcg     58200
     cagaggacac tttgaaataa gcaaaaaaga ttttttgaca atagcacaag cgatgggagt     58260
     taacataagt ggaatggcac tctaaattta gcggtccgaa cacaagcccg ggctttttat     58320
     tatggcaggc cacgcaaagt tggcagcgga aagtaggaaa agcattggct gagtttgacc     58380
     tgacccacgt tcaatttgtt ctgctgacct cgtgcaagta tatgattgct cacggagaaa     58440
     ccgtcacgca aaaaaaactt gcaagcttca gccagaccaa tatcatgatg gtttcggagg     58500
     ttgtgcggac gcttgagaaa aaaggattta tcgaaagaag caaaaatccc caggataaaa     58560
     gagaggtcct cctgtctctt acagaaatag gaggagaaaa agtaacagcg gctttgccaa     58620
     ttgttgagaa gattgatcaa gccttctttg cagctgcgat gaaaaaagag aattttctga     58680
     gcggcttaca ggaactattg aaacatgagt aaagatacgg gcagcgccag ctgtcttttt     58740
     ttatgtgttt ttttcggttt ttgatacact agagaaagaa cgacaaaatt ggaggctttg     58800
     gttacatgga aacgtcagcc cttttaaaac agcaaattgc gaaagaaata ggtttatcac     58860
     aaaaacacgt tgaaagtgtc atccgcctgc ttgaggacgg caatacagtc ccgtttattg     58920
     cccggtatcg aaaagagcag acgggttcaa tggatgaggt tcagattcag acgatttctg     58980
     aacgctggca atacatacaa aacctgaatc agcgaaaaga agaagtcatc aggctgattg     59040
     cagagcagga taaactgaca gataatctaa aacgtaaaat cgagcaatcg gtgaagcttc     59100
     aggaagtgga agacctttac cgcccttata aacaaaaacg taaaacaaag gcgacagtcg     59160
     ccaaaagcaa aggccttgag ccgcttgccg actatatcct gacacttccc caagatgatc     59220
     atctggcagc aactgcagac caatacatca gcgaagaaaa agaagtgttc acacgagaag     59280
     aagcgattga aggcgccaag cacattattg cggaacaaat ctcagacgag ccgaccttca     59340
     gaaagtggat tcgccaggaa accttcaaaa gaggaaccat taagtctgca gccggaaagt     59400
     cggcagacac cgatgagaaa aatgtgtatg aaatgtatta cgagtatgaa gagccaattg     59460
     caaaagttgt tccgcatagg gtgctggcaa tgaaccgcgg cgaaaaagaa gacattttaa     59520
     aggtagcgat cgaaccgcct gcggatcaca ttaaggcgta tttagaaaaa caaatcatca     59580
     aaaatcgctc aacatccgta agagagattt tgcaggagac aattgaagac agctataaaa     59640
     ggctgatcca gccggcaatc gagcgtgaaa tcaggaaaga gctctcagaa aaagctgatg     59700
     aacaggcgat tcatattttc tcagagaact tgagaaagct tcttttgcag ccgccgatga     59760
     aaggcaaaac cgttctcggt gttgacccag cctttcgaac tggctgtaag ctcgctgtgt     59820
     cagatgagac cggaaaagtc ttgaaaattg atgtgatcta tccgcatgcg ccagtcaaca     59880
     aaacaaaaga agcccatgaa aaagtgaaaa agattcttga gcagtatcaa gtcgagatgg     59940
     tggcgatcgg aaacggcaca gcatccagag aaacagagca attcatcgtc aatgtactca     60000
     gagacatgcc gcgcaaaatt tattatgtga tctatccgca tgcgccagtc aacaaaacaa     60060
     aagaagccca tgaaaaagtg aaaaagattc ttgagcagta tcaagtcgag atggtggcga     60120
     tcggaaacgg cacagcatcc agagaaacag agcaattcat cgtcaatgta ctcagagaca     60180
     tgccgcgcaa aatttattat gtgatcgtca atgaagcggg agcaagcgtc tattcggctt     60240
     cagagcttgc cagagaagaa ttccctgacc ttaaggttga agagcgcagt gccgtatcta     60300
     ttgctcggag acttcaagac ccgctcgcgg agctcgttaa gatcgatccg aagtctgttg     60360
     gtgtcggaca gtatcagcat gacgtcagcc aaaaacgctt aaatgaatct ctgcggtttg     60420
     tcgtcgaaac tgtcgtaaac caggttggag taaacgtcaa cacagcctcc gccgcgctgc     60480
     ttcaatatgt agctggatta tcgaagtctg tagcaggcaa cgttgtcaaa aaacgtgagg     60540
     aaatcggaaa gttttcaaat cgaaaagaac tgaaggacat cccaaggtta ggtgcgaaaa     60600
     cctatgagca atgtatcggt ttcttaagag tgcaggaagg gacagagcct ttggatagaa     60660
     caggcatcca cccggaaagc tataaagaaa caaaagcact tttgaaaaaa ctcggacttt     60720
     caacagaaca tatcggcacg gcggaattga aggacaaaat caatcagtgg cgctctctga     60780
     aacggcaaaa gagctgggaa tcggcgaaat cactctgaaa gacatttgtg aacagctgac     60840
     aaggccggaa cgcgatccac gcgataaggt gcctaagcct ttgctgaaaa cagacgtcct     60900
     tcagctggaa gatttgaaag agggaatgga actgcagggc accgtgcgca atgtagtgga     60960
     cttcggagcg tttgttgata tcggagtcaa acaagacggg cttgtgcata tctcaaaatt     61020
     gagcaatcaa ttcgtcaagc atcctcttga tgtcgtatct gtcggcgata ttgtgacagt     61080
     ttgggttgac ggcgtagatg tacaaaaagg cagagtatcg ctgtctatgg taaaataaaa     61140
     gcactgctta cgagcagtgt tttttcctat agaaatacca gcattgattc agcagtttaa     61200
     tttggtaatt atctttttca aggaacgctt tttgcatctg ctttttaagc caatttggca     61260
     taggctcatt cctcctcagc ttttatcata agagggacag tgattaccat attgtatgcg     61320
     aacggtgaat tgtcccgttc aatgtttttt aagtgaggtg caccatggat aacaaagagc     61380
     ttcaaaagct gacagaggat atttctgaaa catattttaa aaagccgttc cgccatcagg     61440
     cgctttttaa tgaccggctt aaaaccactg gcggcaggta cctgttaacc tcccataaca     61500
     ttgaattgaa cagaaaatat ttgattgaac acggcaggga ggaactgatt ggcatcatca     61560
     agcacgagct ctgccattat catcttcatc ttgaaggaaa agggtacaag cacagagaca     61620
     gagattttag aatgctattg cagcaggtca acgcgccgag gttctgtaca ccccttaaga     61680
     aaaaagcgga aaacaaaaaa acttatatgt atatctgtac gacctgcggc caacagtata     61740
     taaagaagcg cgccatgaac cctgacagat acagatgcgg aaaatgccgc ggaaaaataa     61800
     aaagaatttt ttcgtgaaaa aggttgacga atatggcaag cctatgttac attataaaag     61860
     tcgtcacgag agataaataa aaacatttac ctcttgacac tgcaaatcaa ggctgatata     61920
     ataagtcttg tctcattatt ccacagtagc tcagtggtag agctatcggc tgttaaccga     61980
     tcggtcgcag gttcgaatcc tgcctgtgga gccatattgg agaagtactc aagtggctga     62040
     agaggcgccc ctgctaaggg tgtaggtcgc gtaagcggcg cgagggttca aatccctcct     62100
     tctccgccat aagatttcga tataagttct caaccatcgg cccgttggtc aagcggttaa     62160
     gacaccgccc tttcacggcg gtaacacggg ttcgaatccc gtacgggtca ttccatttcg     62220
     ttgggctata gccaagcggt aaggcaacgg actttgactc cgtcatgcgt tggttcgaat     62280
     ccagctagcc cagccatttt tatttttgaa atctaatagt aagagccatt agctcagttg     62340
     gtagagcatc tgacttttaa tcagagggtc gaaggttcga gtccttcatg gctcaccatt     62400
     tgtctttttg cgggtgtggc ggaattggca gacgcgctag acttaggatc tagtgtctta     62460
     cgacgtgggg gttcgagtcc cttcacccgc actttattta caaagtgcac gcaaatctgt     62520
     tttactaggt taagagccta ctaaaccagc acaacacaat ttaatgatca cgcggtcgtg     62580
     gcggaatggc agacgcgcta ggttgagggc ctagtgggtg aataacccgt ggaggttcaa     62640
     gtcctctcgg ccgcatcaat gataccaagg gttttgacac ccttggtatt tttttgtgtt     62700
     tattttcaaa tgatttactg cccacaaact gcccacttac ctaaagtaag tcatctaatt     62760
     tatcagccat ttccttttgc ttgtttggat ataggtgtcc ataaacatca attgttgttt     62820
     ttacagaacc atgtcctaaa cgctctttaa ttgttatgta atcttctcct tggtgtatta     62880
     atagtgcaac gtgtgaatgt ctaaaatcat gtaaacgtat aggagtaaga tcgctatcct     62940
     tgcaaaagta tttaattttc cgactgaaaa tatcttttct tgaaggtgta tctttatatt     63000
     gaaagatata ggtatcatgt gaatgtctaa tacctaattc attaaacaac tcttcttgtg     63060
     cttctttcca acgttctagt agcttaagca attttttatt gatgctaact cgccgaatcg     63120
     aatttttagt ttttggagta gtaacaacaa attgaccatc aagccaggtg cacgatttat     63180
     gcacatctat ttctaataag attttgtcaa tatctttcca ttgcagggcg agcatttcac     63240
     cacatcttag tccagttaaa aaagcaacag tgtaaaaggt tttaaacaat aattgatctt     63300
     gaggaattaa actaataaat tttttgaatt cttctggtct ccaaaacttc attttctttc     63360
     ttgttaaagg taatcgttta acgttgtcac acggatttct ttttaagatt tcttcatgta     63420
     cagctgtatc aaaaattttg cttagactag tcattatatt attaaccgat ttattgctta     63480
     gacctgtttc cattaaatgt tttctgaaat cagttatttc tctatgtgtg attttttgta     63540
     tatcagattt caaaaagtaa tcagatatat gtttgtttat aatgtacttc tgattctgat     63600
     aatagtttgg tttactatct atttcacaac ttgctaaata aattgaaatt agagtcggaa     63660
     agcttactga tctggacttt cttgctcttt cttcttgaaa ttctcttctt aattttgctt     63720
     ctaattctaa agcctctttt ctggttgatg ctactggtct cgtcctaatt ctttctccag     63780
     taatcgggtc aaatccaaag ctaacgtcaa cttgatattg accattttca agttttttta     63840
     cagacatttt atttctcctt taaccaaaag cgcttatttc gtgtgaatag attctgttac     63900
     taaatgagcc aatttgagaa agtttataat cagtaacaaa tgatggtacg ttgaagtatg     63960
     ctgctatttg ttctttgcta aaaccctgta tatatggaag ggcttcatta agcattttat     64020
     ctgtcagtat taattctgat gcaaataggc ttgcttgatg ctcaagttta tcttttagaa     64080
     ctttagagca attcacaact ttaaaagtgt tcaatctttt atggagaaag taatgcccta     64140
     attcatgggc aattacaaat tgttgatgtt ggaggttctc gttgatatgg attaaatatt     64200
     gatctgtggc tttgtcatgt tgtagtaaac cgtttgcttg tccaagatca tttttgagta     64260
     tataaatttt ttggatgtca caaatttcat agacattatt tgtaccatgt gtcttaatta     64320
     ctgattgcac tttatgttta attcctttgc ttgtataaat tgttatcact ctttcttctt     64380
     taattcgtca atgaatttaa ttccgttttt taatgctttt ttaacaaggc gtgcagtttc     64440
     ctcatcaaat tcaccatcat tcataaaaag gagtgtatct tcatccttta attcctgtat     64500
     ggcttcatta attgttttat tgagtaaatc agtttcgttt ttcttgctta cttcatcctt     64560
     tcctaataaa tagtctgtag atacgttata taagttgctc aattttaaga gtgtgtctgt     64620
     atcaggatct ctgtaatctc tttcgtaatt agacaagtta ttgttaccga tattaagttt     64680
     ctctgcggct tctttctgag tgtacccagc tttttgtcga gcttctttta atcgtttgcc     64740
     taggctcatt tttatcatcc atttcacaaa gagttgattt ttataaaaat aataacaaca     64800
     ttttttggag aattcattaa tttcacctat aagttaaata aataattcta aattctcctt     64860
     ttaggagtgt ttgtttcttc tttatggaga gtttaattat caatatttcc atatatgttc     64920
     aaaaaaatac actttaaggt gaattttgtg ttgacttaca cgaaaaggag ttttataata     64980
     aagttaattc acaaagagtt gagttaacga ggaggtgata ttttgaaagg agagttttta     65040
     actgcgagag atattcaaaa aattcttgga gttaaacagg ctaaatctta tgacatcatt     65100
     agaactttga atgctcaaat gaaagaagaa ggatatatgg tcattcaagg taaggtgagt     65160
     agagctaagt ttgaagagtg ttattgttac aaaggcccaa aatctcaaac ggggtgattt     65220
     ttataaacat tgatataaca aactcgttta tgaaagaagc tgtcccttta gctagacaaa     65280
     tggaaggtga ttggatagca cgaatgaaaa ttgctctgaa ttcagtcatt ataaatcatt     65340
     atttaaacct tcccttaaca attgaaaatg ttaatgaatt actgcgaaaa ggcgtttcat     65400
     atcgcaggat atgtaagcat tacggcattg gaagaaaaga cattgaaaag cttcggcaat     65460
     catccgtagt gtgacgttat ataccactat agggagccgt taagaatcct ttgaaaggag     65520
     ggatgcgatg aaaataagag tgaatgcaac aatcattact gatgttgaag ctttaaaggc     65580
     tgataaggat ttgaatcatt ttaaagacta tgccacttgt gaaacattcg ttgttgatgc     65640
     tgataatcat ttgaaggcta atgaagaaat atctgagttg ttaaaaggct gggattggtg     65700
     gtgtatctgg tcaactcgtc cattgagtaa aaaggataac caagtgttta ctttgtataa     65760
     cgatgatttg tataacttat gtcgatagga gtgtttgttc cttgaaaact acatatagac     65820
     aaaaaaagcg ccttgacgaa tgatcatcaa gaacgccgga aaataaaaac tagacacttt     65880
     tattatacgg tattcttgtt gaaatgtcat gcgtgagtat ttgagtgatg aacagcaatc     65940
     actttaaatg ctgtagcagg ctagaataag cgtgcggaat agctgtagtc agcttgatgg     66000
     ctataattag cctactaggt tgccatgagg gcgtaaagcc gttagcaact gataagcgcc     66060
     aagatggata cagaaccgga gcgaatcaaa aacataaaat cgaaattaat gttcttttgt     66120
     aaataaatta taaaaaaatg aaatggggat atgaaaaatg aacttaaact ttattgtacc     66180
     ggatatcaat atgacttttg gagacatgaa attcatggga cttaacagag aaaggtatgt     66240
     ttatgatcgt gaaaataata agcgtactga cgtactggaa tctaggattt ataacattgc     66300
     tagtgctgtc caaggtggtc aaattgaagt aactattcct gagtatgctg gggcaaaaga     66360
     aattcctcct tttgcagata ttgagttgaa aaatccaaaa attagcgcta tggcgactag     66420
     tcaaagggat tcgacgtatg ccaatgtgat gtggaaactt gaagctgatg atattgttgt     66480
     taaaggtggc tcttctgtga aacctgccgc ggcaactggc gggaatgaaa agaaataaca     66540
     tgatgctctc atatcggcag gcgggtgatg tatatgagtg atttcttaaa caaaagattt     66600
     tggaaataca ggggcaaacg aatccgcccg tacatgagaa acaacgtaaa gttagcaggc     66660
     gcaatcatct ttgtgcctgt ttttttattg tctatgttcc ttttttggag agaacaactc     66720
     attcattttg atctatctca agtgataaaa aattttgaat ggaatgtgcc tttaatcatt     66780
     aaaagcgttt tatgctctgt gctaattgct gttggaagca tagttgcatc ttactttctt     66840
     ttgtttgaca gctataagaa aatccttcac aggcaaaaga ttgctaaaat gattttctct     66900
     aacaagtttt acgaaaaaga aaacgtgaaa gtaagaaaaa tcttttcaaa tgaaactgac     66960
     tcaaaggaaa agatcacata ctttcctaga atgtattacc aggtcaaaaa caaccacatc     67020
     tatattcgta ttgctatgga catgagccgt tttcagaatc gcttcctaga cttaggaaag     67080
     gatttggaaa acggcttatt ttgtgacttg gttgataaac aaatggaaga aggttttgta     67140
     tgctttaagc ttctttacga tgtcaaaaag aatcgtattt ccattgatga tgcagtagct     67200
     gagaatggag tccttccgtt aatgaagcat atctcatggc aatttgataa gttgccgcac     67260
     atgcttattg ctggtggtac aggtggaggg aaaacatact tcatgctaac gatcattaag     67320
     gcatgtgttg gactgggggc agatgtaaga atactagacc ctaaaaatgc agatttagca     67380
     gacttggaag aagtacttcc gaaaaaggtc tattcccaaa agaacggtat tcttatgtgc     67440
     ctgagaaagt ctgtagatgg catgatggaa cgaatggatg aaatgaagca aatgtctaac     67500
     tataagacag gtgaaaacta tgcttattta ggcttaaaac ctgtttttat cttctttgat     67560
     gaatatgtgg catttatgga tttgttagat atgaaagaaa gaaacgaagc cctttcttac     67620
     atgaaacagt tggtcatgtt ggggagacag gcggggtatt ttctcgtttt aggcgcacaa     67680
     cgtccagatg caaaatattt agctgacggt attcgtgatc agtttagctt tcgtgtttca     67740
     ttgggtttaa tgtccgatac gggttacgga atgatgtttg gcgatgttga aaaagcatat     67800
     gtgaataaaa aggagacagg gcgaggatat gccaatgtgg gcacaggttc agtgttggag     67860
     ttttacagcc ctatcgtgcc gaaaggatat gattttatgt catctattaa aaatgcgctg     67920
     gttggagtcg agggagcgca ggcgacggca gtcgccagcg gcagcgtaag cgaccagacg     67980
     gccagcggcg aaggagtgag cgaagcgaat ggatgagcta aaacaacccc cccacgctaa     68040
     caggggggta gtaatcgtaa aagaaaaaaa tgaagccgtt gaaagtcctt tggtatcaat     68100
     ggttgactat attcgagtct cttttaaaac tcatgatgtt gacagaatta ttgaagaggt     68160
     tcttcacctt agcaaagact ttatgactga gaaacaatct ggtttctatg gctacgttgg     68220
     cacgtatgaa ctggactata tcaaagtctt ttattctgcg ccggatgaca acagaggtgt     68280
     tttgatagaa atgtccggtc aaggttgccg tcaatttgaa tccttcttgg aatgccggaa     68340
     gaaaacatgg tacgacttct ttcaagattg catgcaacaa ggcggttcgt tcactcgctt     68400
     tgatttagct attgatgata aaaagacata cttttctata ccagaactgt taaagaaagc     68460
     ccaaaagggc gaatgtattt cacgatttag aaaatctgat ttcaatggct cctttgatct     68520
     atctgatggc attacaggcg ggacgacaat atatttcggt tctaaaaagt cagaagcgta     68580
     cctttgcttt tatgagaaaa actatgaaca agcagaaaag tataacattc cgttagaaga     68640
     actaggcgat tggaatcgtt atgaattgcg gcttaaaaat gaacgtgcac aagtggcgat     68700
     agatgcttta ttgaaaacaa aggatttaac cttaatcgct atgcagatca ttaataacta     68760
     tgtaaggttc gttgatgctg atgaaaacat cactagagag cattggaaaa cgagcctttt     68820
     ttggtctgat tttataggcg atgttgggag acttcctttg tacgtcaaac cacaaaaaga     68880
     cttctatcag aaatcaagaa actggcttcg taactcttgt gctcccacta tgaaaatggt     68940
     gcttgaagct gatgaacatt tagggaaaac cgatctgtca gatatgattg cagaagctga     69000
     actggctgac aaacataaaa aaatgttaga tgtgtatatg gctgatgttg ctgacatggt     69060
     cgtttaaaac caagctgcta aaccttaata aacacaggtg atgcgattaa acgtatgtgt     69120
     caacggtacc ggaacgaagt gaggataagg agttgacata ttcagcgcta cccaaaccct     69180
     cttggcattg aacaaacaac cgtttgttcc tgcctaccgg cgagggagtc ccccgatgat     69240
     tcgggggaat agggggatag attaacagca atccaacgag ctaccgttgg tgggtttggg     69300
     tgaaacccaa gaactaactt ggagggataa gatgcataat gtcaatctgt tgaatcaggc     69360
     tggactggaa aatgctttgg aatcagttgg ctgtttagat attgtagaag atttaataga     69420
