(data stored in SCRATCH zone)

EMBL: AB002150

ID   AB002150; SV 1; linear; genomic DNA; STD; PRO; 15684 BP.
XX
AC   AB002150; D84214;
XX
DT   10-APR-1997 (Rel. 51, Created)
DT   14-APR-2005 (Rel. 83, Last updated, Version 7)
XX
DE   Bacillus subtilis DNA for FeuB, FeuA, YbbB, YbbC, YbbD, YbzA, YbbE, YbbF,
DE   YbbH, YbbI, YbbJ, YbbK, YbbL, YbbM, YbbP, complete cds.
XX
KW   FeuA; FeuB; tRNA-Gln; tRNA-Glu; tRNA-Thr; tRNA-Tyr; tRNA-Val; YbbB; YbbC;
KW   YbbD; YbbE; YbbF; YbbH; YbbI; YbbJ; YbbK; YbbL; YbbM; YbbP; YbzA.
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-15684
RA   Yoshikawa H.;
RT   ;
RL   Submitted (28-MAR-1997) to the INSDC.
RL   Hirofumi Yoshikawa, The University of Tokyo, Ins. Molecular and Cellular
RL   Bio-sciences; Yayoi 1-1-1, Bunkyo-ku, Tokyo 113, Japan
RL   (E-mail:hiyoshik@imcbns.iam.u-tokyo.ac.jp, Tel:81-3-3812-2111(ex.7826),
RL   Fax:81-3-3813-0539)
XX
RN   [2]
RP   1-15684
RX   PUBMED; 9274029.
RA   Liu H., Haga K., Yasumoto K., Ohashi Y., Yoshikawa H., Takahashi H.;
RT   "Sequence and analysis of a 31 kb segment of the Bacillus subtilis
RT   chromosome in the area of the rrnH and rrnG operons";
RL   Microbiology (Reading, Engl.) 143:2763-2767(1997).
XX
DR   MD5; 398f449b85d04bc57cc61ea28717d552.
DR   RFAM; RF00005; tRNA.
XX
CC   D84214:Submitted (25-Mar-1996) to DDBJ by: Hirofumi Yoshikawa
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..15684
FT                   /organism="Bacillus subtilis"
FT                   /strain="168"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   CDS_pept        complement(1..1005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="FeuB"
FT                   /db_xref="GOA:P40410"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40410"
FT                   /protein_id="BAA19495.1"
FT                   /translation="MYSKQWTRIILITSPFAIALSLLLSILYGAKHLSTDIVFTSLIHF
FT                   DPGNTDHQIIWHSRIPRAAGALLIGAALAVSGALMQGITRNYLASPSIMGVSDGSAFII
FT                   TLCMVLLPQSSSIEMMIYSFIGSALGAVLVFGLAAMMPNGFTPVQLAIIGTVTSMLLSS
FT                   LSAAMSIYFQISQDLSFWYSARLHQMSPDFLKLAAPFFLIGIIMAISLSKKVTAVSLGD
FT                   DISKSLGQKKKTIKIMAMLSVIILTGSAVALAGKIAFVGLVVPHITRFLVGSDYSRLIP
FT                   CSCILGGIFLTLCDLASRFINYPFETPIEVVTSIIGVPFFLYLIKRKGGEQNG"
FT   CDS_pept        complement(1024..1977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="FeuA"
FT                   /db_xref="GOA:P40409"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="PDB:2PHZ"
FT                   /db_xref="PDB:2WHY"
FT                   /db_xref="PDB:2WI8"
FT                   /db_xref="PDB:2XUZ"
FT                   /db_xref="PDB:2XV1"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40409"
FT                   /protein_id="BAA19496.1"
FT                   /translation="MKKISLTLLILLLALTAAACGSKNESTASKASGTASEKKKIEYLD
FT                   KTYEVTVPTDKIAITGSVESMEDAKLLDVHPQGAISFSGKFPDMFKDITDKAEPTGEKM
FT                   EPNIEKILEMKPDVILASTKFPEKTLQKISTAGTTIPVSHISSNWKENMMLLAQLTGKE
FT                   KKAKKIIADYEQDLKEIKTKINDKAKDSKALVIRIRQGNIYIYPEQVYFNSTLYGDLGL
FT                   KAPNEVKAAKAQELSSLEKLSEMNPDHIFVQFSDDENADKPDALKDLEKNPIWKSLKAV
FT                   KEDHVYVNSVDPLAQGGTAWSKVRFLKAAAEKLTQN"
FT   CDS_pept        complement(2068..3657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="YbbB"
FT                   /db_xref="GOA:P40408"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40408"