     aaagatgcag gaatatgttt tgtatcatac cgaaactgcc gaaagatttg cgattgatat     69480
     ctttacagta gtaaacaact acactaaaaa ggttcatgcg atatttaatg ttcttgaaaa     69540
     tgaagacggt gagacaaatg ttaaaaatgt agaatttgaa gtaatgcatt ttacggagta     69600
     aggacaattt tccttatgac tttaaagggg gaacatcagg tgtttaatat taatctgttg     69660
     aatcaggccc gacttgagag tgatttggat tcccttgggt gtttggatat tgctgaggaa     69720
     ctgattgaaa aaatgatgga agatgttttt tacagtgatg tagctcaaag aatcattgtt     69780
     caaacacttg ctgttataaa taacgccaat gcaaaacttc aagctacgtt taacatctta     69840
     gaagatgaag atatggagac agacgaacga agcgtggagt ttgaaggaat tagctactac     69900
     gaataagggg tgaaaatgtg cggtgtctgc tgtagataaa cgattcaaaa gcttaggttt     69960
     taatgtgggc attccctctt tagtttttgt gagaagttta agcagagatt gcatgttggt     70020
     tgttgaagga gaacgagtaa aaggatttgc tgagtatcgt tacacattct ataaaacaag     70080
     atacttgcca gacggtcgaa tgactagctt aaaagtttat atggagaatc aaagcataaa     70140
     aagggtgtta catcgtgtag catccttttt atctttcttg gaaagaacga aacaaattga     70200
     acagaaggag tgtgaaaaag ttgctcaata aagaaattgg ctctgataag aaggaagaat     70260
     ccttttttcg gtctgctttt caaaaactga aacgaattga aagaccggaa aaagacaaac     70320
     aaaaagtacc ccgtgacagg tcaaagctga tagccgtcac actatggtct tgtgtaggga     70380
     gcttgctatt tatctgtctg cttgctgtgc ttctgtcaat taatactcgc tcccaactta     70440
     atgacatgaa agacgaaacg aataagccaa caaatgacga taaacaaaaa atttcggtga     70500
     ctgctgccga aaactttctg tcagggttca tcaatgaata tatgaatgtg aagaacgatc     70560
     aagaatctat tgaaaaacgt atgcagagcc ttgaaagcta tatggttaaa caggaagata     70620
     accattttga agatgaagaa cgcttcaatg tggatggttt aaaaggtgat cgagagttaa     70680
     agggttacag cttatataac gtgaaagaag gtgataaaaa cagccttttt caatataagg     70740
     tcacatatga aaatctatac cctgtagaaa aggaagttga aaaagaagtt aaagacggaa     70800
     agaagaaaaa gaaggtgaaa gaaaaggtta aaacaaacga gaaatacgaa aaacaaatgt     70860
     tgctgaatat tccagtcaca aataaaggtg attcctttgc ggtgtctgct gtcccttatt     70920
     ttacacagat ttatgatctg aaaggcgata ttgcttttaa gggtaaagaa gaaactagag     70980
     acgaatatgc aggcgagaaa aaagaatcta tcgaatcatt tcttcaaaat ttctttgaga     71040
     aatacgcttc tgaaaagaaa gaagaaatgg tttatatgat gaaaaagccg gaagcattgg     71100
     aaggaaactt gttatttggg gaagtgcagt cagtgaaaat cttcgagacg aaaaaaggtt     71160
     tcgaggtttt ttgtgctgtt cgatttaagg aaaaagaaaa tgacattccg gtaaatgaaa     71220
     aattcagtct agagattacg gaaaacagcg gtcagtttta tgtaaataaa ctcaaacatc     71280
     aataggaggt ttaaatatgg atttcatgaa tttctttatt cttggcgcag accttccaac     71340
     acttggaggg gtaaaaggtt gggcatcaga tgttgttatc caattcatta cgattgtggt     71400
     catgttcata gccgcaaaga atctgatgaa attaaaaatg ggcggcatta tctttgtttg     71460
     ctgtattggc agtgcggtaa cgtgggttat taaacactgg tcagaattct ccggctggat     71520
     caatgcgcta atggaaaaat tgtaaggggg catctgaatg gggcgtctgg tgttcaacta     71580
     ccggaaggca atgagagagc cgaaaaaaat ccaacaatta accgaaaatt attcgttacc     71640
     ctttgcagtt gagttaatac cggctattaa ctatttcatt tttgttggct tatgctttgg     71700
     attctggtac ggcgtgagga tgattttccc tcacgctttt gataacagtt acgtcattgt     71760
     gatttttggg ataccatttt ttttaacgat gcttgtaacg aaaataaagc cggaaggcaa     71820
     aaacatctat atatatttct ttgatttcgc aaagtattac ttcttcatca agcttccaca     71880
     aaagaagtat tgcaatgatc gaaagattga tttaagtaac gaaaaacaaa ttgagtttcg     71940
     aaaacttgtg aaggtggtgg attattcaaa tgagactaaa aacgcctatg aaggcaatac     72000
     acaagaattt gctgttaaca agaacgggcg acgtgtgggc gtactaccga ataaaaagca     72060
     attcgattcc tatgcaaaat aaagaaaaag ttgaatcgta taaaaagaag tggcagcatc     72120
     tttttgaaga aattacatct tatgaggatt ttcacttgat gatgtatcca agtgagtatg     72180
     aattagaaaa acgatttaag gatttagaaa cagatattgc ggcagatgca atggatgtgg     72240
     cacgttacta caatgaagaa accgtaaggc tgttagaaca gcgattagga aggctgacaa     72300
     agtacgactt cattttaggt gtaaaactga aaagcagtct tgtaaatatt agtgtcgaac     72360
     ttaaagacaa tatactatct tttttcaata cagcgactga tacagtcgtg aaaatgctcg     72420
     ggtgggaaca aaatgtttcc acctcttttt ttgaaaaata tgaggaagtc gaagaaacac     72480
     tagcgaatat catggcttct gttcgcggag aacggctttc agaaacagaa atgacataca     72540
     ttaaccgtta tcactttgta cgtgggttaa agcaccaaac gaatgaagaa agtgagataa     72600
     aggatgttcg ctctattaca aacacgatca tagaccccac tgacccatca gtattgcatt     72660
     tgcatagtga tcaagatgaa ggctattcag cttttgtcgt gattgacgaa tttcttcaca     72720
     atatgtcgga aagtgatttg ttttatgaag cacagtctct tcccttccct gttgaagttc     72780
     agatgaaaat tcaaacggaa tcaaagtcca ttaccaagcc tgccctcaac ctcaaaagac     72840
     agcaattgaa agaagaacaa aaagaacaac aaagcacagg cgatcgaagt gatgtttcca     72900
     ctgtcacaag tgccacaatg ataaggcatt tacaagatga aataaagaaa gaagatgtgc     72960
     atgtgatgaa ctggctgtcg gtgatagtcg ttcatggaaa gacaaaaaaa gaatgtgtgg     73020
     gaaaagcaac gattgtcaaa aggcatttaa aaggcgctgg cattacttgt cggcttccgg     73080
     tggctgatca attgaacctt ttttataaaa tgcttcctgg tgaaaagtta gacataaccg     73140
     ataagaactg gattcaaaaa acaacgcaag acggtgtggc tgaaagtctg tttgctgtta     73200
     actctgatat tggttcgaaa atcgggttct ttctcggttg ggttgatcgt ttccaagagc     73260
     acaccgactt agaaagtgcc attatgtcca gccgtgattt tgtcttattc caccctttct     73320
     tagcgaatca gcagttaaaa ggttcaaaga cacgttctcc tcactgctta atcacaggag     73380
     acacaggaaa cggcaagtca tatctagcga aattgatctt taactatatc agcatgttaa     73440
     acatcaaatc tctgtatata gaccctaaaa aggaaatgag aaagtggatt caaagagtct     73500
     tgaatgatga gtacattaga gagaactttc ccttatatat tgcacattta gagaaataca     73560
     actatatcac gctagatcat gaaaacacgc acaactgggg agcgcttgac cctatctcct     73620
     tcctccctcc tatgaaagca aaagagctag ttcaagtcat ttttgaacaa gtatatgact     73680
     ttaaagggaa ggacgacata aacacagctt tccttcgtgc tacgtcagaa gtgattgatg     73740
     cgaaacaaaa aggtgaacag gtcggctcac ttgatattat tcggaagatg cagagccatc     73800
     ccgaagaagc tgtacaaaaa gctggtgact atttaaatga ggtcgtgtca gattccattt     73860
     tgaaactttg tattcatgat ggttcaaatc ctgcattgtc actagaaaag cgaattacca     73920
     ttttagaagt tgaaaatatg gatttgccgg atcatgctga gcgacttgaa aactacacga     73980
     tatcacaact aaagtctagt gcggtcatgt ttgcactagg taagttctgc gagctattcg     74040
     gcatgaatca agacgaacag actgttgaat ttatagatga agcttggata ttcaccacgt     74100
     cacaacaagg aaaaaaagta gaaagacaaa tgcgccggat tggtcgctca tacaacaatg     74160
     cggaatactt catttctcaa tccacaaaag acgctttaaa agaagaggat tctggaaact     74220
     ttggcgttgc ctttgctttt gacgaaccaa acgagcgtga agaagtgttg aaatggatga     74280
     acatggaggt cacaaaagat aacaaaaaaa tgatggaatc catgtttcaa ggtcaatgct     74340
     tatttaaaga ttactatggc cgcacctcta aaatttcgat tgaatgccta ttcgaagaat     74400
     ggcaaggtgc tctgaaaaca gttgagaaaa aagccgtcgc atatgcggaa gaaaaatatt     74460
     tgtaaaaagg ggttgaatcg tacatggaaa tagctttctt aaactctctt gttgtcacga     74520
     gtccaggctt ttataaagct gagaaaatca cattggacga agttaaacaa tggctgaagc     74580
     attatgatgg tcgatacaaa agttttatcg gacataaatc aacggcacag tttctgcaaa     74640
     aattattagg tatcagaatt gagcaaaatc gaaagacttt cagacatatg aaatatcaaa     74700
     aagcaatctg tttctctctg tatgaacgat atcctgaaaa cgtgttgcta acgcaaagag     74760
     acttagagaa agccagatac caattttatt tattaactcg gttagattag gaggtggttg     74820
     taatgaaaaa gaaaagaatt ttgattgtgt cggctattgt gttgctgttt ttaactgttg     74880
     cttcagctgt aacggtattt tcggctgatg gagatacaac gacgcagcca aaagtcgaaa     74940
     aagctggcgg cgtggaattg aaggtgaaaa ggtttccaat ctcacgctat caagcgaata     75000
     atgaagcatc tgacgattta atcaaggggg cgtttgttgg gctgacaaac gtcacttttt     75060
     cttttgcggg aaacattgtc cgtgtggttg atacggggat ggatattttg tataacttgc     75120
     aaccgattga cgagttcgca aattctatta caaacgtctc taaaacagtt tataaaacac     75180
     tgaaaaagaa tttcggtgaa gctttattta ttttcacgtg cgcctatgtt gtctacctat     75240
     tctgtgtgag aggtagcgta aaagaagcaa tgcggcggag tattctattt atttgtgtca     75300
     tggtgatcgg tgggctttgg atgtcgaacg ctggttatta catgaaagta ttgaatgcct     75360
     tgtctgtaga agctcaagga aagcttttaa ctgcggggaa tggattggtt ggcattgttc     75420
     aagatgaagg caattttgca gacagttcag cgattgaaaa aggaaaagaa atggaaggca     75480
     cagttgcggt tatgcgtaat ctttactttg acattgcttt gatgaagcct tttttaattg     75540
     tgaattttga tgaaacaagc gaaaagaaaa tcaatgagga agatacagat aaaggcggac     75600
     ttaatcgtat agataaactg ctttcttata agctttcaga ggatggagaa aaagataaaa     75660
     aagattatat aaaagagact gaaattgatg attataaaaa tgaatctatg acttctggaa     75720
     atgtgtttaa tcagctggga gagtctttta tcgctgtggt cgcttctatt gtcattggga     75780
     taccattttt agcattagcg ttctttaatt tcttgcttca agttgtcgct ttagtgatag     75840
     ttttctttgt gccatttgct ttcatcttag cgtatgttcc tcaattagct tattcgggat     75900
     ttgttacgct tggacgcttg gggagtgttt acctactgaa agcaatgtta ggggttatcg     75960
     ttctgtttgt gtacgtgact tgttttattg ttgacaagtt aataccgcca aatggttttg     76020
     gaatgtatct tttaaatgtt gctgtccttg cttcaatctt gtggattggt tttcacaaga     76080
     gggatgccat tatcaagttt gtgactgctg gaaaagttgt ttcagttgat aataatatga     76140
     tggaaaacat gagacaaaac attgttcagc ctgcttggga acaagcgaag aaaataggtg     76200
     gagtatgggg taacggaggc ggcgtattta ctgactttac aaagcatttt gggggaagaa     76260
     aagacggttc gaatgctgat ggcgtaactg gtgctccaag tggtggcggt aattcaccga     76320
     gtgggactgc tatgggatat gataatactc atgctatttc aagaaccccg caaaaagaaa     76380
     cagctaacgg aatagctaat cataacagtc gaagcttaaa acgcaatcct caaactctat     76440
     cgaaagaaca agaaaagcaa aaacaaaaag aagcctttgc aaatgcaaaa gaaaataaac     76500
     agcaatccca tttagccaga ttgagaaaag acggaataaa ctctcctatg ttgaaagatg     76560
     ctttgaatga agggaatgag gatttatcca aacgagcacc tatcttgcag gataaaaaag     76620
     atgaatcagc acgaacagat caaaaagaat atgtggaaca gcttcttaaa cagcccaata     76680
     accagcaaca aactgacgat gcatcattac agcatgaaga agaatctact tctaatcgtg     76740
     cgcctgtctt acaagagaat gaaaaagata cagaacgtac tgatcagaaa gcgtatattt     76800
     atgacgaaca aaatcagaat cttgaaacag atcagcaaca agattttgaa gtccagaaag     76860
     atgattctgt ttccaatagt gagcctgtag cacaagagaa aacagcagaa atcaaacgat     76920
     cagatcaaaa agtcatgatg aatcaacctg aaccgcagct cggttttgaa agtcctcaat     76980
     ctacaaaagt agaaaatcaa cctattgcca ataacgaacg taaaatcaga ccatctgaac     77040
     ccgcaaaagt tcattcagat ggtattcgtg ttgatgaaaa acaggctgtt gctcctgctg     77100
     aaaataagac tgtatcaaga gaaaaacagc cttcatcaca aacaattaaa cggactgaac     77160
     aaagcgttaa ttcatttgac caagtgtctt tgaatgaaat tgcaagacgc tcttcatcaa     77220
     aagtagaaga tcgactgaga agggatgaaa gaacaagatg ataagtaaaa aggtagttct     77280
     tcctttggta ttctcggctc cttttatctt cttttttgtt ttatgtatcg tagtggttat     77340
     gacgatttca agagaaaatc aagtcgggga cgattttata ggcggcgggg atggcgaata     77400
     tgaaacagtt ggaattgcgc cggaagtgga acgatttaga gcagtatttg agaaatatgc     77460
     ccgtcaagaa ggcgtttttg accaagtgaa tattattatg gcgctcacca tgcaagaaag     77520
     tggtgggcgt tctttagata tcatgcaaag ttccgaaagt atcggcttac ctcccaactc     77580
     cataactgac ccagaacgtt caattgaagt cggcattaaa cattttaaga aggtttttaa     77640
     acaggctggc ggtgatgttc gtttaacctt acaggcatac aactttggtt ctggatttat     77700
     agactatgtc aaaaagaatg gcgggaaata cacaaagaaa ttagcacttg atttcagccg     77760
     attgcaagct tttaaaatgg gctggaaaag ctacggtgac ccaagttatg ttgaccatgt     77820
     catgaggtat gtgaaaggct ctgataaaaa tgtgaagcct gtgaaaggct ctatggattt     77880
     ctatgaaacg gtcatgaaag aagctttgaa atatgaaggg caaccgtatg cctggggagg     77940
     ttcaaacccg gaaactggat ttgattgttc tggccttgtt cagtggtctt ttgcgaaagc     78000
     tggaatcact cttcctagaa cagcacaaga acaacatggg gcaaccaaga aaataagtga     78060
     aaaagaagcg actgcgggtg acttagtgtt ctttggcggc acatacgaag gaaaagccat     78120
     tactcacgtc ggcatctatg taggcaatgg cagaatgttt aattcaaatg acagtggaat     78180
     ccaatattct gatctgaaat caggttactg gagagatcac cttgtatctt ttggacgcat     78240
     taaataacta ggagtgaaaa tatgaaaaca catattgcat gggcttcagc ttgtttatta     78300
     ttagtcatgt taactggatt tttcacgatt ggacagcaaa cgtataagat tgaaaagtta     78360
     aaagataaaa atgaagtttt gagcgaaaaa attaaggaat tgaaccatat agaatcaaca     78420
     agtagcgctt cggaaaataa ggcatttttt gaagcgtttt ttaattactc cgacatagat     78480
     atacgatatg aaacagttaa gaagcacaca actggaaaag ggtttgatta tgcattccct     78540
     tctcgttctg atcaaaagca cacagtcagc gtgcaaagtg aattactatc actagagagt     78600
     tattcaaagc cgttagatga gtctcatgaa ttgtttttaa acattgttga agtcgccaca     78660
     actgcaaatt cagtcactac gaatcaagtg ttaattgtac aaacgactat gaaaaaagaa     78720
     aaggatggtt ggttagtcga taatgtgcag gttaagggaa atggataaaa ggtggaaaag     78780
     atcaatttgt ttgtttatac taaatattga aaaaggaggt aatgtttatt ttgaaaaacc     78840
     tttttatttt ccttagtttg atgatgatgt ttgttttaac tgcatgtggt ggaagcaagt     78900
     atgatgatgc gattgatgat gtaattagcc aatataaaga gcataaagga aatgacacag     78960
     agataaatat taaaagagag aatgcgattg ttagagtcta tgaagggggc aaatatattc     79020
     agtttgcatt ttatatgccg gataactctt cacgtgaatt aacaacattt aagtattatg     79080
     aaaaatttgg agataaatat gaaaagatga ctgatatgcc ggggaatggg gaaaatgatc     79140
     gtctggggtt atcaaagaaa acaccagact atgaagaagt aaaaggagaa gagacagagt     79200
     tagaggagta aaccgtgtgt ttactcctct tttagtttta ttgacattgg taaaacagag     79260
     atagggtaag aacttagcta attaagaatg aaaattataa ggtttataag ttggaaacta     79320
     aatcaaatat gtcttctaag aatagattta tgggtaaaag ttgtttttac actattggtg     79380
     ctactagcag tggcatttaa gttattttaa tttcgtatta aatttagcct ttatcctttc     79440
     ccatttttta tcttctaatg tgagatcata catacggagt attttttctt ttaaattaaa     79500
     taagtctatt ggttcctcca aggagaatgc ttttttattt ttatcaatta ctccttttat     79560
     ttcgccctta aaaccaggga ggatgaaagt agagcagtta ttgctattca cccaagtagc     79620
     ccccatttca ttaaggcagt atacgctatc atagtaatta tcggataaca tataaaagac     79680
     atatgcaccc ttaaaaagat gtttttttag atattcgaaa atatcttcat ctccaggaat     79740
     accatgataa ggtgaagaag tgtatattat atcttcagaa gacactccta tatcctctag     79800
     taattcaacg aaagcattac atacaatttt gtcttttgag gagtggctaa taaatatttt     79860
     tttctctaat tctctatttt gatcacttga aaagtgagtt atgctgcttt tttcagtctc     79920
     atctactaca ggcaattcat ctaaaaattt ttttatttta ttttctgttt catgatgttc     79980
     aaactcatta aaaacaaatt catttttata tatttcattg cggtttcgtg cataccaagt     80040
     cttaagttgt tctagtgaat aacgaattaa ctcaatatca tttgattcaa gagatgttcg     80100
     aaattgatca ataatatttg tgagtacagg ctcgcgagag taatctagaa gtactcctat     80160
     aattccatta gcctcaaatt ttaatttttt taatgtgtcc attagatttc ctccgaccta     80220
     atttaatcca ttgtttgtaa acatttcata tctaattata taacatagac tcctattcta     80280
     actacttatt ttaaagcagt ctggattgtt tgggtaattc ataaaaaaat aaaagaaaga     80340
     aggaggaata gagtttttct tttttttgtt tgcaatgtta ctgtcaagtc gcaaaagaat     80400
     tgctatgacc gaaaaaaaac cgcaaaggaa tagatataag gtaccttttt gcaattcatc     80460
     tttgtaaaat aaaggttatt ctgacataat acaattaatg taaaaattcg cacaatttta     80520
     tgtaaggatg ggggaatttt cttgcggggt gttttcttag ataaagataa aattccgtac     80580
     gacttagtca cgaaaaagtt aaatgaatgg tatacatcaa taaaaaatga tcaagttgag     80640
     caagccgaga ttataaaaac agaagtagag aaagaattgt taaacatgga agaaaatcaa     80700
     gatgccctgt tatattatca actattagaa tttagacatg agataatgct gagttatatg     80760
     aaatctaagg aaatagaaga tctcaataat gcttatgaga ctataaaaga aattgagaag     80820
     caagggcaat taactggcat gttggaatac tatttttact tttttaaggg tatgtacgag     80880
     tttaggcgta aagaattaat ttcagcgata agtgcttatc gaatagctga atcaaagttg     80940
     tcagaagttg aggatgaaat agagaaagca gagttttttt tcaaagtgtc ctatgtatat     81000
     tattatatga aacaaacata cttctccatg aattatgcaa atcgtgcact caaaatattt     81060
     agagagtatg aagaatatgc tgtccagact gtgcgttgtc aatttattgt agcaggaaac     81120
     ttgatcgatt cattggaata tgaaagagcc ttggaacaat ttttgaagtc tttggaaatt     81180
     tccaaggaaa gtaacataga gcatttaatt gcaatgtcac atatgaatat tgggatttgt     81240
     tatgatgaat tgaaagaata taagaaggct tcacaacatt taattttagc gttagaaatt     81300
     tttgaaaaat caaaacatag tttcttaaca aagactttat tcactctaac ctatgtagaa     81360
     gcaaaacaac aaaattataa tgttgctttg atatacttta ggaaagggcg atttattgcc     81420
     gataaaagtg atgataagga atactcagcg aaattcaaaa tattagaggg attatttttt     81480
     tctgatggtg agactcaatt aataaagaat gcattttcat atctggcttc gagaaaaatg     81540
     tttgctgatg ttgaaaattt ttcgattgaa gtcgctgatt attttcatga acaaggaaat     81600
     ttaatgctct ctaatgaata ttatcgtatg agtattgaag caagacgaaa aattaaaaaa     81660
     ggggagatta ttgatgaaaa tcagccggat tctattggca gcagtgattt taagtagtgt     81720
     attttcaata acttatttgc aaagtgatca taatactgaa attaaagttg ctgcagatcg     81780
     ggtaggggca tagcttagat aattggaaaa gaggaaaaaa gcttaatctt ttttcgaagg     81840
     ttaagctttt tcttttattt ataaaaagtg aactaactat cagaaagaaa ttatattaaa     81900
     ttttattttt ttgtttaaaa agtagattat ataaaggcaa gctaggtggg ggaaaatatg     81960
     tttaaaaaag aaaaagtcac agaatacatt tggactatac taataccaac aatcatcact     82020
     tttatcatta gttgggttgg gtcttattac aatggtactt cgacagttag tattggacaa     82080
     cctacaaaag tttccggtca gtatatcacg ccaataaata taagtcccta tcatgatatt     82140
     aaggaattaa gaataacttt tccgcaaaaa ctagatgtaa aacaaattag ttcaaatgag     82200
     cctataaatg taaaatcaga taagaacaat ataggagttg aaagtaattc cacttttgag     82260
     attgcgaaaa tcgttgaaaa taatagcgtt cagttgctaa ttacaacaca aaaaaagtta     82320
     aacgataagg aaattagaat tgataaaaat ggaaataaca tttctgtaaa ttatgaatct     82380
     cagattgtta atcctgcaaa aaaacaatta atcaatctta taattacgtc atctatttat     82440
     tttataatgc ttaatatact agcattgatt atgaacaaaa gatgggataa gtattatgca     82500
     aaaatgaaaa atgaaatcaa agaatttgag gataatgcaa aagatcttga taaaaaatca     82560
     aagaagaaaa gcgaggaatt atcggagctg cgaaagacct tgaaccaagc gtttgaggaa     82620
     actgatagga taaaatatca tgagaagaaa aaacaaatcc tcctcttagc taagttaaac     82680
     gattataaaa aagaactaac cttttggaga aatacaataa gaaaagttct ttatgaactt     82740
     cctgatggag ataaaaaagc agataaacta atagggacag ttacatcatc tttaaaaacg     82800
     tacggtacag tcgaaaaaaa cgagcatgat tatgaaagtt taaaagtagc agctgcctta     82860
     ctaaatgatt ctgataagag atcgtaatgt actggatttt aataaactat tagaaagaag     82920
     attagctgca aacatcagaa cgaccaaaca atggtggtat gtttatagag tttagttgtt     82980
     gaaaagggcg aactatgagt ttgctgccca tttactgccc agaataaata acaaatcatg     83040
     aaaatcagtg taaataaaat aacttaatgc tataaataaa ggcttttgta aataaagata     83100
     tgattttact aggttgaggg cctagtgggt gaataacccg tggaggttca agtcctctcg     83160
     gccgcatcta accacctttg gtattatttt tttgtgtgga aaatacggct atgggagaag     83220
     acttgctcac caaaactcac cagctactta aagtaagtca tccaaacggt cggcggttcc     83280
     ttctgtttat taggaaaaag atatccgttc attgtaaaag aaacgaacca tgtcctattc     83340
     gttcaaaaaa actaaagggt gatacatatt atacatgatt aatatgtatc acccttttct     83400
     ttcttgttca acaatcgcgc ttgaggagaa cataagctaa tacaactgac tcgatttcta     83460
     aagttgctcc attctttttt taaacaactc atccacaacc tgttttaaaa tctcgtacga     83520
     ctgaatttcc ttgctcaatt cgtaaatatt agataacaca attaattcat ctgcgtgata     83580
     catttgttgg aaatcaatta gttcgcgacg aattgtttct cgatcaccca tgattgtata     83640
     ccccagtcga ctgtggagaa tttctaattc aaactgtgat aacgattcta ggaagttttc     83700
     agtgggtgga ataagcttac ttaaattatt tgtataaata tcaatataca cctgcaaatg     83760
     acttgcagaa ataaaagatg cctcgtctat agattctgct gcaatcacat taatgcaagc     83820
     gatcacataa ggttcttgta aataagaaga cggttggaaa ttttctcgat aaatagagag     83880
     cgcttcttcc atcgaatggg gtgaaaattg agcgccaaat gcatagggta aaccaagctt     83940
     tgcagcaatt tccgctgaat ccgttgagga tcctaacaca aaaacaggca catgcgttcc     84000
     aatacccgga taagcgcgaa cctcaccctg tacactctta tccccgacaa aacgcaaaat     84060
     atcatttact tctctttcaa agaaaaacac tccattatgg ttggaacgac gaatcacatc     84120
     ggccgttttt tgatccgttc cgggtgcgcg tcctaatgcc aaatctacac gatttggata     84180
     taatgtttca agtgttccaa attgctccgc tacgattaat ggggaatgat ttggcaacat     84240
     aataccccct gaacctacgc gaatgtcttt tgtatttgct aatatatgtt gtacaattga     84300
     tacggttgct gcacttgcat aagcgtcgtg attatgatgc tctgcaaacc aaatccgttt     84360
     atagcccata ttatctacag ctttagctaa tgacactgca gaatcaatcc cttgtttcat     84420
     tgtttctcct tgtcttaatg gagcaactga taaaacagat atatcaaatt ttttcataat     84480
     ttcacctcta aaataatgaa cttatacaag atcaatggaa aaaacatttt gaaaaattgt     84540
     ttcatattaa atggtgtcca ttcctctttg atttgcatgc aaataaatat atactttctc     84600
     aaacgatcaa tacataggca aaataaagtt atttcacaat ttcactttac ttttaaagtt     84660
     ttaagcaaac ataaaaaaat gttcagtgaa caaaatatgt aaaatacatc ttatttttca     84720
     gaaaggatac aagaaaatga ttgatgaaat agataaaaaa atacttgatg agctgtctaa     84780
     aaatagtcgc cttacaatga aaaaattagg ggaaaaagta catctcactg caccagcaac     84840
     cgcatcaaga gtagtaaagt taatagacaa tggcataata aaaggatgta gtatcgaagt     84900
     gaatcaagtg aaattaggct tctctataca tgcttttctt aatatttata tcgaaaaaat     84960
     ccatcatcaa ccctatttag cttttataga aacacaagat aactatgtaa taaacaatta     85020
     taaagttagt ggagacggtt gctatttgct tgaatgtaaa tttccttcaa acgaggtatt     85080
     agatcaattt ttaaatgact taaataaaca tgcaaactat aaagtgtcga ttgttattgg     85140
     taaatagtta actttataaa acggagatgt gcggtcatat aacatgatat atatgctcta     85200
     aaaaagccct aggttggata tggaatttac caagctgggg cctttttata cattataata     85260
     acaagcgcat tattcatcag acattaatga agtattataa tgctttttta cttccttaat     85320
     agacaaataa agctgatagt ttccatactt caataaatca ttcagaaggt gatttaaaac     85380
     ttcttgtgaa tgaaccgtta ccttcagaag ataacatgca tctcccgaaa cacgatgagc     85440
     ttcgctaatt tcattacgag tagcaataaa tttcaataaa tcatcatgca tatatgcatt     85500
     catgaaaaag aagacaaagg ctgtaaaaga aaaccccatc ttcaattcat caaccacaat     85560
     cgaatatgct ttaatgatac cgttatcctc catttttttg atgcgattgc ctaccgcttg     85620
     tcctgtcata tgaatttttt caccgatttc tttccattgt atccgagcat ttttatttaa     85680
     taattggaga atttgaaaat caattgaatc aatttgcata gtaactcctt tcacagtgaa     85740
     aaagttttac aaaatagtat ttcatgagac catcgaaaat tcaatggaaa ttatatatcc     85800
     ttatacagta taaaaatttt aagaggtgaa aaaatgacaa cagctttatt agtgattgat     85860
     attcaaaatg attactttcc aaatgggaag atggctttaa caaacccaga gaaagcagca     85920
     caaaatgcgg ctaaactact ttcacacttt agaaacacag gcgcacctgt ctttcatgta     85980
     cagcatatca cagaaggtaa catcgctcat tttttccatc caaatacaga aggtgtcgaa     86040
     attcatgagt cagtacgtcc attagagaaa gagacagtca ttgtaaaaca tatgccgaat     86100
     agctttttca atacagattt aaatggaaag ctacaagaag aaggggttaa agaattagtt     86160
     gtttgcggta tgatgtccca tatgtgtatt gatgcaacag ttcgttctgc agttgaacat     86220
     ggttatgtat gccaagtggt agaagatgct tgcgcaacaa caacattgca aattgaagat     86280
     aaaatcgttc ctgctgagca tgtccattac gcatttatgg ccgcattaaa tggtgtctat     86340
     gcaacagtaa aaaccacaga ggcattttta aaataaaaga atttcctgcg cgaacataac     86400
     gtctttcttt tcacaagaaa gatgattcaa caacttaaaa aaggatgttc agaaaaatac     86460
     ttctggacat cctttattca ttatctttta ttgtttttca gtatcattat tcccatctga     86520
     taaaagatca agatgtcctg tctttgatcc atagtaagac catatacagg gattgttttt     86580
     gccataaata tagatattga tgaaggttta cataaagcac ctaattgctt gatttacttt     86640
     aatgttagat ccctcaataa ctccattctc ttctaatttc tctactctag ctgtagctgc     86700
     tgggcatgtt aaatgtactc tctcccagat ctttcattga attcggctat tatacataat     86760
     ttctctataa ttttttatct gtttgatcta tttgaacgtt aattcctttc gaaaataaag     86820
     tcaaagagtt aaaacacttt tttttatcta tgtattcgaa cactgctgat attatacact     86880
     taactctgtc gatctaagac aaataaaaaa agaaagtgag ttgtaaatat gaatattaca     86940
     caaattcgaa atgcaacaat tgttgtaaaa tacgcaaata aaaaattttt gatagatcct     87000
     atgttagcag agaaaggtac gtacgctact ttccctgaaa cgatcagaca agatttattt     87060
     aatcctttgg tgagtttgcc aacatcaatt gataacattc tggatggcgt agatgcggta     87120
     attgttactc atctacacct agatcacttt gatgatgtgg caaaaaacgt attgccaaaa     87180
     aacatcaaaa tgtttgttca aaatgaagca gatgcaaaag aagtaaaagc aagtggtttc     87240
     aaaaatgtag aagtgctaca tcaagacact gtttttgaag ggatccaatt agtaaaaaca     87300
     aaaggtgaac atggcagagg ggaagagtta ttaaacttaa tgggtgatgt ttgtggatta     87360
     gtattcaagc acccaagtga aaaagtttta tatgtagctg gggatacagt ttggtatgat     87420
     gctatcgaag acgagattca tacacatcaa ccagaaatca ttgtggttaa tggtggagac     87480
     aatcaaagat tagatttagg ttcactcatc atgggaaaag aagacatcta tgaagttcac     87540
     aaggctgctc ctcatgctaa gattatatct gttcatatgg aagctgttaa ccattggaca     87600
     ctatctagag aagaattaaa aaactttagt aaagaaaaag gattctcaag taatatttta     87660
     gtgccagaag atggcgagtc ttacacattt taatatgaac accgacaaat aaatagaaga     87720
     agctcataat tataaaaact aatcatgagc ttcttctaat aatgaatatt ttaaatttta     87780
     aatatatcga aaatcctaaa tatacggaat aacaaaaatg gaatgttcca atgatgacaa     87840
     aaaaacttga aaagcaacaa agatgtgtcg ttaggaggta gaattcatgg taatgacaaa     87900
     aaaagataca aatatatcaa cacagcagcc tctttggtta caaggttata ttgattcacc     87960
     agaaaaacaa aaccaacttt ataaaaaaac attaaaaatc ttgatttttt cacaaatatt     88020
     tgggggagca ggacttggag ctgggataac agttggggcg cttcttgcac aagatatgat     88080
     aggatcggaa aatgtagcag gaattccaac tgccctcttt acttttggat ctgccgtagc     88140
     tgccctgctt ataggagcat cctcacaacg ttttggtcgc agagctggac ttgcaggtgg     88200
     tttccttata ggcggattag gtgctatagg tgtgataatc gcggctttaa ttaacagcgt     88260
     tgccctatta tttgtttctc ttcttattta tggagcaggt atggcttcta atcttcaagt     88320
     tcggtatgct gggacagacc ttgcaaatga gaaacaacgg gcaactgctg caagtatggc     88380
     cttagtttct actactttag gagctgtagt aggtcctaac ttagttaata caatggggga     88440
     atttgcagat tcaattggtg ttcccaattt agctggtccg tttattatgt caggagcagc     88500
     ttttataatt gctggaatta ttctcttaat ttttcttcgt ccagatccgc tgtttgtatc     88560
     aacagctatt gcgaatgctg agaaaaaaga cgataaagta caaataggag gaagtctaaa     88620
     aaatcctgct atagacaaaa aaggaataat ggtaggagct gtcattatga ttttagctca     88680
     actaatcatg acagctatta tgacaatgac accggttcac atgggtcatc acggtcatgg     88740
     tttaagcgaa gtgggattag ttataggact ccatattgca gcgatgtatc ttccttcacc     88800
     attgactggt ttattagtag ataagtttgg tcgcacaact atggctattg cttcaggtgc     88860
     cacacttctt gccgctgggt tggtggcagc tattgcaccg gcagactcat tatcattgct     88920
     aatcctagca ctagtattac taggggtagg ttggaacttt ggtttactaa cgggaactgc     88980
     ccttattata gattcaacac atccatctct acgtgcaaaa acacagggaa cattcgatgt     89040
     tttattagca ctatcaggag cagcaggtgg agccttgtca ggaatggttg ttgcacattc     89100
     tagttataca atactatcaa tttctggagc cgttttatca ttgttactca ttccagtagt     89160
     tatttggtat tttagaagga ttcaggaaaa agcataagct tatataactg tctttgaaga     89220
     acctaagtag acattacttt accggaacct cctttttcta tttattatag taaggagttg     89280
     acatggcatt agtggcatgt gtataactac acaattattt gggattcaga gagcatgtaa     89340
     tgaacggaag agataattat ttatcacttt tattattgta cggtgttctt gtggcattaa     89400
     gttcagtcaa ttttggtcta actgttttct ttttgttttc atcacctctc catattatta     89460
     acaaacacga aaaggatttt aatgaaaata aaatgattag cgtatgtatc tctaattttc     89520
     aaaatgaatg aatagtcctt tttaagattt acacacttat tctccaagga aaaatgactc     89580
     aatttttcga ttttttatgt aaatcaaaaa agaatcatgt tagagtaggt gtgctgaaaa     89640
     taattcaaaa aattattttg cgatatgatt aaagtaatat tgccagagag tttcaattgg     89700
     acaaaattgt aagtgtttaa tacactgggg ctgcaatcaa atatgcacct ggaatcaatt     89760
     gctaaacggg ggagtttata tgaacaacaa gaaaaatatc tttgatattg ttatgtacat     89820
     tattttcggt gtgttaagtc tttttctagt tgcaaaaact gattatggca ctggagtttt     89880
     agtgtttgtt gcaattttat acctcgctgt tattgcttat aaaattaagc aagtatttag     89940
     taattcagat tcttaaggtg taacacaagg aggatttcaa ttgagaaaga aaagagttat     90000
     tacttgtgtt atggctgcat cattgacttt aggctcactt ttacctgcag gttacgcttc     90060
     tgcaaaggag gactctaaga caaccccttc ttacgaagaa ctagctctac attacaaaat     90120
     gaaaagtgaa aagatttcat cgaacgggaa attagttgaa attgagtatg tgagtggaaa     90180
     tgaaactcac aaagttcaga tgaacggaaa taatcatact gtaaaagtcg atggcataga     90240
     acaaaaaggt ttaaactttg agtatgatga aaatgttgct aaaagaacaa attatgaaaa     90300
     caataatttg aaatcaaatg aattcacaac acaggctgca aaacctaaaa agggatacca     90360
     ttatgtgggg actttatctg ggcatacaaa agcagctaaa aatgcgttat cagttacaat     90420
     gtcattagtc ggtattgtcc ctggcttggg atgggggagt aaggctgcca ctattttatt     90480
     ctcttattgg gcaaaagaac aaatccctga tgcgtattat aaatatgatt tatacgaaaa     90540
     aggagcaatg actgatagtt ggtatcagta tgctacagtt caattttttg aagataaagc     90600
     tcataaaaag aaaatgggca aaccttggac aagtactcct gcaaaagtag atttacctaa     90660
     tagctaattt taaaatcact ttgtctttat aaaggacaaa gtgatttttt gttatacaga     90720
     agtaaaatcc ctcgtctgag gaatcttgga aaaaacttgg ttcaattttg atataacatg     90780
     tttttttctt gctaatttag tttttctatg tatcgctaca cattctaaat aataagatat     90840
     tagccggacg gttgatgcca agctcaaaag tttatatgga agtcaaagca taaaaaaggg     90900
     tgttacaacg tgtagtcttc tttttatttt gccaacgtaa caagtgtgaa agtaatgatt     90960
     tgtaggatca gttaagaaag gtttaagatt agatattgaa aaattttata tattttcaat     91020
     aaaatactgg tactataata aatgtataca gattgtatgg agatgtaatt aattaaaaag     91080
     gagtttttta attgcgttgg agtaaatggt tcaatgtttt ttgtatagta gcattgggat     91140
     caatatatgg ttataaatta tttactaacc aagaagtcag tactactcgt ttaataatag     91200
     cttctgtaat tgtgttgtgg aatattgttg gactttttag caaagaatca gtaaaacaag     91260
     cacagcaagc aaattaaaag tcataaagtt gggaaagaag gatgttactt atgtagtatc     91320
     cttctttatt attccttgaa aaatgaaaca aattggagat tacagcttat ataatcaatt     91380
     gaagtcgttg attattttca tgaacaggag atttaatgct ttctgatgaa atattatcgt     91440
     atgaatgttg caagaggaaa cgttactcaa agattacagg gatgtgatga acactcctct     91500
     ttatcgcact cacctgaccc caaattgttg gggaagggca ggtacggaag atagagtatt     91560
     ttttcttcgt aacaaatcga aaaggttgga taataaaaaa cttataatct aaggcggtat     91620
     atagttgtga aaaaggcgtt atttcttata ttagaccagt atgcagattg ggaaggtgtt     91680
     tacttagcat ctgcattaaa tcaaagagaa gattggtcgg ttcacactgt ttctttagac     91740
     cctattgtaa gctcaatagg tggttttaaa acatctgtcg attacataat agggttagaa     91800
     cctgcaaatt ttaatttgct agttatgatt ggcggggatt cctggagtaa tgacaataaa     91860
     aaactattac attttgtaaa aactgcattt caaaaaaaca ttccaatagc agcgatatgc     91920