FT                   /protein_id="BAA19497.1"
FT                   /translation="MQNAVIYQPVQIEYLKKTSDLFSEQQLADSFVLIFHLKGNGYISI
FT                   GTNTNPLQKKTLYVCPPNETFGFTPAADGHIDACIIRLLSYIKETGQDIFTPCTESELA
FT                   KLKLMNVSHIENLAVRLQELAALWNESSQLSQLKCVIEVQSLIYDLFTASLSDQTDTHS
FT                   AIEKTKHYIETHADTKITLAQLSQMAGISAKHYSESFKKWTGQSVTEFITKTRITKAKR
FT                   LMAKSNCKLKEIAHQTGYQDEFYFSRIFKKYTGCSPTSYMKKRRKKIAAYGRGTMGHLI
FT                   PLHHIPFAAALHPKWTSYYYQHYSTDIPVQLSAYRFNEKWEENLYTLSQAEPDVIVSMD
FT                   SISPEEQDRLNRIAEVMYLPSEESWRTHFLQTASFLKEESEAEKWLADYDQQTTAAKKT
FT                   LQHVQGLRFLFLRLHKQNFYLAHNRSVREVFFGDLGFSSATTADTPSEQAISLENIANY
FT                   QADCMMLFLFKEPETIAYYQQLQQTEAWQNLSAVRDNRVYLLSLDPWNEYSACGHERIV
FT                   QQTVSLLSGDCP"
FT   CDS_pept        complement(3848..5092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="YbbC"
FT                   /db_xref="InterPro:IPR008302"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40407"
FT                   /protein_id="BAA19498.1"
FT                   /translation="MRKTIFAFLTGLMMFGTITAASASPDSKNQTAKKPKVQTGIDTLL
FT                   PDYKKQLKGKRIGLITNPAGVNTSLKSSVDILYENPDIKLTALFGPEHGVRGDAQAGDE
FT                   VGSYIDEKTGVPVYSLYGKTKKPTPEMLKNVDILMFDIQDVGTRFYTYIYTMAYAMEAA
FT                   KENGIPFMVLDRPNPQGGNHIEGPILEPEYASFVGLYPIPLKHGMTIGELASLFNKEFS
FT                   IDADLTVVKMKHWKRKMDFDDTRLPFVLPSPNMPTVESTFVYPATGLIEGTNISEGRGT
FT                   TKPFELIGAPFIKSTELEETLNSLHLPGVTFRAASFTPTFSKHQGTLCHGVQLYVTDRD
FT                   KFEAVKTGLSVIKTIHDLYPEDFEFLSTGSFDKLAGNGWIRTKIENGTSVENIINSYEK
FT                   TLQQFSKTRKKYLIY"
FT   CDS_pept        complement(5106..7034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="YbbD"
FT                   /db_xref="GOA:P40406"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="PDB:3BMX"
FT                   /db_xref="PDB:3LK6"
FT                   /db_xref="PDB:3NVD"
FT                   /db_xref="PDB:4GYJ"
FT                   /db_xref="PDB:4GYK"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40406"
FT                   /protein_id="BAA19499.1"
FT                   /translation="MRPVFPLILSAVLFLSCFFGARQTEASASKRAIDANQIVNRMSLD
FT                   EKLGQMLMPDFRNWQKEGESSPQALTKMNDEVASLVKKYQFGGIILFAENVKTTKQTVQ
FT                   LTDDYQKASPKIPLMLSIDQEGGIVTRLGEGTNFPGNMALGAARSRINAYQTGSIIGKE
FT                   LSALGINTDFSPVVDINNNPDNPVIGVRSFSSNRELTSRLGLYTMKGLQRQDIASALKH
FT                   FPGHGDTDVDSHYGLPLVSHGQERLREVELYPFQKAIDAGADMVMTAHVQFPAFDDTTY
FT                   KSKLDGSDILVPATLSKKVMTGLLRQEMGFNGVIVTDALNMKAIADHFGQEEAVVMAVK
FT                   AGVDIALMPASVTSLKEEQKFARVIQALKEAVKNGDIPEQQINNSVERIISLKIKRGMY
FT                   PARNSDSTKEKIAKAKKIVGSKQHLKAEKKLAEKAVTVLKNEQHTLPFKPKKGSRILIV
FT                   APYEEQTASIEQTIHDLIKRKKIKPVSLSKMNFASQVFKTEHEKQVKEADYIITGSYVV
FT                   KNDPVVNDGVIDDTISDSSKWATVFPRAVMKAALQHNKPFVLMSLRNPYDAANFEEAKA
FT                   LIAVYGFKGYANGRYLQPNIPAGVMAIFGQAKPKGTLPVDIPSVTKPGNTLYPLGYGLN
FT                   IKTGRPL"
FT   CDS_pept        complement(7062..7295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="YbzA"
FT                   /db_xref="GOA:O05213"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR022849"
FT                   /db_xref="UniProtKB/Swiss-Prot:O05213"