     ggtgcagtgg attttttggc gaagaatggt ttgctgaata atcatagcca tacaggtaat     91980
     tttgtttact tatggaaaga ttacaaacaa tataaaccga ttagcagttt tgtagagaaa     92040
     caagcagtaa gagataaaaa tttggttact gctaatggaa ctgcccctat tgaatttact     92100
     aatttaattt tagagatgat tgattttgat actcctgaga acatagagaa aatgatgtat     92160
     atgaatcgtt atggttttta tcatttttgt gataaatatg gaaatccatt tgttgattaa     92220
     tttgctggaa atgattttcc cgaatagggg gctttgcgat tgagttgaat ttcctaataa     92280
     agcaaagaaa gatgatttga ggtcaagttt aacaaataat gccatcaata ttaatttgca     92340
     gttatttccg attcctgata taataaagaa gaattatttt tgttcggtgt aaaggatagt     92400
     atgaagattg acttttcgtc ttgatgatac tttgggcaag gatagtatat actgtgtggt     92460
     tacacactag gaggcaacaa aaatggaaca aggtacagtt aaatggttta atgcagaaaa     92520
     aggttttggc tttatcgaac gcgaaaatgg agacgatgta ttcgtacact tttctgcaat     92580
     ccaaagtgac ggattcaaat ctttagacga aggtcaaaaa gtatcgtttg acgttgagca     92640
     aggtgctcgt ggagctcaag ctgctaacgt tcaaaaagct taatcttcaa tcgtttatac     92700
     aaacaggctc tttatatagg gcctgttttt ttatgtctat atcatactca ataaaaaacc     92760
     ctactcaacg ttcgagtagg gagatgctac aaggtaatag aaaaagattt aaaacttcaa     92820
     aggtttgttt acagtataac atactggatt gacaatatgc ggaatgtata taaattattt     92880
     aatgttttgt tcaaatatag ataactgact ctttttttca ctaacctgtt cgttcattta     92940
     agtaagatta gatgaattat aaaaatggtt tcatctaaat gttatcaact cgcatatctc     93000
     ttttatgaga agaagataaa caattattat tcaatgttgc agtggatata agaaattctt     93060
     aaaaataatg aggagatcga ttgttttttt ctcctggaaa taatcactta gagataccta     93120
     aaacaatgaa agccctacct ctcttccatc cttacggctc cttgtccgtg ccagtgtgaa     93180
     tcaggatact aaaaaaagtg actattttat tgagtttttt ggtaaaactt caatcttcgc     93240
     agaagaaatg taaataataa aaatggatta gaatgtagga ataacaaaag aggtcgttaa     93300
     tgttctaaac ataagttgga gaagatttgc ttttcatcat aatattccga aatatctttt     93360
     gggatgtatc taaccaaaac tttttatttg tttttcagtg attcctttaa ttacttccag     93420
     ttcactaatc aaaaattcat atgcattatc cagcattttt ttttcgcttg cattaagtgc     93480
     tttttctttc ttcatacgca ttaaatcacg tacaacttca gcaccttctt gtatttcacc     93540
     tgtttttatt ttgtccgtgt ttattttgta cctttgcttc catggcagta acctatcgga     93600
     ttctccatgc tgaaaaatgt gcataatgtg ttttaatgca agtatatcgg taactggtcg     93660
     tatattcgaa ctcaatattt tactcgttgg aatcataact gtcatattac tgattgacat     93720
     tcttatgaca taatactgtt gtttttcctc taagaattct ttttcttcta tggcttcaat     93780
     tatacctgct ccgtgcattg gataaacaat gttatcgcca atttgaaaca tatcatccac     93840
     ctccatatat ggtatccttc ttaagattac catatatgga ggtgtaatat caaaatttta     93900
     ataataacat gatcgaattt ttgatgtcaa taactttttt gaaaaaacag atcaagcaaa     93960
     aacaataggg aacgtgtcgg atttccaatc aggaaaaggt caattgatcc gtgtgagcag     94020
     tttttcattg gctcaatgac attacagaaa tgatttgagt agataagaaa gaacgatatt     94080
     cgtgaaatgt cagctaaaaa tatttaaagc acatgattaa gttctaattt ctttaccgat     94140
     ttgatatgga taacggccga cttacttaat gatgcatttt cacttatctt gcaagcagaa     94200
     aaaggtttgt tgataaacat ttagccacca aattggcatt attatcaggg aaattgacaa     94260
     ccttcaaatg ggtattgagg cgagaagaaa aataaagaaa ggagagatta taaatgaaga     94320
     ccagaacata aagaagtaaa ggggaaagaa caaggttaat tgaaaagcaa actatataaa     94380
     atagtttgct tttttttgtt atgacttcac ttctttttct ttctctttaa tgactaataa     94440
     aacaccgctc agaattaaaa acgaacctat ccaaaatgtc ccgcctattt gttctccaag     94500
     cagaatccat ccgagtaagg ttccaaccag aggctgaaaa aagaaaaaga ggcctccact     94560
     tgaggcattt aataattgta agccgtggtt ccacaataaa aatgcacaag ctgttgaaac     94620
     aattcccaaa tacaaaaggc cacctagaat tttagggtca agcagtagtg gcgtaaaaat     94680
     cgtgctaggg gagtaccatt aacagggact ccatttatta atagaataaa ctttatgaat     94740
     tcattttttt gtatgataat ggcgtcatat tcatcgcttg ttgaaattta cttatgaaat     94800
     aactggtact gttaaatcca acttgataag acacttctgt cacattggat tcagggtgtt     94860
     gcagtaataa taagcttttt tgaattctat aatccattac ataacgtaat ggcgtcttat     94920
     tcagcattcg tttaaaataa cggcagcatt cagaacggct cagttggcca gcttttgcaa     94980
     tgtcctctaa tgtgattttt tcaacataat ggagatggat ccagtttaac atttgtttca     95040
     ttcgatgact ttttatcatt tcagattgat cgtactctaa ttgaaaacca ttaacgacca     95100
     ggtttttcca cattaacgtt aattgcatcg taatgtcaat ctcatagagc gatgtctttt     95160
     gttgaatcaa ttgatttatt tttttaacag catctagaat attttttgcc cactgttgat     95220
     ttccagccaa aaataaatag ggcaaattgg ttgaaaacat atagggctga acatagcttg     95280
     aatacagttc ctgagataaa acgaaatggg gtgacacatt caagcaaata tacgtacaat     95340
     ccgagccttc cttttcttcg gccatgtgca ggtagccgct attgataaat aatccatccc     95400
     cttcgtgaac ctctattttt tcttcattta tttgaaagag agctatccct tttagtatca     95460
     aaacaaattg gatttcatca tgccaatgaa gcggaatata gccatttata ttttgattga     95520
     tcgttgtctt gtagcaggca actggcaatt ctaccgttcg gtgctctgtt aattctttta     95580
     aattttgatc gatcacaaaa ttcttcattc tgacttcaca cctcaatata tttatatttt     95640
     ttcattcaat ttgagtattt tttatcatgt tttgcattta ttataacact attattatat     95700
     ttattagtga ggagtcatgt atgaatactt ccaatagaag aatgggattg ttctatgtta     95760
     tcacaggggc gacatgttgg gggattggag gcacagtagc caaaaaactt tttcaagaat     95820
     atcaaattga tgtcaattgg cttgtaacga cacgcttgct tacggctgga atgttacttt     95880
     taatgctgca actgttcaga aaggatcgtt cccaggttat tgaggtgtgg aaacacaaag     95940
     cgtcggctgg ccagcttcta atttttggcc tattgggaat gctagctgtg cagtacacat     96000
     atatggcatc cattcaacat gggaatgctg ccgttgctac gttattgcaa tatttatccc     96060
     cagtaatcgt cattatctac acgctgttgc gaaaacaaac ggttcttacc aaacaagata     96120
     tcataactgt tgtacttgct ttagtgggtt gctttttttt gttaacaaat ggttcaatgt     96180
     ctcaactttc agtgccggca gctgcagtag tatggggagt tttatcagga ttcgcggcag     96240
     ctttttatac tttgtatgcc gttggtttat taaataaatt tgattctctt gtcgttgtag     96300
     gttgggctat gattattggc ggttttgcat tgggttttat ccatccgcca tggcaactgg     96360
     attttcaacg attaactgct gaggcgtatg catatatctt attcgtgata ttatttggaa     96420
     caatgattgc gttctggttc ttcataaaaa gcttggaaag cctctctcca aaagaaacaa     96480
     gcctactagg cagtctagag cctctatcag ctgttgtaac aactgtcgtt tggttaaaag     96540
     cgccatttgg ttcttttcaa tggattggtg ctatttgtat tatagggata actttaatat     96600
     tggctttaca taaagagcct tctatggaga gtgaaaaatc gatattaaag attaggaatc     96660
     atgcaaatcg ggatatatag gggctttttt tgcttacatg accggtccgg caatgaaaaa     96720
     cactggtgga gtttgagccc tctcggcagt atcaaaaata ccaagggttt tgacgcccta     96780
     ggtatttttt cttcaagaac cttcaatttt tcttctctga ttgaaaaacg tattactttt     96840
     ttgtgattgg tatccaaatt tcacttttaa aagatggtga tgttacatcc ttatgctcgt     96900
     tccacaatat ttctggacct tctatttgtt cgtaatttga cgatggaaac cattcggaat     96960
     aaatgcgtcc ccatacttct tgcagtgtat ccggaaatgg cccgattgat tcgaatacag     97020
     cccatgttga ggcaggaact tcaagccgtg agaagttatc tggacaccgt ttcgttgtgg     97080
     ctgcgccaat atagtgatcg agctctccgt tttcctctgt ccgaccttca gaaaaattcg     97140
     tggatgcact aatgaggcct gatggtgcta cattagatag ctcttttagt ttatttattg     97200
     ctttttcatc taaactttcc cacatagatg caatttccgg attaattcct ttgaaaataa     97260
     taggaactct ttttttaatg ccaacgatgc gaaatgcctc tttttcttca atacggtagt     97320
     tcatttcatt tcctccttta attgttagct ggaaggtcat tcgtggataa gctttaaggg     97380
     aatggccatt aaatctggct tttgatgggt ttatgccatg taaattttgg aatgcccgtg     97440
     caaaagaatc tggtgagtta taaccgtact ttattgcaat atcaatcact tttacattgc     97500
     tgtctttcag ttcaaaagct gcaagagtaa gacgtctgcg acgaatatat tccgataatg     97560
     aaatacctgc aaggaaggaa aacatccttt taaaatgata ttcagagcag aaagcaagct     97620
     ttgctgcctc ttgaaaatca atatcattag tgaggttttc ttcaatatac tttaacgccc     97680
     tattcatact tttaagcaaa tccatttatt tggcctcctt taaccaaaga ataacaggag     97740
     tgaaatgtat ttatccgaca ttctgtgcac agttttgcag gatgacttat atgaaataaa     97800
     gtaagtgatt cacttgtatt tgtacaggtt ttattgaagc atgctgttca taaaaaggca     97860
     tcaataaaag aaagttataa ttgtcttata aacggcacat tcatataatt gagtgaaaaa     97920
     ggatgcgtat catgcctatc aattcttttg aaaattatcc gatgagctgg aagccatcga     97980
     ttgataaagc tgaaaagcct atttataaag cacttgcagg gcaattggaa caggatattt     98040
     taaacggagt tttattacct ggaacaaaac ttcctccaca gcgagaattg gccgattatc     98100
     tagatttaaa tgtgagtacg atttcaaaag catttaaagt gtgtgagtta aaagggctgc     98160
     tgagtgcgac tgtagggagc ggcacatttg tatcgtatga tgcgttgtcg aatgcgtatt     98220
     tacttgagga tactaagccg acacatttaa ttgaaatggg agcaatactt ccagatcacg     98280
     cttcatatga gcccttgtta taccaactga aaaacatggt tcatgaggag gattatgaaa     98340
     aatggtttag ctatggccgg gcaggtgaaa gcctttggca aaaagatgca gctgtaaagc     98400
     tcatccaaag aggcggattt gaaacatccg ttgatcacat tttatttgca aatggagggc     98460
     aaaatgcgat tgcagcgaca ttggcgagtc tttgtaagcc tggagatcgc atcggagttg     98520
     accatcatac gtaccctgga ttaaaaactg ttgcatcatt gcttagtgtg caaatcgtac     98580
     cgataaaatc agaaaacgat gaaatgagtc cggagtcact tgaatatgcg tgtaaaaacg     98640
     aaaatattaa aggtttgtat ttaatcccgg attatcataa tccgacgact tcctttatgt     98700
     ctgttgagaa tcgaagaatg gttgcagaca ttgtaaagaa atataatctg tttgttattg     98760
     aggatgcatc gtaccatctt ctcaacaaaa atccgcttcc ggcactcgcc tcattcgcac     98820
     cgcaacaggt tattcatatt gcaagtttat caaaatcgtt agcgccaggc ctgcgtttgg     98880
     cttatgtagc agtgccgaga caatataagg agccaatatc aaaggcgctt tataatttaa     98940
     atataactgt ttccccgcta ttagctgaac ttactgctcg cacgattgta tcaaatcaat     99000
     ttgaagtctt aattgagagt catcgtgaac aaaccattcg cagaaatcaa ctcgtaaacc     99060
     gatatgttgc gggatataca tgtttaggtg ttgaaacagg catttttcgt tggttgttgt     99120
     taccgggtaa aatgtctggt gccgaatttg aagaattggc tgctcgactt ggcgtgcaag     99180
     tgtatgcggc tgaacgcttt gtagtgggaa atagttgtcc tgaaagggct gtaagggttt     99240
     ctgtctgtgc accaaaaaca cttgaagagc ttgaacaagg attaatgatc ctgagacgtt     99300
     tgctagacga tcttacctaa tattgtttgc catacaatta tgacattgta tggctttttt     99360
     gtgcgtgtta tgatgatcca catctagagg gaggtttata caaaattggc ttttagaaag     99420
     gaaggtcaga tgatgttaga caaggacagc gtaaaagcaa tagatgttca aactgcttca     99480
     ttacagagct acatcagttc accagaaaaa caaaaatcgt tatacaagcg tacactattc     99540
     gttgtgagta tctcacaaat ttttggcggt gcggggctgg cggcaggagt gactgtcggt     99600
     gcgcttattg cacagcaaat gcttggcact gatgcgtttg ctggtttgcc ttctgcttta     99660
     tttactttag ggtcagcagg atctgcatta attgttggaa gactttctca acgttatggc     99720
     cgtcgaacag gtctttcagc tggctttatg attggcggac ttggagcaat aggcgttatt     99780
     atggcagcaa tcataaatag tattttcttg ttatttattt cgttgcttat ttacggtgca     99840
     ggtacagcca ctaatttaca ggcccgttat gcaggtacag acttagcaaa tcataagcag     99900
     cgagcgactg ctgttagtat aaccatggtt tttactacat ttggcgcagt ggcaggtcca     99960
     agcttagtga atgtgatggg ggatttcgct ctttctattg gtgttccatc acttgctggc    100020
     cctttcattt tagccgcagc agcatatatg ttagcaggtg tggtcctttt cattatgctt    100080
     cgtccagatc cattagttat agcaagaaca atagaagcgg caaatgaaga gcctggtgat    100140
     aaaggacatt tggcggcaac tgagcataca gaaaacaaaa aagggataat cgttggggca    100200
     acggttatgg ttcttaccca aatagtaatg gtagctatta tgacaatgac accggttcat    100260
     atgagacatc atgggcatga cttgggtgca gtcggtcttg ttattggttt tcatataggt    100320
     gctatgtatc tcccttcact tgttacaggt gttcttgtag ataggttggg acgtaccgca    100380
     atggctattt cctctggaac aacgttgctt ttggcaggtg taatagcagc atttgctccg    100440
     ggagaatcta tgattcttct cgtcattgct ctttctttac tgggattagg gtggaatttt    100500
     ggtttgataa gcgggactgc ccttattgta gattcaactg atactgccac acgagctaaa    100560
     acgcagggga cagtggatgt tctgattgcg ttgtcaggag ctgctggcgg agcattatct    100620
     ggaatgattg tggcaggttc aagttacctc gcattatcac ttattggagg gattttgtcc    100680
     ttattactca ttccggtggt ggtatggtct aggggccgct aaagggtagg attgtttaat    100740
     ttacattaat ttgttatatt gttagataaa gtatattgca gcatctaata ttctaacgaa    100800
     ctatagttgc tccattaaat ctattataaa gatttgacca ggattcctta tagctgtgtc    100860
     actcactgca tattctttaa ttgaatcaca taaaatggtt atcggatttg aaaaaggcag    100920
     gattactcgc tttaggtaaa ggagtcataa cgttgttaaa aaggttttct cttgttattg    100980
     ttacactaat gatgtctatc gttgttgttt tagcggctgc taaagagtcg cctggagatc    101040
     atgtcatctc atttgatgaa cctattatct tgatgatctc aattggaatc gttgtatttt    101100
     tattgatccc tccattagtc atgtcctttt ttggcaattt ggttgtaaga ataatatctg    101160
     gtgtatacca atgttttatc gttttcactt ttctggggct cattccaatt ggatttctta    101220
     ttcccaatgg ctttttgaca attctagttt ctattgcagg aactttagtc agtatagcta    101280
     gtgttgccgt aaccttatgc attggcaaga ataaaaaaga tatataatca tcgaattgtt    101340
     attttttcag attgtcagtg aaataattat acaaaaagag aaggcttgtg ggccttcttt    101400
     ttttgttgtt gcatcatccc cactttgagc ttaatctatt gaataataag agaaggaacc    101460
     tatagaagaa taaaataaat accgagatgt caaaaataaa actggacttc attattgtga    101520
     attcacgtaa atgtaaaaag attggaaaga ggggaattcc ttcatgacaa atagcagaac    101580
     aaatccgaag gttgatgaat ttttaagtaa agcgaaaaag tggaaggaag aatttgagaa    101640
     gttgagaacc atcattcttg actgtgagct gactgaagat tttaagtgga tgcatccttg    101700
     ttacacatat cataataaaa atattgtttt aatacatggg tttaaagaat attgcgcgct    101760
     tctgttccac aaaggcgtct tattacagga tacagatgga attctcattc aacaaacgga    101820
     gaatgtacag gcggcgcgcc agattcggtt tacaaatgtt caggaaataa atgagctaga    101880
     aaacattttg aaagcctata ttcacgaagc cattgaagtt gaaaaagccg gtttgaaagt    101940
     ggatgttaac aaaaatattg aattgaacat tcctgaagaa cttcaaaata aattcgatga    102000
     aatccctgca ttgaaaattg cttttgaagc tttgaccccg ggacggcaaa gagcgtacac    102060
     tctttatttt tctcaagcca aacaatccaa aacccgagaa tcgagagtcg aaaaatatgt    102120
     gcaaaaaatt ctcgatggaa agggattaaa ggattaggca cgccaaggtt caggctaaag    102180
     gaatagcatc atagcgtaat aagatcattt ctatagaaga aaaacaagca tagtaagatg    102240
     cttgtttttt cttaggacaa cattcactta ctgctgaaat gcttctaaca ttgtatgcca    102300
     ctagacagcg ttataaaata ttaatgcaac acctagaaat ctatccaatg aaatagctca    102360
     atggtatggc tcattacatt tagaatgcct aggagaacta atagaaccgg aagattttta    102420
     gcaagttact acactccaaa ctttgttttt gtattaatat accttattaa ccattgtttt    102480
     tagtcaggtg cagacaaacg aatactgatt aatgaatcat catgatatca atgagccgct    102540
     tgattttttc atcgtcgcct gtatcaacgt acactgtttt tctgtttttt atgatactct    102600
     cagtcacttc ccgcatgacg cctttttcta tatcatcagc ggaatcccag cgtaaaggca    102660
     cattatatac atgaattgtg ccatccccat tgccatgata agtgactgat ccatccacta    102720
     aacgagaacc tgccaactgg gtcacatttt ctggatagct ggcacttgta tcatcattag    102780
     gattaattgg ctcgccagcc gcaatatgtc gaacatttaa ttcatctatc tcttgattag    102840
     gtccaagttg aagccaaact ctggcatatt caattttttc cgaagagtat gctgccaata    102900
     cattgtcttc tttgcttttc tcttctgctg aagaggtatc atttgcagct tttgttgcgg    102960
     attcttctga ttctgttatt ggctccgctt catccttgcg tattttggtg ctctcttcag    103020
     gctcagtgtg tttttcgtca gtttgcacag cagaagcttg atttgaaggt tgttgtgctt    103080
     ctccatcctt actgtccgta catccagcaa gcaaaatcat aagcagcagg gcagtattgc    103140
     aataacatat ctttctgcgt ttcttcattt tttcattcct ctctattaat tcaggtcagc    103200
     ttcatatata agtttatgta tctaaatatt accatggaat agataggatg atattgaaaa    103260
     ctgtttaaga agaggaaacg atcttgaata gcatcgcgaa aacctaagaa tcttaagaag    103320
     ttttgcccct ttttcttcag gtattgaatg taaagtggga tataaatgca aacaaaaacg    103380
     aaatgcctta tccacctcgt gtcatggcag aaaaagtggg ggatttatta gagcggattt    103440
     gataatggcg gcaggtaaat gggtgttgac ttatatgtct aagcgggaga ctcaagtctg    103500
     ctcgatcgca tacaaaatac caagggccag caacccttgg tatttttata ccttcatgca    103560
     tttttgaagt ttatgcttaa aggtctgcct tactttgcaa atcgccgagc tgctgcaacg    103620
     cacatgataa cggcgatatt cactgctacg agtgcccagc ccactttctc gtgcagaatc    103680
     actgaggcaa gcagcagtcc aaaaaaaggc tggagaagct ggagctgccc aaccgctgca    103740
     attccccctt gggcaagacc tcgataccag aacacgaagc caatcagcat gctgaataag    103800
     gatacatatg caagactgag cagtgcggga acgccgatcg ccgaccatga gtccggcgta    103860
     aaaaagaacg acaatggcag cataagagga agcgacagaa cgagtgccca tgagatcacc    103920
     tgccaattcc ccagacgccg tgaaagtttg gccccttctg cataaccaag accgcatacg    103980
     acaatagaag ccagcatgta cgcgtcgcca agcggggatg aacctccccc ctgaatgagg    104040
     gcgaaacctg ctactaacaa gctgccggca gctgagaaaa tccagaagac ggggcgaggg    104100
     cgttcacccc cgcgcagtac gccgaagact gccgttgcga gtggaagaag tccaatgaag    104160
     acaatggcgt gtgcggatgt gacatgctga agcgctaaag ctgtcagcaa cgggaaacca    104220
     atcactacgc cgaacgctac cactaacaat gaaatgagat ctcttttggc aggatgctgc    104280
     tgccggaaga tgagaaggag acctcccgcc agtacaccag ctatcgcagc acggcaaact    104340
     gtgagaaata acggatcgaa gtctgacaca gccaaacggg tcgcaggcag cgagccgctg    104400
     aaaatgagta cgcctataaa accatttatc cagccatttg ttgttttgtt cattataatc    104460
     actccacata tctttcttgt tcattgtctg tattttctta acaaaaccag cagctaagga    104520
     ttacaatgac tataaactgg aattggcctt ttataaacag ccagttttca taaaaaaatg    104580
     cataccagtt aggagaacaa cgcgcaaatg gatatcacgc cttttttgaa tagaactctg    104640
     gatattccgc tttatcagca gctttatcgg tattttaaag aaaatatgca tcggggccgt    104700
     attcaaaaag gaatgaagct tccttcaaaa agactcctgg cgaatcagct ttccatcagc    104760
     caaacgactg tagaacgtgc ctatgaacag ctcgctgctg aaggttatat tgtgagcaag    104820
     ccaagaagcg ggtggtttgc tgattatcat gattctgatt ttgcttatga tagaatgcca    104880
     agcacaacac ccattcaaca agaagcagaa gaaaataaac aatggattga ttttcattat    104940
     gggaatgtag attcttctta cttccctttt tccgcatggc gaaaaagcat ggtcaatagc    105000
     ttagaccaat atggacacga gctttatcgg ccgggacatg ttttaggaga gtttgagctg    105060
     agaacactca ttgcagagta cctgtatcaa tctcgggggg ttcattgcgg ccctgaacaa    105120
     gtgattatag gtgccgggaa ccctattctg ctgcaaatct tgtgccaagt ttttgagccg    105180
     aatatttcta tagggtatga ggatcctggt tatccaagag cacgcaagat ttttgaagcc    105240
     aaccgcatga atattgttcc tataccagtc gatgatgagg gaatctgtat acagaagatc    105300
     aaagaacagc agccaaacct tgtatatgtc acaccttccc atcaatttac gctgggaacc    105360
     ataatgacaa taaacagaag aattcagctg ctcaaatggg cggccgaaaa tcaatccttt    105420
     atcatagagg atgattatga cggggaattt aggtacacag gacagccggt tccttctctg    105480
     caagggcttg atcagcataa ccgtgtcatt tatatgggca ctttttctaa gtctcttttg    105540
     ccctcgctgc gtatcagcta tatgattctt ccttcgcctc ttttaaaaaa gggtcatgaa    105600
     atcacgtcct tatataagca gacagtgtcc tgccacagtc agctaaccct agctgaattt    105660
     ataaaaaatg gagagtggca aaaacacatc aacagaatga gaaaacttta ccgcaaaaaa    105720
     agagccattg tattagaggc agtgcaaagg gaattaggag agcatgtcag aatccgcgga    105780
     gaaaactctg ggcttcgtat cttacttgac gtttatttgc catttggtga aaaagagtta    105840
     attgagaagg cgaaaaaaca tggagtaaaa atttatcctg tttctctttc ttatcaacat    105900
     catcctccta caaaaacggt ctcgctcggg tttgcagggg tttctgaatc cgacataaga    105960
     gaaggcataa aaaaactgaa ggctgcctgg aagatatgag ggagctttca gtttagcaaa    106020
     acggccaagt gacgactaag tgttgagagc tgttcaatat tttttaagta tatgatgagt    106080
     gcctgcagtc caggccacga tacgtctgtt tagcgaaaaa cagaattttt tatttgctcc    106140
     tcacagtgct aaaataaaca aaatagacaa ttgaaaaaat agaggtgtaa gaatgaagtt    106200
     agatgagttt acaattggcc aggtcttcaa aacgaaatca ttaaaagtat caaaagatga    106260
     tattatgcgg tttgcgggtg aatttgaccc tcagtatatg catgtagatg aagaaaaagc    106320
     gagtaaaggc agatttaatg gaattatcgc ttccggcata caaacactgg ccatatcttt    106380
     taaactttgg attgaagaag gtttctatgg agacgatatt atagccggaa cagagatgaa    106440
     tcatatgaca ttcataaaac ccgtatatcc ggatgatgaa ttgtttacaa ttgttgaggt    106500
     tcttgataag cagccaaaga gaaatgaatt gggaatactc acagtattgc tatctactta    106560
     taatcaaaaa gaagtaaaag tgtttgaagg tgagttatct gtattgatca aacgataact    106620
     cagaaagccc gcttttcgcg ggctcgattg aagcagatgg gtgaaagatg ttagcgggtt    106680
     tcctttgaaa aataagaggt taaaacatca taaacaatag gcaaagaagt aaatccctca    106740
     tcttctagaa aatgacctcc gtgctgaact tcatataacg cagcatcaat ttgttgtgcc    106800
     agatccttgc tgaatgaaaa aggcacaatt tggtcgtcct tagaagcaat gacagcacgg    106860
     tgcttcgcgg actcgatgat tttttgatga tcaaacgatc cctgtgtaaa ttcatctaac    106920
     atctgtaaag tgggcaatga tttggcaaag ccggaaacaa gtatgattcc gccaagctgt    106980
     tttcgtaatt gaagatgttc caaaaatctc aaaatggcgg ggcaacctaa gctgtgcgca    107040
     accaaatacg tattttcatg taaagtgtgc tgatataaag agagtgtatc cagccaatcc    107100
     tcaagtcttg gctggagcgg attaggcatg tttaaaatgt ctgcttggac cccatctgcg    107160
     agcagacgtt ttttcagcca agggaaccaa tgatttgttg aggaggctct gtagccatga    107220
     atgatataga cttgttttgt cattatttcc tcctaagaaa tattttcatt cagtataaaa    107280
     ttcctctcat tgggaaacaa gtacgcactt ttttgtaagt agctttacat atgaggccct    107340
     ccttgtgcca ttccccactt acacatctca tctatgaggg gatacaaaga tcgccctctg    107400
     tcagataacg aatactctac tttcagtggg gtgtgagaaa cctcagaccg atgaataagg    107460
     ccgtcagttt gcaattcctt aagctgtgcg cttaacattt tatgggtgat gaaggcatag    107520
     cccttttcag ctcgccgtat ctcatcgttt tttcacaccc taactcatag agaattctca    107580
     ttttccattt gccccctata agagataagg tgtattcaaa tggggcttgt ttactgcggc    107640
     acaggctatt cattgtaatc aaacctcctt ttttaagtat catatcagaa taaattagga    107700
     ttttcggtgt tgaagtttga gggcgattca cgatctgaag tgaaaggggc cgcttgctca    107760
     acaggcggca cggtacatga atgttctaag tcaaagaggg ttaccttact gttagttact    107820
     ttatttaaaa aaacgcatgt ttttagctga aaatatctat tatggtatat ttaaatataa    107880
     agaaatattt gagaaatgag gaatggtatg aatacaccca aaaaacataa gaaatttaaa    107940
     gcgaaaatga ttctccaaat catcatggtt atcattggag gaatcatagc ggcatatgga    108000
     ctagaaacag tgctcattcc aaacagtgta tctgatggag gggtgacggg tcttagcatc    108060
     gttggttcac agctattcaa cttgccgctg gggattttga ttgctgtgat caacattcca    108120
     tttgtctggt taggatataa gcaaattggg aaaagctttg cattattatc aattatcgga    108180
     atcgtatcgc ttgccgcggg gacaagcttt ttccaccaca cacccgctat catagaagga    108240
     gataccctgt taattaccgt tgtcggcggg attatccttg gattcggaat ggggctggcg    108300
     ctgcgtaatg gcggcgcatt agatggaatt gacatgcttg ctgtgctgct atcccgaaaa    108360
     ctgccattcg gaacgagcga tctcattcta ttcttaaacc tatttgtgtt tatttttgtt    108420
     tccacagtat ttggcttaca aggggcattg ctttcagtca ttgcttacta cattgcatcc    108480
     aaagtgattc atgttgtgga ggaaggctta agcggctcta aaacctttca aattattaca    108540
     acccaacctg aattaatggt agagacaata cgtgatcaat taggccgaag cgccacatat    108600
     aaagaagctt acgggggttt ttcccacgag aaatttaaag aaatcacatg tgtcatcaac    108660
     cgtttagaag aaaccaaact aaaggaaatt attaatgata ttgataaaac tgcctttgtt    108720
     accgtgtatg atgtagctga agtgaagggc agcaatttta gaaatcttaa tcatcactaa    108780
     aaaatagaat gaccttttta accgtaactg acatgccgcg ggtaatttaa tcaaaaacac    108840
     ttttttgagg cttgtgggtg aataaccggt gaaggtctga atcacagaaa taccaagggc    108900
     gtcaaaaccc ttggtatttt ttctggttat tagattttat cttcagcttt acgtgctgct    108960
     tcgagcttat caatcctgtc tttatatttt tctccccagt ccttcatgtg caggataaca    109020
     ggttctaatg ttcttccaaa ctcagttaaa gagtattcga cttttggagg gacctgttta    109080
     taaacctcgc ggtgaatcac gccatcccgt tccaattctc ttaattgtag cgtgagcata    109140
     cgctgggtaa tttttgggta tagttttcga aactcattaa acctcttttt accgtcaatg    109200
     agatgataaa gaagaatgcc tttccactta cctccgatga tatctaatgt tgtctccacc    109260
     ggacatcctt caaagtcatc agaagaataa tcaatgccga gtttacgatt tctcaagctg    109320
     ttcactccta atagtatact ttttgatact atatacattc aatgtgcgta ctttttatat    109380
     tttaatatac atcatataat gatgtcacat ctaaggaatg aaaggaatgg atcatatgaa    109440
     aacactcgta ctcgttgtac atccgaatat agaatcctct cgtatcaata aaaagtggaa    109500
     agaagccgtt ttaagtgaac cagatgtaac tgtccatgat ctttatgaaa aatatcgcga    109560
     tcaaccaatt gatgtggaat ttgaacaaca gcagctcctg gcccatgacc gtatcgtttt    109620
     tcagtttcca ttatactggt acagcagccc accgctttta aaacagtggt ttgatgaagt    109680
     gtttacgttt ggctgggctc atggtcccgg cggaaataaa ttgaagggga aagagtgggt    109740
     aactgccatg tccatcggtt cacctgaaca ctcttatcaa gccggcggat ataacttgtt    109800
     ttcgataagc gagctgacaa aaccgttcca agcatctgcc catttagtag gcatgaccta    109860
     tctgccttcc tttgccgaat atcgcgccaa tacaatcagt gaccaagaaa ttgccgaaag    109920
     tgcgaatcgg tatgtaaagc atattacaaa tatagaatta aacccgaagg ttcgcctgca    109980
     aaggtatttg aaacagctgg agagtgtcga tttaacataa agattgattt ttgaaaatcc    110040
     tgtactcacc aagcaggatt ttttcttgtt cagcagaggg attttaacat atagcaaaaa    110100
     aagaagaagc caccaaaaat aagctatttg cttggtcctg actgcttatt tttggtgaaa    110160
     tacttatttc tctgtgatga aataaagcaa agcgatgacc ggaaaagcga ttccaatcca    110220
     taatgctgta ctccatccgc ctgaggcata tgcccatcct ccaattgatg accctatcgc    110280
     accgcctaga aagaagatcg ccatgaataa tccgtttaat cgactgcgaa tttcaggcgc    110340
     caacgaaaaa atagcacgtt gactgagcac aaggtttgca gatacaccca tatctaacag    110400
     aatagcagcg gccactagaa ctgttatacc gacgggggag ctgctctgaa tcatgagcgg    110460
     cagtaataaa gagacaacga caacaccgag agcgattcca gtggcaagcc tggttaagcc    110520
     tcgatcagcc aggcggccgc ctattggtgc agtgactgca cccgcaatgc ccaccaatgc    110580
     gtagagtgct attgccttct gagaaaaatg aaaatcagga ccggacaata ataaaggaac    110640
     agttgtccag aacaagctga aagctccaaa tacaaacgca tgatagatgg cacggcggcg    110700
     taagactgga gtcgtgcgca gcagcttcca cattgaaccg agtaaggcag tatagtttgt    110760
     atttgctgtt ggttttctgg caggaagcac ttttgataat acgatggcca ggataacact    110820
     taccacggcg gacaaagcga atattgcatt ccacccccag atatcagcga ctagactaga    110880
     tatcggacgg gaaagcataa taccgagtaa taagccgctc atgacattgc caacaacccg    110940
     gccgcgtgca gcgtctgatg caaggtatga tgcaaatgga acaagcactt gggctgcgat    111000
     tgatcccaat ccgacgaaaa acgcagctgc taaaaacagt gttccatgct tcacaaatgc    111060
     tgttagtgtc aaagccgctg cgcttagaag gagcgataca acaataagtt ttttgttttc    111120
     gataatatct cctaaaggga caaggaatag taagccggca acgtatccga tttgggtgag    111180
     tgtgacaatc aatccagcac cgcttggaga aagtccaatt gccttactaa ttaatccgac    111240
     caagggttgt gcatagtaaa gattagcaac aatgataccg catgcagttg cgagaagaag    111300
     ggttaaactg ggtgaaatcc tctgacctgc ttgtttgttt ccattagcca tatgaatgaa    111360
     ctccttttta agtggttttt tgagtgtaat catgacttct cacaagtgat tttataaact    111420
     gaacgttcag tttcgtcgat taataaaaat aatatactaa acgttcagtt ttgtaaatgg    111480
     atttctgttt tcttttttta ttcaatttaa gtatactgaa cgtatagttt atattgcggg    111540
     aaggaatgat ttatgtgcag agtaaacgag ggcggccgcg tgatgaagga acgcataagg    111600
     cgattctctc tgcagcctat gacctattgc tggaaaaagg cttcgatgcg gtgacagtcg    111660
     ataaaattgc cgagcgtgcg aaagtgagta aagcaacgat ttataaatgg tggtctaaca    111720
     aggctgccgt tatcatggac agctttcttt cgaccgcgac ggacaggctg cctgtgcctg    111780
     atacagggtc gtcagtacaa gatatagtaa cccacgccac gaatttagct aggtttttga    111840
     caagccggga aggaaccgtt attaaggaat taataggtgc agggcagttg gatgaaaaat    111900
     tggcagaaga atatcgcacg cgatttttcc agcctcgccg cctccaagcg aaaggccttc    111960
     tagaaaaggg aattcagaaa ggtgaattga gagagaatct tgatattgaa gtaagcatag    112020
     atctcattta cggaccaatt ttctatcgtc tgcttataac aggggatgag gtgaatgatt    112080
     cctatgtgcg tgatttggtg atgaatgcgt ttaagggagt tcaagctacc tctgctacag    112140
     agagtatgta gctgataaga actgcaaaag ctgcggatta tatgacaaat tggttccatc    112200
     gtacagtgaa atataagatt tttgttgctg agcggaatca tcgagggaaa agttctctta    112260
     tcggatgtcg aaaaagaagt cattcaatcg tgaatacata acatcatatt attacattcc    112320
     ttttcatcga ttggaacaag ggttctatac ttcaatggaa taccgcaaag ttggagtatt    112380
     taaacaacag gggaaaatcg atggccatta tgtaggtgtc atggcaatgg aaaaaatact    112440
     tgcaatgtaa acaggcctct aaagagacct gttttttaat atccagatga ttgtctagtt    112500
     tcagcttggg ctctatgacc actcccataa ctgaaatagt ctaatattta taccagaagg    112560
     gattgtttat ataaataaaa gtttatataa tgacgggggc gctaaggaaa cgcggggagc    112620
     gactcaggtt ttcgtttcaa agttttgatc cttaagatat acggagcgct acatatggaa    112680
     acgtaaaggg gaatgtataa tcatttggcg tgtatataac gatttgctta tatattgatt    112740
     tgggaaggag gagctcatat gacgattgat gttgcggcga tgactcgttg tttgaaaaca    112800
     cttagtgatc aaactaggct tatcatgatg agattatttc ttgaacaaga atattgtgtc    112860
     tgtcaattgg ttgatatgtt cgaaatgagc cagcccgcca taagccagca tttgcggaaa    112920
     ttaaaaaacg cgggttttgt gaatgaggac agaagaggcc aatggcgtta ttattcaata    112980
     aatggttcct gtcctgagtt tgatacattg caattgatct tacatcaaat tgatcaagag    113040
     gatgaattgt taaaccatat caaacaaaag aaaactcaag cgtgttgcca gtaaggaggc    113100
     attagattga catcaatgat tttggcagta ttcatctttt tattaactct agtattggtc    113160
     atatggcagc cgaaaaattt atctataggg tggtcagcct gtggaggcgc agttttagct    113220
     ctaatagcag gtgttgtcaa ttttcatgat gtgttaactg tgacagggat tgtttggaat    113280
     gcgaccttgg cttttgtggc catcatactg atatcgttaa ttcttgataa tatcggtttc    113340
     tttgaatggg cagcgcttca tatggctaag gctgcaaaag gatacggtgt gcggatgttc    113400
     gtttatgtat ctctattagg agctatcgtc gccgcgttat ttgcaaatga cggtgcagct    113460
     cttatattga caccaatcgt attagcgatg gtcagagcat tacattttaa tgaaaaatta    113520
     gtttttcctt ttatcattgc cagcggattt attgcggata ccacttcgct tccttttgta    113580
     gtaagcaatt tggtcaacat tgtttcagcg gactattttc atattacgtt tattgattat    113640
     gcatccagaa tggttgtccc gtacctgttt tcgctgctgg cgagcatcat tgtactttac    113700
     cttttcttta gaaaaagcat accaaaacgc tatgatctga ctgaggttaa aaaacctgtt    113760
     gaagcaatta aagatcaaaa catgttcaga ctgtcatggt atatcttagg gctgctgtta    113820
     attggatatt ttgcaagtga atttttttct atccctgtat cagtggtagc gggcagcatt    113880
     gcaatcattt tcttaatcgc tgcgcaaaag agtccggccg tccatacaaa gaaagtggtg    113940
     aaagaggcgc catgggctat cgtattcttt tcaattggca tgtacgttgt tgtgtatggt    114000
     gtccgaaatg ccggattaac ggatgtcctt tcagatgtga ttcaagccgc agctgatcaa    114060
     ggattgtttg ctgggacaat tggaatgggc tttattgcgg cgattctttc ttccattatg    114120
     aataacttgc cgactgttat gattgacgca ttggccattg ccggtacaga tacacatggg    114180
     atgatgagag aagcgcttat ttatgcaaat gtgatcggtt cagatttagg gcctaaaata    114240
     acaccgattg gttccttagc gacattatta tggcttcatg ttctttcgca caaaggtatg    114300
     aagatttcct ggggcacgta ttttaaaaca ggaattatcc tcacgatacc cactttattg    114360
     atcacacttg tcggcctgta tatttggctg ctgataatcc attcttgttt ctaaaaggac    114420
     aaggtcacta tatcaaggaa aacaatgcac tggtaactct tgccgcagcc aaatggctga    114480
     agggtggggg agaaaatacc ttggggctaa gtggaatgtg tacagcgcag gaatcgaagc    114540
     tcaaggatga catcgagtgc tgtcaaagca atgaaagaag cagggattga tatttcaaat    114600
     caaacatcgg agaaatttga tgatccggca aaagcacacg gaacagaaga agtgtttcca    114660
     aagggtccgt gatgaaattg gtgaccgttt aaaacagttt gctgtaactg gggaataaag    114720
     aatcgatata ttcagcgttt tcttgggtta tataatacaa tgtgttgttc aacaggtgtc    114780
     tgcgagctga gtgcagacac ctgtttttgt ttttatttgt ctgagattcg taacagggaa    114840
     gttatttagc tggtgacaga ggaaaattga tttgtgaaca gaatcatgaa ggagacggtg    114900
     ttttaaagga gttgtctgtt ttgcaggaat taacaaaaaa aaaatacagt agcttaaaaa    114960
     caatgtttga tgacaaatat tgtcccacat ttgtctattc aatattagac caaaccattc    115020
     cgggagctgt ttatgcagat gatcaaacct ttcctaaatc gttttttata ggaactgaat    115080
     caggcattta ttttattgcg ggagaccaag ggaatcggga ttttcatgat ttcattgcag    115140
     gatattatga agaacaagtg aaatcatcaa aacgatttac cttgttttct tccagtgata    115200
     catgggatag cgtactgaaa cccatactga aagatgactt aaaccaaatg agaagagctg    115260
     cattttctta tcaaccaaaa tctttcaaaa agactttgca actgccaaag gggcttgtat    115320
     tgaaaagaat tgacgaagac atcatttcac atagcacagc gtttaacagc gcgtattatg    115380
     aggagtattg gaattctgtc tcacagtttg cttcaaaagg ttttggattt gccgtattac    115440
     atggcaatca cgtagtaagt gagtgtacct ctatattttt agggcataat cgagcggaaa    115500
     tggatatcta tacacttgaa gaatatagag gactggggtt agcttattgc gtagcaaata    115560
     ggtttatagc gttttgtatg gaaaatggga ttgttcctag ctgggattgt gatatttgca    115620
     acaattcgtc cattgcatta gcagctaaac tagggtttaa gacggtaacg gaatacacta    115680
     tttactactc tggctaacct taatgaaaga accttaaaag gagataccaa ccgatgttgg    115740
     tatctttttt gttttagagt ttttttaccc ttttagcaga aaaatgggtg atgaaaatct    115800
     tattcatttt atttactttt aggtaggtaa aacatacccc gccaactgta accactccgc    115860
     ctagcagaga gagcagtgtg ggtatctcgc cgatccagag ccaagatatg atcaaggcta    115920
     aagccggtgt aacataaagt gaaagggttg cttctgaagc accgacgaat gaagtgacat    115980
     atgctagtgc gaagtaagga ataaccgtcg gcaataatcc taagtaaacg atagacaaag    116040
     ttgcgcttat tgaagcgttc atcatctctt cgcctaagcc tggcagaaac acaagcatag    116100
     gtattgttcc gccccaaatg gtgaatgtaa cgaatggaat aaaaccatat ttttttatat    116160
     agcgggcttg aaaaacgaaa taaatactct ccgaaaatgc tgccagcagg atgaccaaga    116220
     taccgctcat tgaatatgta aagtctcccg ccccaaatgc aatcaataat acacccaata    116280
     aactgatcat agagccaagc catttcgtaa atccaaaatg ctctttataa aacaggcggg    116340
     atagcatggc tgagaagatc ggtgccgtag taacgagtaa gcttgcaact ccggcactaa    116400
     ctgttttttc accgatgttc agcaaaatgt gatagaatgc aaatcctaaa aaccctaaaa    116460
     gaaaaatggc aggaatgtct ttcaagtcgg gtaggcgcat ctgagtcaaa acagcaaaaa    116520
     gcaataatgc catagagccg attaacaaac gaaataaagc aaggtgttct ggcgtgtacc    116580
     cttcaagtcc tgcgcgaatt cccggaaaag cagatgccca taaaccaatc atgagactat    116640
     gagatatcat tatttgaact gttttctttc gcattcctct cactcctctt tacaaaaacc    116700
     aaccagttat ttaatgtgtt tctatactaa taaagatttg atgatatggc ttcaaccagt    116760
     tcaatagatt ttgacccaac caatttattt taaggagacc gattctatga gctttccaga    116820
     agaaaaaaag atgaaaaagc tccctaagta cagacaaatc gttcatttta ttaaagagaa    116880
     aataggaaat ggagagtggc cgattggaag caagattcca agccagcgca cgcttgcaaa    116940
     agattttcag gtaaatcgga gcacagtgat tacagcgtta gaggaattga tggccgatgg    117000
     gctaatagaa ggcacaatgg ggaaaggcac agttgttatc aacaacacat ggacactgat    117060
     ggctaagaat tctgctcccg attgggatca atatgtcacc tctggcattc agatgccaag    117120
     ccgaaaaatc gttcaagaga taaatcaatc agaatcaaat acagacctta tacagctcag    117180
     taaaggtgaa ctttcagctg agatttttcc tttggctgtt atgaaagaga tgatggggaa    117240
     ggtatctcaa cacatggagg cattcggata tgaagaacca aaaggttact tacctttgag    117300
     ggaggcatta agcaactatt taaaaaccat tggaatcaac gtctcatctt cttccattct    117360
     gattgtctca ggagcgttgc aagccttgca gctgatatca atggggctgt tacaaagagg    117420
     atcaaccgtt tatcttgatc agccctccta cctttattca ttacacgtat ttcaatcagc    117480
     tggtatgaag ctgactggac ttcctatgga taatgaagga cttttgcctg aaaatgttca    117540
     tttaacaaga ggagagcggg gaagggctat cttatataca aatccatgtt ttcacaatcc    117600
     gactggtatt cttatgtcta aaaagcgacg ggaagaaatc ctagcagtaa gtgagaatac    117660
     acagcttcct attattgaag atgacattta tcgtgagtta tggatcgatg aaattccgcc    117720
     atatcctatt aaaacaattg ataaaaatgg acacgtactg tacataggaa gtttatcgaa    117780
     aacattaagc ccaggtttga ggattggatg gatcgtcgga ccggaaccgg tgattgaacg    117840
     tttatctgac attaaaatgc aaacagatta cggatccagt tcgctatccc agagagtagc    117900
     ggcagagtgg tttacttccg gccactacca gcagcatgta gaaaaggtta ggcagcaatt    117960
     aaaggtgaga agagaattgg ccttgagtgc tttagaaact catttgaaag aagtggcgac    118020
     atggaatatc ccaaaaggag ggttttttgt ctggataaaa atattgcctt ccatatcaat    118080
     gaaattactt tatactaaag ccttatcaaa agggattctg atcaatctcg gcagtatcta    118140
     tgctcaggaa aaagggaatt atattcgctt atcatatgct tatgcatctc ttgaagacct    118200
     tcaaaagggg atttatgagt tgggtttaat gattaaagaa ttggcaagca ggtaactttt    118260
     atatccttaa atggatgttt cactaaaaaa gagatcaagc ctaatgatcg cttgatctga    118320
     taataacaag ggttactaga atagaccaaa tcatggttcg gtcttaaaat aatcatgtct    118380
     ctgaacgaaa agtctttccg acttctcttc ctaaaccaaa gtagtgtctg aaattataga    118440
     taagcgggct ccatttggaa gggttgatat ggttttcgtc cagaatgata ctttcctcgg    118500
     catgaaaatg tagtgcctgc gtctctacaa ttgcgaatga cgattcatat tctggaagcc    118560
     gaatgtgttt cacttcggct tcgatttgga tagggcattc tttaattcgt gttggtgata    118620
     ctgtttttga ttgtaaaggc gttaaccctg ctgcctcgta tttttctttt ttatatgtaa    118680
     atccgatctg cttctttaaa ggcggtatac tcttttttcc gctataagat gaaattcttt    118740
     caacgttttc ccataaatcc gggccaggca agtttatgac acactctttg tgtctttcca    118800
     aattgtcgat ggcttttcct cccagtccta ctccaaggat tatataatgt ccaagagccc    118860
     aagaagaaga cataggacta atattagtgg ttccatcctc attcaatgtg gttagaagaa    118920
     atgtcgaggt accataatac atgatcttgg gtttgatttc cttaaatcga cgagtgtctt    118980
     gttttttgat gtccaacgtt ttttcctcct tgtcacgctt acatttatat tgtaaaggat    119040
     taacatttca actatcatcg aaatatgaat gtaaggagga aaatcatgaa tcctaatatt    119100
     gcaaaaatct cttcgttgct atcagatccc tcgcgttctt ccattcttct cagtctgatg    119160
     gatggaagga tacaccctgc gggagagctt gcatatctcg ctaacattaa acctcaaact    119220
     gcaagttttc acctgaataa attgcttgaa gcaaagctga ttagcgtaga gaagcatggg    119280
     agacatcggt attacagatt ggctgactca gatgctgcaa atgtgatcga acaattgctt    119340
     catattgcgc ctaaagcaaa agtcaaatct ttaaaagagt caaaagagaa aaaggacttg    119400
     catttcgccc ggacctgtta tgatcatttg gcaggttatg tgggcgtgca aatggcacat    119460
     tcactagttg agcaggggat gttaaaaaaa gttgatttaa actttgaggt gacttcagag    119520
     ggtgctttat tcttttcgaa gttaggcatc aatgaagagc aacaacggaa taagaggaga    119580
     gcctttgccc gctgctgttt ggattggagt gaacggcagc atcatattgc aggagcatta    119640
     ggaaacgccc tattggtgcg catgttagaa gaagaatgga tcgttcgtat gcctaaaacg    119700
     agagcgatta ggattacaca aagcgggaaa atcgcgtttg aaaagcacct aaacgtgaag    119760
     atttaggatt ttgaagcgga aacatcagat gatgaggcac gatatctagg aggagtaaga    119820
     tttgttctaa tcttactcct tcttcttatt ttgaagcagc tcgattcccc attgcaatag    119880
     agatgcggtt ccaactgttt atttgattaa tgatcagaac aaggtcaaca tattgttcct    119940
     catcataatg ttcccgcacc cgatgatata gctcatcagg aaccctttta gatggaatga    120000
     gcgtgatgtg ttcagatagt tcgagagccg ctttctcttc aggtgagtaa aaatcacatt    120060
     cattccaagc atgtaaacag taaattcgct gttcagtttc tcccattttg cgggcatcgg    120120
     acgtatgcat atctatgcag aaggcacagc cgttcatttg agagactctg attttgatta    120180
     gttctctcgt cgttcggtta attgaggatt gtttcgtgta tttctccata tccatcatga    120240
     ttttcatacc ttcaggtgca atctcatagt aggacactct ttgactcata aagcaagact    120300
     cctttccata gaatacctag attgtatccc ggtattgatc attttaccaa tgtgcggttt    120360
     gaatgacagc tgtttcagcg tcttttggaa agaagcttct ttgaataaaa ataagggtag    120420
     ccagcaatga tgagtggagc tgctaatgca agcagtatcc atgagcctga ttggctgtct    120480
     ctagtgactc taatgaatat ataagtaccg atcagaaaat ataataaagc acctagaaac    120540
     caatacatgt tcattcctct ttttccttgc tttttggttg cgcatttttg tctgtcatat    120600
     ggcttaatcg atcagggttc tgatttttta ataccttttc ggtccggatt ccttttctct    120660
     ttaatgataa aattgtgaga tcaatcgatt tcaatgatga tcattccttc aatgaatagt    120720
     aagttcctta tgattttaaa ggtaaatttg aaaagataaa acgtacatag aggcagaacg    120780
     ttcatgtacg tttgggcaat gatcacttgt tggaaactct aatgtttccc tgcacctgat    120840
     attgttgtgt tccttctctt cctataaaat gattggatac atgtatgttt gcacgttgaa    120900
     atatgggttc gattttcatg aatctctatt cggtgaaaca ggtaaaggaa gtggataagg    120960
     tttgcttata aggaatcctt ttaaagataa atattactca catgataggc gggcattaaa    121020
     catgcttgca ctcagagtgc cgggcctggc ttttattctc atgatctata tagcctctat    121080
     cgtgctgcaa tttgtttctg ggggctggtc cattttattg ctttatgcgt ttaccatatt    121140
     aatcgccatt tttgctttgc ttcattggca ctcatatcgc tgggttaaga aaagagtgat    121200
     tctgtatttc gcggtacaag gtttgatcac ctttgcactt gctaatctca tgactggctt    121260
     ctttatactt gtgattatcg gcctttatgc atttttaatt ggacaaatta taggaatggc    121320
     agacagaaga aggacttttc tcattcttta tctattgctg ctgctggtca taaattcggc    121380
     gtatcacctt cataaaggtg aagttttgca ttttattgtt attgctgcgc cgatcatgat    121440
     tgtcatcatc acttatgccg caacattttt tgcccaagtc gatgaaaaaa taaaagctca    121500
     attgactctt gaaaggctgg agctggctca tcagcaggta gaacagctga cgctgcagaa    121560
     cgaaagacag cggatggccc gagacttaca cgatacgctt gctcaaggtc ttgtcagttt    121620
     aaatatgcag ctggatgcga ttcatgttca tctcgccaaa ggcaacacag agagagcgaa    121680
     ggaaatcata caacaatcga tgaaaagagt gaaaagcaca atagctgatg cacgttcagc    121740
     tattgacgat ctccgcagca aatcagaaga aatcggtgtt ttaaaagaaa gaattacctc    121800
     gctaatggat cattttatag agtcgacagg catggcttgt ttattagatt acagattgca    121860
     tcaggtgctg gatgtgcgta cagctgaaaa ctgttattac atcattggag aatgcatgac    121920
     gaatgcggca aagcatgctg aggcgaaaac aatctggata tccatttggg atgatgaaaa    121980
     gggaaggctc catttaacag ttaaggataa cggcaaggga tttgatgttg aaaaaggaaa    122040
     gaaaaagaga ggacattatg ggcttcttgg catacaagaa cgcgtcaggg caataaatgg    122100
     ccaattcaat atcaagagta caaaattgaa aggaacacaa attgagatca ctgtaccaat    122160
     tcagggagag atgcaagatg aataaggttt taatcgttga tgaccatctt gtcgtgaggg    122220
     aaggtctgaa gcttttaatt gaaacgaatg atcaatacac cattatagga gaggcggaaa    122280
     atggaaaagt agcagtccgt cttgcagatg aattagaacc ggatatcatt ctgatggatt    122340
     tgtatatgcc ggagatgagc gggttagagg ccattaaaca aataaaagaa aaacacgata    122400
     cccccatcat tattttgact acatataatg aagatcactt aatgatcgaa gggattgaat    122460
     taggagcgaa aggatatctg ttaaaagata cgagttcaga aacccttttt cacacaatgg    122520
     atgcagccat cagaggaaat gtgctattgc agcctgatat ccttaaacgt ctgcaagaaa    122580
     tccaatttga gcggatgaaa aagcagcgca atgagacgca gctgacagaa aaggaagtca    122640
     ttgttctaaa agcaattgct aaaggtctta aaagcaaagc gattgccttt gatttgggcg    122700
     tctctgagcg aacagtaaag tccagattaa cgtccattta caataaatta ggcgcgaatt    122760
     caagaactga ggcagtaacg attgccatgc aaaaaggtat tctgacaata gacaactaaa    122820
     ctgcatattt gaaaattgcc caaacgtaca tgcccgaatg tacgtttttt tcatttcatt    122880
     gtcaactaca atgagaaaga atgtgatcaa gcaatgtgtt gaaaggagat tatcatgtca    122940
     aaaatgttat atacattagg aggatgggtt gctcgcaatc gcataaaagc aatatgtgcg    123000
     tggatcgttg tgttagttgc tgcgataggc cttgcagtga ccttgaaacc aagtttttct    123060
     gaggatatgt ccatacctga cacaccttcg gaaaaagcga tggatgtgat tcaaaaagaa    123120
     tttcctcatg gtcctgataa agggagcata cgggttattt tcggtgctgg tgatggggag    123180
     aaacttactg ggaagccagc aaaaaaagca atagaagata cgttcaaaga aatcagtaaa    123240
     gatgattctg ttgactcgat tgcaagtcct tttgtgacag ggacaatcgc gaaagatggc    123300
     acagttgcct atgctgatat ccagtataaa tcatcagcag atgatataaa ggattactct    123360
     atcaaacact taaaagacag tttgaaaatg gctgatgatg aaggattgca aactgagcta    123420
     agcggagatg taccgggagc ggagatggag ataggcggtg tctctgaaat tgtcggcatt    123480
     atcttggctt ttgtcgtttt agccattaca ttcggttctt tattaatagc aggtttgccg    123540
     attttaactg cactgattgg tttaggtgta agtattggac tggttttgat tgggacacaa    123600
     gtatttgata ttgcttctgt cagtctttca ttagccggaa tgattggcct tgctgttggt    123660
     attgattatg ctttatttat ttttacgaaa caccgccagt ttttaggcga aggcatacaa    123720
     aagaatgaat caattgcgag agccgtggga acagcgggaa gtgcagtggt ttttgccgga    123780
     cttactgtta tcgttgcact ttgcggatta actgtcgtta acattccttt tatgtctgcg    123840
     atggggctga cagcagggct tagtgtactg atggctgttt tggcttccat cacacttgtg    123900
     cctgcggtct tatcgattgc agggaagcgg atgattccga aatcaaacaa gaaaatagaa    123960
     aaacaaagca ctgaaacaaa tgtctgggga cgctttgtca ccaaaaatcc tatcatgcta    124020
     agtgtatgca gcattctgat tttgatcgtc attagtatcc catctatgca tttggaactg    124080
     ggcttgcctg atgctgggat gaaagctaag gataatccgg atcgccgggc atatgacttg    124140
     cttgccgaag gctttggaga aggatttaat ggccaattaa caatcgtagc ggatgccaca    124200
     aatgctacag aaaataaggc ggaggctttc gcagatgcag tgaaagaaat aaagggctta    124260
     gaccatgtag caagtgtcac tcctgcaatg cctaataaag aagggaactt tgccatcatt    124320
     acggtcgttc ctgaaacagg tccaaatgat gtcacaacga aagatttggt acatgatgta    124380
     cgcagtttat cagataaaaa cggagtagat ttgcttgtta ctggatcaac tgcagtgaat    124440
     attgacattt cagatcgcct gaatgatgcg ataccggtgt ttgctgtact tattgttggc    124500
     tttgcgtttg tattgctgac catcgttttc cgttcgctgc ttgtgccgct tgttgctgtt    124560
     gcaggtttca tgttgacgat gacagccact cttggaatct gtgtatttgt cttgcaagac    124620
     gggaatctca tcgacttttt caaaatacct gaaaaagggc cgatactcgc gttcctgccg    124680
     attttatcga ttgggattct gttcgggtta gccatggatt atcaagtatt ccttgtcagc    124740
     agaatgcgtg aagaatatgt aaaaacaaac aatccagtac aagccattca ggctggatta    124800
     aaacacagtg gtcctgttgt tacagcagcc ggcttgatca tgatcttcgt ttttgcagga    124860
     tttatctttg caggcgaagc ttctattaaa gccaatgggc tggctctttc ctttggtgta    124920
     ctctttgatg cctttattgt aagaatgaca ctgattccaa gtgtcatgaa gctgatgggg    124980
     aatgcagcct ggtatttgcc gaaatggtta gacaagatta ttccgaatgt ggatatagaa    125040
     gggcatcaac tgacaaagga aatacagccg gaaatagatc atgaacaaaa gaaacaaatc    125100
     agtgtgtaat agaaaaagca gatcttttat gatctgctct tttgcttatg gtagtattta    125160
     gaagatgaag tcggcagtta aaaggagacg cttatggcgc catcactcat tttcgatatg    125220
     gatggaactt tgtttcatat tggcagaagc tgcatcatac tagcaggcat cccaggagaa    125280
     gtgacatgat tttttgactt tgcattcact acttgatgcc aaggatcttg agaatccttc    125340
     ttgaaaataa aggattttac aactgatcat ataagaaacc taaagaaaca agcacacaaa    125400
     accagctgcg ggttttgtcc aagaaaaata gagtccataa gagggactct attttttgaa    125460
     gtgcccggct agaagcatat tgcaggactt tatgaatgca aatcactatc ttataagccc    125520
     ttaccgtgaa atgcctgttt ctgcattgaa aaaacgcatt acacgttcat ttacgtaagt    125580
     gggttgttcc atcgataaaa catgtccggc atttttaatg acttccgcct caatatctgg    125640
     aacgaatgaa gaggctcggt gcagggctga gtggggatca tagatgactt catgttcacc    125700
     aagtaataat aggataggaa ctcttgctga acgtaattcc tcatcggtaa aaacatacgg    125760
     aaatccgtcg gcattaggat ttggatttct tgatccatcc tgccacatta cccctgcctt    125820
     aaactgcttc acaaaaatcg ggtgcagcac attctgatca ttcatcatcc aatttaagaa    125880
     tgtttcaact ccatttgacg ctgtaaggcc aagagcgtat ttgtagaaat cgtgatgaaa    125940
     tggcaaaaac gtttctgccg gactcagtat agctgcgctt tttactctct caggcatacg    126000
     taaaaggaaa ttcatcgtat ggagaccgcc aagcgaaagt ccgatcatgt gggacttttc    126060
     gatccccaga ttgtcaaaca catcaagaag ccaattggcg taatccgttc ttgtaccgct    126120
     tacattctca ggaatactct tgtttttatc acctatgata tcaactgcat aagttctgta    126180
     tttactgctc caatcggcga tgttgggata ccacatcgtc gagctgaata atgctccgtg    126240
     gagtaataca agcggcgggg catcctctgg gccgcttgca atcacatgtg tttgaccaaa    126300
     acgagtagat atatagaatg atttacaacg gaccggccaa agactaaggc tttcattata    126360
     agtttgataa tagcggatac cgttgtcact taattcggga atactagatg aatggtttga    126420
     catacaaatg cccctcccaa ttttgtttaa atgaatgtgc cgtttcgtga tggggaatct    126480
     gattttgata taacagactt tatttacaat ataatacagt tgttattaga cgtcaaatcc    126540
     aagatgaaaa ggaaaaaaac gattgaaaca gattattgaa aatcaatata acagaatatt    126600
     aacctccttt gtggagccgc ttcattaaaa ccgcaatcca aatgcatgaa tcacaaaaat    126660
     cacaacagga gggatcagga gggaaggcag cagattcagt gttttgaact tcttgattcc    126720
     aagaatgctt agacctgaac tgaggatgag tatgcctccc acaattgtga tttcattaat    126780
     aaggtctgta ttgattgcgc tctccattac ttgtgcaaat aaatagatgg agccctgcca    126840
     ggaaaataat acaagtgcgg cagccgctat tccaaaacca aaagttgaag cgagcacaat    126900
     ggaggtgatc ccatctaaca tcccgtttgt cagaaggtat gtataatctc catgcaaagc    126960
     ggcttcaaca gggcctaata ttgacagcga acctatacaa aataataaga ccgcagttga    127020
     taagccctct gctaaattgc ttttagaaaa tttgttcacc agcttgttga atcgtaattc    127080
     taaattgatg atctggccta gcaaacctcc aatggctaaa ctcacgatga atagaatggg    127140
     gtatttacta tcaggcaaat gctgtgtaat ggcgttgatc cccagtgcga ccgcagcgaa    127200
     tcccattgcc tgcatcaaaa tatcctggta ttcatcttta atgccttttt tgaatatccc    127260
     cccgattatg cttcctgcaa tgatcatcac tgtgttaaaa atcgttccaa acataagctt    127320
     tctcctccaa aaatcattcc tgcataaaaa ataaaccctc tagttagtag agagtcaagg    127380
     gagatcaaaa catattcatg agattatttg atgggcagca ggatttcagt cacgtaatta    127440
     tctaggttat tcgtaatgcc ataatcaatg agtgtgattt cgattgagtc ccctgctacc    127500
     tcataatgat gttctttcat atatgccagt aattttttgt agtatggttc ggcttctgga    127560
     tgtgaccctt taaacctaat ttgcagatat tctcttgaag gaaagatgat ttctgaagaa    127620
     gttttttcat tttcatcttc aagaatcata aatatactgg aatatttgtc aaactgtttt    127680
     gctttcacat ttgctgcaga aatggataaa ccaatcttgc ctatgaatat atcttcgttt    127740
     acattcaggt gggttctcaa ttcagctaac gaatgttcga tatcatggcc gagaacatat    127800
     tcatgctgca aataggccac acgcattgcg ggaagtttga tttttgaaat ttgatgtaac    127860
     ggcatgttaa cggcatcttc tatatgtgtg atgcgtcggg agatctttcg ttcaatgcgt    127920
     tccaattctt tcttcttgcg atcaatttca acctgctggc tttttagtaa atgaagaaga    127980
     gtgtttgtat tttgagagtt ataaaaatca agaagcttat tgattggcag gcctagggcc    128040
     ctcaaatact tgatggtatc cagccgctca aactgttggg tagaataata tctatagttc    128100
     gtttgctcat ctttatattc cggtttcaaa aggccgattt catcataata ccgaagagca    128160
     gagattttca cattgaataa ctttgacact tctccaatcg aaaaaaattc cttcattcta    128220
     acaacctttc tgtcctatga ttgatataca cacattatat agtacggcga gtactaaagg    128280
     taaagtttgc agcataaaga aaaaactcct tctaaaaagg agcttttcat tcttcgaaat    128340
     aaggatttac atggatgagc acttcttcta catctgaaaa ctgtcttttg atttcatttc    128400
     gaatttcgcg ggcaatgtcg tgtccctgct taattgtcaa atcatgatcc aaagataaac    128460
     ggacatcaag caatttatag tggccatgtt ctcgcgcgcg gattctatca attcgtttta    128520
     cctgatcaca ttgaaaaata acagctttat attcctctat cagctcggga tcaacactct    128580
     tttccatgag cacaccaaca gacggcctga ttaattccat tgaaatctta aaaatgaggt    128640
     aagcaacgat tgcactggca atggcatcgg cgtacaacag ataggaccat ccacggctgt    128700
     ttccgatgat agccaacagg acgccgataa aagcggcaag agaggcaacg atatcgcctt    128760
     tatgatcgta cgcaatcgct ataatcgctt tgctgttcca ttttttccct tgctttatag    128820
     aataacgata taagatttcc ttagccacgt acgaaatcag agccgcaaac aatgcgctgt    128880
     attggggaac gcttggccct ttaacaaagg acagaatcgc ttctatgagg atataaacgg    128940
     atacgatcac taagataatt cctacaatcg cctcactaat gacttcagct tttccgtgac    129000
     caaaaggatg gtcttgatcg ggcggtttat tggaaattcc gatcactgcc aagactgcaa    129060
     tcgaagcaac gacatctgcc gcggaatgta ttccgtctgc aaacacggct tcactatcgc    129120
     ctaccagccc aaaaaagacc tttcctgcca ttaagatcag attggcgatc aatgcaatca    129180
     aagcaacttt tctgcttatt tgttctcttt cacttgccat tttttcctcc tataaaactg    129240
     cacaaaaaaa taggagtgct ctatatacgc tctccgtatc ctttcctgtg taatcacttt    129300
     gtttatcata ccaattcaat ttcgagtggg tctatagcaa cgttgtttcc tgtttactaa    129360
     taaataaggt gacagaaaaa aagttggagc tatgctaaaa aggtcataca gcaaacaaat    129420
     gagttcttat gtaacaacag tgatgattcg ctattaaaat gctgccgtca gtgaaaaatt    129480
     tccacctaat tttcaaaaac ctattgacat gagaagatct gtattttact attatctcat    129540
     attcaagata ttttaatttg agatatttgg tcggaaagat cagcgatcaa gcgcaactct    129600
     aagtgttcaa tcgttgtcag ttcttttaca caatattcaa tatgattttt tataacataa    129660
     tatctcgaat tcgagataaa agggagtgta gcgtaatggc tgaatttact catttagtca    129720
     atgaaagacg atctgcaagc aattttcttt caggtcatcc aatcacaaaa gaagatctca    129780
     atgagatgtt tgaattggtt gcattggcac catcggcttt taatttgcag catacaaaat    129840
     atgtgacggt tcttgaccag gacgtaaagg aaaagctgaa gcaggccgca aacggacaat    129900
     ataaagtggt tagctcttct gcggttctct tggtattagg ggataagcag gcatatcaac    129960
     aagcggccga tatctatgaa ggtttaaagg tattggggat attaaataag caagagtatg    130020
     accacatggt gcaagacacc gtttcgtttt atgaaaacag gggagaacaa tttaagagag    130080
     atgaggcgat aaggaatgct tcactttctg cgatgatgtt tatgctgagt gctaaggaaa    130140
     aaggctggga tacctgcccg atgatcggct ttgatgcgga agccgtaaaa cggattttga    130200
     acatagacga ccaatttgag gttgtcatga tgattacgat tggaaaagaa aaaacagaga    130260
     gcagaagacc gcgcggctac cggaagcctg tgaatgagtt tgttgagtat atgtaaaagg    130320
     agcggataaa aatggctaaa aaaacgatgg gaattcatca tattacagcg attgtcggtc    130380
     accctcaaga gaacacagat ttttacgcag gagtgcttgg gcttcgtttg gtcaagcaaa    130440
     ctgtcaattt tgatgaccca ggtacgtatc atctttattt tgggaatgaa ggcgggaagc    130500
     cgggaacaat cattaccttc tttccgtggg ccggagcccg ccaaggcgtc attggagacg    130560
     gtcaagttgg cgtgacttcg tatgtcgtgc cgaaaggggc tatggcattt tgggaaaaga    130620
     gactagaaaa gttcaacgtt ccctacacca aaatcgagcg ctttggggaa caatatgtag    130680
     aatttgatga tcctcatgga ctgcacttag aaatcgtgga aagagaagaa ggagaggcta    130740
     atacgtggac tttcggagaa gtaacgcccg atgttgccat taaaggtttt gggggtgcaa    130800
     ccctattatc agagcagcct gacaaaaccg ctgacctttt agaaaacatc atggggctgg    130860
     agcgagtcgg caaagaagga gacttcgttc gttatcgttc cgccggtgat atcggaaatg    130920
     tgattgacct taagttaacg cctattggcc gcgggcaaat gggggccgga acggtgcatc    130980
     acatcgcttg gcgggctaac gatgatgaag atcagttaga ttggcaaaga tatattgctt    131040
     cccacggata tggtgtaact cctgttcggg atagaaacta ctttaatgcc atttacttca    131100
     gggaacacgg ggaaatcctg tttgaaatcg caactgatcc cccaggcttt gcacatgatg    131160
     aaacacagga aacaatgggc gaaaaactga tgctgcctgt gcaatatgaa ccgcatcgca    131220
     cacaaattga acaagggctg ctgccgtttg aagtaagaga gttagattga tttgacacat    131280
     aaaaaataaa gaaacatata ttcaattgat gattgctgga tggtactgtc agcaaagaat    131340
     cagataaaat caaagatgag gagagataca aatggaagat gcaggactgt tgcttattcg    131400
     tataatgatt ggtgtggtgt ttttgtttta tggcacacaa aaattattcg gctggtttgg    131460
     cggatacggg attaaaggaa ccggacaatg gttcgaatca attggggtga aaccaggaaa    131520
     cgttgcggcc gctctatcag gtcttgggga gttagtaagc ggaattctat ttattttagg    131580
     cgtattcctc ccgcttggag ctgctatcat aacaatcatc atgttaggtg ctatcgtaaa    131640
     agtccatgga gcgaaaggtt ttgcgaatgg cgccggaggt tttgaatata acctggtgct    131700
     cattgcagtt tccatagggg ttgcactcat cggttcagga gcttacgctt tgcattttta    131760
     atacgaaagt atgtaagaac agttgctgct tgtcagtaac tgttctttta ttttcacatt    131820
     ttcggcaagc ttgcaggtac tctgcaaagc aaaaaagcgg atatcataaa tataaatctg    131880
     tatagtgaat gatacgtatt gatgagcttg gtcatgaaaa acagacctat ttgaaggagt    131940
     aaatggatga aagagatgac aggattacat tcattagttt ctatagaaaa ctttatcaaa    132000
     cagcacaaat tcagttttat ttatatatca aggcctggct gtacagtatg tcacgcagtt    132060
     ctgccccagc tcagaatagt attggatcag tttccaaaca tcaaattggg gcatatcaat    132120
     gctgacgatg tagcagaggt cgccggcaga ttttcagttt tcaccgttcc tgtgcttctt    132180
     ttgttcattg atgggactga gtttctaaga gaagcccgtt ttgttcattt tgaacagctt    132240
     gaacaaaagc tgaaaagggt ttatcgatta tatgaaggcg aataaaggaa taaggcaaaa    132300
     aaagaactca aatgagttct ttttttattc ttcactaggc gaagaagggt tatcaacctg    132360
     cccttgatca cttgtatcat tatcacaact tgctgaaata ataattgaat gagaaggaga    132420
     gtaatctcct aatgtgaaat tcactccgta atttttgctg ttcgcagtat ggctgttttg    132480
     caagttttgt ccgatatctg tattggcgtt ttgtgtcatt ccatttatcg tgagatttga    132540
     gatgttgatt tgagatcgca tgcttcaaaa actcctttca ctcagaagta gctgtcataa    132600
     aggacgctgg cagtctattt acttctatga tattgcgttt ttatatcatt gcatcaacat    132660
     aatggtaaaa ataatagcga gtgaatgatc atcttttgaa gatgatcaac ctatcagcag    132720
     aaataaagcc gcctgataaa gaggcggcag atcgttatat gtcatctatg aatttgatgt    132780
     atcgtttttc gtttgcctga aggataagat agtcgttttt aatgatgagt aggagcctat    132840
     agcagcgtag ccataaaacc agcccataaa tacgccagaa aagaggctgt gtcgatggct    132900
     tatgaaaaca gaaatgacaa ggcctgttat taaggcaact gacggtacaa aagttttggg    132960
     gattttcaat aatattttga ggatttgggt tatcaatatg atgattggaa cagctatcac    133020
     agcatcccaa aagttcgtgt gaataattgg aaaagccata cggcacctca tgaagtgttt    133080
     atttcttaat ttttacgcta aaagcttgga aagcagctct tggatcgcat atgttacatt    133140
     ttgggcttga ttggcggagc ttgtttggct taaagcattg gattcaaaaa ccaaacctgt    133200
     attactccca ccggaaccct ctgttgtttt agacacagag aacgggctga tggaaactgc    133260
     aaatccgtta ttaaaaacgc tgttcccgga tatcgaatga atataaactg ggaatttcat    133320
     cattcatctc tcctctctgt tatgactgtt tatacaatat ggtgtgtgag cagcagttgc    133380
     ttaaacaaaa cggcaaaaac tttcagtaag agacaaaaac ctgcaaaatg ccacaagcgc    133440
     cttttgttaa tgcagctttt tagggacgtt ttttttattt tttttgccaa cttcatcaaa    133500
     aatattctga ttgccagact gggcttgtcc gtccttattt atgaaatcgg ggtgaatgag    133560
     ttttttcaga tccctgactg ttaaaggctt ggcgtcatca gttaattcta ttcctaattg    133620
     cccgtttgcc tctaatgtcg caattttgac atcttgtata gccgtaacgc cgtgaagcct    133680
     tagctgcatt tcaagctggt cagctgtaag tctcatcttc tttaagtttt cgatatgaag    133740
     ctgtccgttt tcaatgacga tttttgcttt tccggttaac atcttttcaa tggtgttcga    133800
     tttcatttgg atccattcca taacgatgag tgtgcttgtg aaaattgccg ctgcaattaa    133860
     tgttttgaag aggctgtact cgatgattgg ctgaacgata atagttccga tcgaaatcat    133920
     gacaaccgtt tgagtcgacg tcatttgtgc gattgatttc cttcctgaaa ttctcagcaa    133980
     aatgaccccg gctacaatga gaacaagaga ttcccaagtg aaattcatgc taccacctga    134040
     ccaatgatga attagatttg tcatgggatt ggcttttctt ccggccaatc gcaatttaat    134100
     atatccgaaa ggcagtcggt tcattctgtc ctgaaccgaa caatattttt ggtatagatg    134160
     gatatattaa gccaaacaat gatagcaaca ggagtttttt ggccgaaaca atctgggaag    134220
     cggggagcgc cataacatga ttgaacttga agttgtcatt agaacggttg ccagctttgg    134280
     cttgctgtta atcgcagaac gaattttagg caaacagaca atctctcaaa tgacgatttt    134340
     tgattttatt gcggcgatca cactaggggc gattgctgcc ggattagctt acaatacttc    134400
     aataaaaccg cacaatatgg ccatttcgtt tagtattttt gtgctaacca tttttctaat    134460
     ttcgtttctg tcgataaaga acaggaagct gaggaaattt tttgccggag atccaacagt    134520
     gctgattcaa aacgggaaga tacttgaatc aaatatgagg aaaatgcgtt acacacttga    134580
     ttatttaaat cagcaattac gggaaaaaga aatatttaat atcgaagaag ttctttttgc    134640
     cattcttgaa acgaatggtc agctgactgt gttaagaaaa ccgcaattcc ggcatgtgac    134700
     caaacaggat ttaatgattg cggtaaacca agaacaaagg cttccgatag aacttattat    134760
     ggacggagaa atcattgaga ataatttaaa gcagaatcgt ttgacggaat cctggctttt    134820
     ggaagaattg cgaaaaagag acataaaggt gaaagagacc gtgtacgcag tgctgctggg    134880
     taatggggat atttatgtgg atcaatataa agaccatata tcagtcccta tggataagga    134940
     atgaaggaac aatcaatctt aaagcccctt attgaacgca acggtttcaa cttgtcttgg    135000
     gtacgaaata tgcagaagcc cgtttaacag ctgaatctgt aacaaatgag tttcagcggc    135060
     ttcgggaagc tgaatgattc gctcaatttc tccgtaatac cgttcacgca gcacttccat    135120
     ttcggctgga aaaacaggcg tgatcgttcc tttgatcagc agctgggttt tagacagtaa    135180
     acggatcgtt aattcttcct catacacacc gggcatttcc acaatgataa aattatattc    135240
     ctcatcttga taaaagtcgt aaacaaacgt agaagcttcg gaatcaaaaa aatgttccgg    135300
     ggctttatat ttgagcacat ttgtccaaaa gtcactttgt ttatattcat tcgtaatctc    135360
     aagccacttt cgaatttttt cgaaatccat atgagattct ccttaaattt gatttgaaat    135420
     cggcgcagaa gggtttccga tttggtcttg gtcactaacg tctgaatcaa tatttccagt    135480
     gtttaaaagt gaagacgtag gcgaaagatc ccctaaggaa aagtttgctc caaaatattt    135540
     gctgttcgca gtatggctgt tgtgcacagt cggaccgaca tctatatttc cgttttgcgt    135600
     gacgccgttg atcttaatat ttgcgatatt aatttgatat ggcatagacg aaaccccttt    135660
     aatctaaaat tggcggtggt gcaatcggag gagcattaac gttggatgta tcagagttgc    135720
     cgatagatgt ctggtcattt acatcaggat cgtttaagaa gttttccatt acggattctg    135780
     taggtgatgt atcaccgaaa gaagagttgg tcccttgaga tttttgattg ttggtagggc    135840
     tgttataagc agcttcgcct attgtaattg aaccattgcc cgaaatactg ttgatcttca    135900
     aataatatag gttgattact gtagacggca tcccatcaca cccttccatc tttctgtaca    135960
     gtacattatg cgccgctgca cccaattgtt ccttgcattt acgggcaaaa ctctatctgg    136020
     ccccggagtg atgctcaatt atcagtgaat gaaaagccat tgatatagga atcaatgaat    136080
     tgattcagtt attcgaaatg catgagacct tttaataaag gaagctggca aacaggatca    136140
     gtttgaaata attgacaatg aagctaatgc catgaaataa tactcgtgag taacattact    136200
     cgtgggtatt atttttgggg tggtcctagt tgaaaagtaa aggagtagaa agccgaaaac    136260
     gattacttaa agctgccgct aatgaatttt cggttcgggg attccatgac gcgaaggtaa    136320
     gtgaaattgt gaaaaaagct gggttcacgc agccttcatt ttacctgtac tttcaaagca    136380
     aagaagccat ctttgccgag ttaataaccg attttcactc tcgagtcaga aagctgacag    136440
     agtcacttct tctggaaaac ggattaaaca cggaggatgt gtcaaaacgg gtactgctag    136500
     ctgtagagac tgtttttcaa tttttggatg aggacaagga tttaaccaag atcggctttt    136560
     ttctcaaccc ggaagcaaaa caaatgaaaa aagacttggc gatggttttg aaagagaact    136620
     tagaagcaga acagcggctt ggctattttc actctgaact ggatatggaa actgtcgctg    136680
     agtgtttggt cggcatgatt gaacatttaa ccgaatcatt tttgttaacc ggaatcaaag    136740
     atccggcaag cctcgcagca gaggttgtga atcttttaat ttacgggatg cttccgaaag    136800
     ggaatgatgt aagatgatat ctattatgat gaaagtcagt ttggcagttt ttatgcttgc    136860
     gggaggcatc ataaaggtaa gccgcgttcc ctttcaagtt gagcattggc ggcattatca    136920
     atatccatta tggtttctga ctgttactgg cattcttgaa atagccgggg cacttgctat    136980
     gacagcggga atttggaatc ggtatgcagc aattggagca ggtgttctgt ttgtcgttct    137040
     catggcggga gcaattcatg cgcatatgtt tcgagcaaga caatctgtca tcatggcgat    137100
     acaagcgatg atttgtttga ttgtttcaat catgatcatc atggggagtt acacgtaagc    137160
     ttttcactaa tgtttaagaa caagcccatt tgcaggaaat ctccttttct tatcgaataa    137220
     tagaaagtcc aggaattaac tgaatcagta aaatagagct ccatttctgt gttattcgtc    137280
     cggcatcagc tgggcttttt ttataaagga ggaatacagg atggcattca ctttggaaga    137340
     catgactgag gaagagttcg aagcctttcg cgggatgtcc gtgcaaaatt ttgcgaaaca    137400
     aaacataacg tcaggaactt ggacggaaaa agaggcattt gagaaatcgg agcaggcata    137460
     tgagaacatg attccgaatg ggcgagacag cagcaatcat tatttttgga acatcacaaa    137520
     tgaccaagga gaaagaatgg gctggctctg gctgtatgct gatccattac atccgcaaaa    137580
     ggaagcgttt atctattcct ttggattgta tgaagccttt cgcggaaaag gacttgctca    137640
     attggcgctt caaacgcttg atgaaagagc aagagagctt ggtgcggaaa ggctggctct    137700
     acatgtattt gcacacaacg agacagccgt ctatctttat cagaagatgg gctatgccat    137760
     gaccaatata cgtatgcgga aacagctatg ctgaaaagcc gcttacgtta cccaaataca    137820
     acatgcctat ctggaagcgg tggcagggta ctataagtca tcattagaaa gattaaggtc    137880
     atgggaggct tgaacatata aagaaaaagg acaacagctg ttgtcctttt caatgccgct    137940
     tgaactttct ccctcagtct tttttgtctt gatgatccag ctcttttatt cgtttcgtaa    138000
     gctcattgaa agcctgatca agctccttat accctttatc atttggcgtc ataaaactga    138060
     gctttcccag cacttcttgt ctttctgtct caagctttaa ccgaagctcc tcccgctcat    138120
     ttctttctga aggaacgtcg tttaactgct tttcgatgcc gttgtttgag atgacgagtt    138180
     tactgtttgt tgttttttcg agaaagtatc ggtcatgtga aaccgccagc aatgtgccgc    138240
     tgtattgtga cagtgtttct tccagctgtt cgcgtgacgg caggtcgaga tggtttgtcg    138300
     gctcatctaa aatcagcacg tctttttcct ccagaatata tgccatcagc ttgatcttta    138360
     cacgctcacc catactcata tgcttgatcg gttcagtcca ttgggcggct gtaaaaccta    138420
     agtgcctcat cagattttga acgtgccccc ttgctttgaa tgtttcattc tcaaataact    138480
     cttccggtgt ttgttctaaa ggcaaatcaa acacctcctg cgttaaatag ccgatgtttg    138540
     cggacggcga cacccataca cttccttctg ctgtttcctg tcccagaatg atgttcagta    138600
     atgtcgtttt tccgctgcca ttggggccta tgatcgcaac cttttcgccg tgctgaattg    138660
     taaagtttgc gtttttaaag agagtccttt ctccaaacgc ttttgttaca ttctgaactt    138720
     ctaaaaaacg ttttcctgtt ttgtgggttg tatcgattga aaagcggact gtatattctg    138780
     gggtaacggg ttccgccttt gctttttcaa gctctttttc aagccgcttc tgcttggatt    138840
     ttatctgggc atccgtacgc ttcgctttta cccggtgata ttctttaaac ccttcctttt    138900
     tcgtcgattg agcatgggct ttttccgacc aagaagcgag cccattcatt tgtgcttcaa    138960
     tccgttcaac cattttttgc tgcttttcat attcacgctg ctgggtgagt cttttcttct    139020
     cccggaactt catatacccg gagtaattcc ctttgaattc aatcagcgtc tgatcctcaa    139080
     gcgaccatat ttttgttgcg gcttcgtcta aaaaatatcg atcgtgagaa acgagaatca    139140
     cagtgccgtt ataatgtttc agctgttgga tgagaaattg caagcttttt tcatcaaggt    139200
     ggtttgtcgg ttcatctaac agcagcagat ctgcatcctc tgatagtcct ttcgccagcc    139260
     gcgctttcag tttttcaccg ccgcttaact gatgaaaatc acgaagaggc acatgccatt    139320
     tctccagtaa cttcttttcg gcaggtgtct gatccgcaaa ggaatacgcc gcggtttcct    139380
     gttcaaccaa agccagtttt atatccttcc gaaggatttg accctgtgca ggggctaagt    139440
     cattgtgaat gaggtgcagc aacgtagatt tcccagcgcc gtttttgccg ataatcccaa    139500
     tgatatctcc ttgctgaaca ctggcgttta catgtttaaa aacagtttga tcctttactt    139560
     catagctaac gtttgttaat gttacgatct ctttcatcca tatccctcgc tttaaaggga    139620
     gaataaaaaa atcctcccaa atgtgttgga aggattagcc gtgcctgtgc atgatcaaat    139680
     aagctatttt ttataaatag cagtgtcgta tatatagaaa atgggcagac taatcctatt    139740
     ttttgatttg aaatattgat ttcaaacggt aaaaataaga ttagttaatc attgtccacc    139800
     catcatccct tcttgttttg attacaaaca ctatagcata cctttaaatt caaaagcaaa    139860
     ggtcattttc atcaaaaaaa ctcctgctct catttttgag gcaggagttt tgagtcttat    139920
     tgatgcttcg cttttctcac tttataaatc acaatcagca aaataaacca aaccggtgtg    139980
     acaaataagg aaacacgagt atcctgtgcc agtgccagca caaccagaac aaacgccagg    140040
     aacgcaagaa tcaggtaatt tgtaaacgga taaagcggaa gcttaaactt gtttgttttc    140100
     gctaattcag gtcttgtttt gcggtatttc atatggcaga tgaccgtaat cccccaaatg    140160
     tagataaagc atacggttga aatacttgtg atcagggtga atacgccttc tggcatgatg    140220
     tagtttaacg taacaccgat taaaatcacg atagctgaaa agaataaagc atttctaggc    140280
     actttacgct gagtcagttt cgccattgac tcaggcgcat tgtgatcttt cgccagggaa    140340
     tagaccatac ggcttgtact gaatacagcg ctgttgcatg ctgaagcagc ggatgtcaac    140400
     acaacaaagt tgataatact tgcagccccg acgatgccaa cagcgacaaa tacttgtacg    140460
     aatgggcttt cgctgggatt gatgatatcc caaggataga tgctcataat cacgagaaga    140520
     gccccgatat aaaaaagcag cacacggaca ggaatattgt tgatcgcctt agggattact    140580
     ttttcagggt tttctgtttc accggccgta agcccgacaa gctcaatgcc gacaaaagca    140640
     aacacaacca tctggaacga gaggataaac ccgtgcatgc cattcgggaa caggcctccg    140700
     tggctccaga ggtttgtgaa gctggacact cctgagcttg tggaaaagcc tttgaaaatc    140760
     atcacaaggc caatgacgat taacgccaaa atggcaatga ctttaatcaa agcgaaccaa    140820
     aattctaatt ctccaaaaag cttgactgtc gccagattca taatcagtaa aataataaga    140880
     gcgattaagc caggcaccca ttgcggcaca cccgggagcc aatattgagt gtagagcccg    140940
     actgctgtca gatcagccat cgcaatggaa atccagcaga accaatatgt ccagccggtg    141000
     ataaaagctg ccatatcgcc taggtagtct tgtacaaaat ccacaaaaga gtgatagttc    141060
     aagtttgata acagcagttc acccagcgat ctcataatta aaaagcaaat gatccctgtg    141120
     atcatataag caaataaaat cgaaggtccg gcaaaatgaa tcgatttgcc cgagccgaga    141180
     aataagcctg tcccaatggc tccgccgatg gcgatgagct ggatatgcct gtttttcaag    141240
     cctctctgca acgtttgctg atttatattg tctttcgtca tgtcgtctgt cactttatgt    141300
     gttcctccat tgaaaattgt ttattgagtc agcaatctat ttttaatgat tattataaca    141360
     ctaaaatttc tatctttttt actaaaaaag gattgatgaa aagaatttta atgtgatttg    141420
     gactatttcc cgaaaaaagc ggctccattt agggagccgc ttttttatgc tttttcagtt    141480
     tttgtcataa acaggtagag cccgtaatct gtcggtgcgg atgcgtagcc tgcctgccgc    141540
     agcattgctg tgatattgcc gcggtggtat gtcccgtgat tgacaacgtg gggaagcagt    141600
     tcggaaacag ttgttttcat gattccgctt gagggatttt gaatctggag tggcttattg    141660
     agctgttctt tttgctgtaa aaatagtata tagcgctcgg ataacctcag aaaaaggtct    141720
     tccatttcct ctatttcttt agcctctgtc tgttctttaa gctgttcagc taaagccaac    141780
     gcatcgctca aggttttgcc ggaaaacact tcaatccagc cgagatcaga aagataaaca    141840
     tgagacaata catgggatat tgacggaaac acgctttgaa tttcttgatg gtatatctct    141900
     tttggaagct cttttaatcg gttgaatatt tgttgattgg cccagacgtt atattcatac    141960
     aatttgaatg caaaatctga catgttaaaa ttcccccttt cgtgtgtata gctttcatta    142020
     tacacgaaca tgagttctta tgtagagtgc tcgaaaataa aatttgttga catatatagt    142080
     ttagaggaat aaactaattg acattgaaca taaagtttag cggggtaaac tataatgagg    142140
     aggggaagat attgaatgaa caaaagctat gtcaggcgat aaacctgttt gtggaagtcc    142200
     tgcttgaagg gacagaattt gtgcatcgtg aaatcaatca ggatgtcttc aagcatatct    142260
     caagggaaca ggcagacctg ttgaaaattt taaaagtcaa gggcccaacc tctcccggca    142320
     gcctggccat gtaccaaaat gtacataaga gcgcgatctc taacagactg aaaaagctgc    142380
     tcgaaaaggg attggttcaa tgggacgact gtccggaaaa aagtgatagg cgctctaagc    142440
     ttattaacat tacacccagt ggtgaacaca tactagaaga attagattct gccatcttta    142500
     acgcgctcaa accgttgatt gatgatatag atgaggaaca cttacattct atcatcgaga    142560
     tattcaccat tttaaaaagc aaatttaaag gaggagattc tgccgaatga gagcaatcat    142620
     caaattcaag tgggcaattg cagccatagt attagcactt accgtcgttt tgagtttgtt    142680
     ttctccgaac ttaacggagc tggccaatca aaaggggcag gcccagcttc ccgctgatgc    142740
     tgtttcagaa agggcaaacg ccattttaaa acaagcggga gaagacaata attcgatcag    142800
     tgtagtcttt acattagaca acgctataaa gaaagaaaca gagaatcagc tccggataat    142860
     aattgataaa atcaaaaaga tcgacggtgt agaagaggta acatctcctc tgtcagcgga    142920
     aaaagaagtc aaagaccagt tgatgtcgaa agacaagaaa accgttctca tgcctgtcac    142980
     gattacaggt tctgataaaa aggcggaaaa aattgcggac gagatttatc aaatcgttcc    143040
     tgatgacttg acggcatata ttacgggagc ttcccttatc aaccaggatt tcgctcacag    143100
     ctcagaggaa gggcttaaga aaacggaagt gataacagtc tgcctgatca tcggtttact    143160
     gttgatcgtg ttccgatctg ttgtgacgcc ttttatcccg attgtggttg tcggtttttc    143220
     ttatctgatc agtcaatcta tactgggcat ccttgtatac aatgttgatt ttcctatctc    143280
     gacgtttacg caaaccttct tagttgcgat cctgttcggc attggaacag attactgcat    143340
     actgcttctt acacggttcc gtgaagaatt ggcaaacggg catgataaaa aagaagcggc    143400
     gcttatcgct taccgcacag ggggaaaaac cttatttatc agcggatttg cggtattgat    143460
     cggattttcc gccttaggat ttgcgaagtt tgcgattttc caatccgcag taggggtagc    143520
     agtcggtgtg ggaattttaa tgatcatcct ctacacactg ctgccattat ttatggtgac    143580
     gctgggtgaa aaattattct ggccttctaa gaaagtgctg tcacacagtg ataacaaact    143640
     atgggcgttt ctcggcagac actccgttgc gcgtccgttt ctgttcattg tcatcacggt    143700
     ggtgattacg cttccgttca tcttgaccta tgatgaccag atttcattcg actcaactgc    143760
     ggaaatcagc agcgattata aatctataaa agctctcgag gccattaagg atggattcgg    143820
     ggaaggaaaa gcgttcccga tcaatgttgt cgtaaaagga gacaaagatc ttacaacagc    143880
     tgatacaatc ccctatctag gaaatatcag caaagcgatc gagaaagttg atcatgttga    143940
     ctctgttatg accattacgc agccgactgg taaaaaaatc aaagatttat atattgataa    144000
     ccagctagga tcggtttcag acgggctgga taagacggtg aaagggattg ccgatgtcca    144060
     aagcggatta acggatatag aaaacggact gaatcaaatg gcagggcaaa ccggctcggc    144120
     ctcaaatgga gggtctggcg gttcactggg cgatgcggca gatggcttgg gcaaaatcaa    144180
     tcagcagctg cagctcgtga gcaaacagat ttcccaaacc ggcaataccg cacagaccgt    144240
     gcagcagctt acggcaataa gcggacagct tggccagatt caaaccggcc ttgaacaagc    144300
     gaaccaacag ctctcaggcc agcaggcaca agccggaacg ctgacagaaa gcctgaaaaa    144360
     gctgtccgaa ggcgtgaaaa gcgcaaatga gggcctgacg aaagtctctg acggtattac    144420
     agcttccagt gatatattag aggacatgag caaaagtcca actgtaagag atactggcat    144480
     attcattcct gatcaagtaa tgaaggacaa agactttaag aagtcaattg accagtattc    144540
     ctttgcagac ggcaaaggtg ttcaattaag tgtcgttctg gattcaaatc cgtactcaga    144600
     acaagctatt acgacaataa accaaatcaa aaaagctgtc gcaaacgaag ttgacggcac    144660
     tcctttggag aatgcacaga tcgtgtacgg cggggtcacg agtatgaatg cggacttaaa    144720
     ggagctatcc acaacggact tctccagaac aatggtgatt atgattatag gcctgtttat    144780
     cgtgttaacc attttgttcc gctcaatgat catgccgatt tatatgatcg cgtcattgct    144840
     gctgacgtac tatacgtcga tatccataac agaattaatt tttgtaaacg gcttaggaaa    144900
     cgcgggtgtc agctgggcag tgccattctt cagctttgtc atcttgatcg cgttaggggt    144960
     agattattcg atcttcttgc tggatcgatt taaggaagag gtgcaccttg gcattgagca    145020
     aggtgtcgtc aggtcaatga gcaaaatggg atctgtcatt attacagctg ccattatatt    145080
     ggccggtacg ttcgcggcga tgatgccttc aggtgtcaat acactgatgc aggtggcaag    145140
     tgttatcatc atcgggctct tgctttacgg ccttgtcata cttccgctct tcatcccggc    145200
     aatcattgcg acctttggag aaggaaactg gtggccgttc ggcaggaaga aaggaaaaga    145260
     gtaatcgaga gaagagtgat gaatggtcat cactcttttt tcatgactaa acgactaact    145320
     tcagacgtgt tacccaaaaa gatcagacga tcaaacggcg gctgtactta aaaacaaaga    145380
     gcccggaaaa cattcccggg ctctttgttt tatttccatt ctgcaattgt atcaatcggc    145440
     agacggtagg aagcatagcc ttcgtctgct gcttttccga tagaaagtag cataaccggt    145500
     acataacgtt ctttatctaa tccgaaggtt tccgcgatgt tttctttatc gtatccgccg    145560
     atcgggtttg tatcgtagcc atgcgcgcgt gcagtcagca tcagctgcat ggaaacaaga    145620
     cctccgtcaa tcaggatcgt ttcacggttg acctgtgccg gaagcttttc aaaatgtgcg    145680
     gtcagcgcgg cgatttgtct gtctttgacc tcctgcggca tgtaaccaag ttccacggct    145740
     tttgaataga tttcttctag atagtctgcg ttgttcatgt ctgcaaatac agcgatgaca    145800
     gcagatgatg ttgtgacttg tgtttggtta aagcttgcaa gcggtgcgag cttttctttt    145860
     ccttccgggc tgtcaatgac aagaaaacgc catggctgcg cgttaacaga agatggggca    145920
     gttgttgctt cctctaagat ctctgtcatt tcttctttgc tgatttttac tgccggatca    145980
     tagttgcgga tagaacggcg gcctttcata atttccataa aatcgtttgt tttgatcatg    146040
     ttgatacact cctcttaagc ttcgatatta tttatattgt ttcgcatgcg cgccagcaca    146100
     tcaatgagca ggcggcgttc ttctgcgctt acatttgcga gcatttcctt catgaaacgc    146160
     tccttttcct tcttagaaga ctcaattcgc tctcttcctt ggtctgttaa ccgaacaagg    146220
     gtgatgcggt tgtcctcagg cttgcgccgc cttgatacca tgcctttgga ttccagctgt    146280
     ttcaggtgtc tggtaacggc tgcgctatcg atatttactt tcttttgaag gtcgctttga    146340
     ctgatctcat ctgcatgata aagcaatgtc agcaattcca aacgagattg gctgatgccc    146400
     gtgcatgcct cgaacttcac gccaatcacc ttgttcacgc cttgcagctg atataaaatc    146460
     tcggcttcct ctgaacaaaa tgacgccaaa acccatccct tctttcctgt caaaactatt    146520
     aattgatata tcaatgattg acacgtcaat taatatacaa cgattgattt catcttgcaa    146580
     gccatttgca cttttgaaca acctcccagc gcataaaatt cgctaggcta gaacttagca    146640
     aaaaaagctg gccgcttctt cagatgatgc tggtcacgat gattccctgc atcattccca    146700
     tttataggtg ttcggaatat cactttgccg gcccgtgctc aagcggcttt cacaggctga    146760
     aagttatgat acaatataca aatgtttcac agcttcaatc catagttgga gctgacatcc    146820
     attatataag ggactaggtt gaagggaagg tttgataaca tgctgcacaa tccaactgga    146880
     aaagaacgct tggcactagc gtttctgctc ggcatgcttg ctatattggg cccgcttaat    146940
     atagatatgt atttgccaag ttttcctgaa atcgcgaaag atttatcagc aagtgcttca    147000
     cttgttcagt taagtttaac agcctgtctg gtcgggctta cgatcggcca gctgattgtc    147060
     gggccggtca gcgatgcgca gggaagacga aaaccgctat taatctgtat ttttttattt    147120
     gcgttatctt ctctgttttg tgcactgtcg cccaatataa caactttagt ggctgcgcgt    147180
     tttttacaag gcttcactgc ttctgcaggg cttgtgctgt ctcgcgcaat cgtccgcgat    147240
     gtgtttaccg gaagagagct ttctaaattt ttctcgctgt taatggtcat taccgcggtg    147300
     gcgccaatgg ttgcgcctat gacaggcggt gccattttgc ttttgccgtt cgcaacgtgg    147360
     catacaattt ttcacgtctt aatgatcatc ggatttttac tagttcttct gattgcattg    147420
     aggttaaaag aaacgcttcc gctggaaaaa cggattccaa gctcaatcgg aacatccgtc    147480
     aaaacgatgg gcagcctgct gaaggatcga tcctttatgg ggtacgcgtt aactgtcgga    147540
     tttattcacg ggggaagctt tgcatatgtg tctggtacgc cttttgtata ccaggatatc    147600
     tacggggtgt ctccgcaggt atttagtatt ctttttggca ttaacgggct ggcgattata    147660
     tcgggcagct ttatcatcgg acgctttggc ggaatcattc atgaaaaaag cctgcttcgt    147720
     atagcggtca ttacggctat gattgcgacg gctgtgctat taaccatgac catgattcac    147780
     ggtcctcttg ctacattagt catatccatt ttcatttaca tgattacgat cggcatggtt    147840
     ctgaccagca cgtttaccct agccatggaa aagcaggggc accgcgccgg aagtgcaagt    147900
     gcgctgcttg gaatgcttcc gctgctcctc ggttcaatcg tgtcaccgct tgtaggcatt    147960
     aatgagacaa cagccgttcc gatgggagcc atcatgtttg tgacagctgt catcggctca    148020
     ctggcgtttt ttggattaac gaaagaacga gtagggcaga attcataa                 148068
//

If you have problems or comments...

PBIL Back to PBIL home page