FT                   /protein_id="BAA19500.1"
FT                   /translation="MEWMFGPHASENAYGHTGWTGTVTIIDPAYNLGIALLTNKKHTPV
FT                   IDPEENPNVFEGDQFPTGSYGSVITAIYEAME"
FT   CDS_pept        complement(7300..8226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="YbbE"
FT                   /db_xref="GOA:O05213"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR022849"
FT                   /db_xref="UniProtKB/Swiss-Prot:O05213"
FT                   /protein_id="BAA19501.1"
FT                   /translation="MIERDIAAGFPGAVLVVVKDGRIIKKAAYGYSKKYEGSELLRRPA
FT                   KMKTRTMFDLASNTKMYATNFALQRLVSQGKLDVYEKVSAYLPGFKDQPGDLIKGKTRY
FT                   VSLMSSSTNSGLPSSFYFYTPEKAGKYYSQERDKTIEYLTKIPLDYQTGTKHVYSDIGY
FT                   MLLGCIVEKLTGKPLDVYTEQELYKPLRLKHTLYNPLQKGFKPKQFAATERMGNTRDGV
FT                   IQFPNIRTNTLQGEVHDEKAFYSMDGVSGHAGLFSNADDMAILLQVMLNKGSYRNISLF
FT                   DQENSRPVYSTFSNRSDIRSWLEAERK"
FT   CDS_pept        complement(8473..9813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="YbbF"
FT                   /db_xref="GOA:Q45579"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:Q45579"
FT                   /protein_id="BAA19502.1"
FT                   /translation="MSKENNYHHLAQKILELCGGKSNISSYTHCMTRLRITPYDESKAD
FT                   AQALRKLDGVLGVVEAETLQIILGTGVVNHVTAAFSKLVSAEEGADVKEAAAKKKADIN
FT                   RKNATPFKLFLRKIASIFIPLIPALVASGLITGITKAIIQAGWLSADSQIAIILTVIGS
FT                   GLFTYLGILVGINASKEFGGTPALGALAGILIINPEIAKISLFGEELLPGRGGLIGVLF
FT                   AAIFIAYTEQFIRRFIPQSLDIIVTPTVSLLITGIVTYVVFMPLGGFISDAIASGLLSI
FT                   LDIGGIAAGFILGATFLPLVVTGLHQGLTPMHMELINSIGNDPLLPILAMGGAGQVGAA
FT                   FAVFVKTKKTTLRKAIAGGLPSGLLGIGEPLIFGVTLPLGRPVFNSMFRSWNRRRLSSL
FT                   FSSSHHCDWCLRTAAIFSSPAFANHPVYRWALYFLRGRFFIDLCIRI"
FT   CDS_pept        complement(9839..10756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="YbbH"
FT                   /db_xref="GOA:Q45581"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="PDB:2O3F"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q45581"
FT                   /protein_id="BAA19503.1"
FT                   /translation="MKQTVSLTKQSNITIHDKERTRMATGGLAIIQSMKHKLPPSERKL
FT                   ADYILAHPHKAIESTVNEISALANSSDAAVIRLCKSLGLKGFQDLKMRVAGDLAKPTFQ
FT                   GYRDIVPHEPLPSISEKTAGNAIQAIQDTSDLMDYKELERAVSLLLKAHTVHFIGLGAS
FT                   GIVAKDAQQKWLRIHKQATAFTDTHLVASLIANADKDDIVFAISFSGETQEIVELFAMA
FT                   KEKGITTISLTQFSQTSVSALADVPLYTAHSNEALIRSAATSSRLAQLFIIDVLFLGMA
FT                   AEQYETTTGYIDKTRAAIQSMRIK"
FT   CDS_pept        complement(10753..11673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="YbbI"
FT                   /db_xref="GOA:Q45582"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005486"
FT                   /db_xref="InterPro:IPR005488"
FT                   /db_xref="InterPro:IPR040190"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q45582"
FT                   /protein_id="BAA19504.1"
FT                   /translation="MNILNIEIYHFKTGGILMSEPLNLHRLTTESRNSQTVEIHKANTL
FT                   GILKMINNEDMKVAAAVQEVLPDIKTAVDCAYESFQNGGRLIYTGAGTSGRLGVMDAVE
FT                   CPPTYSVSPDQVIGIMAGGPEAFLQAAEGIEDSEEAGAEDLRNIQLTSNDTVIAIAASG
FT                   RTPYAAGALRYARKVGAHTIALTCNENSAISKDADHSIEVVVGPEAITGSTRMKAATAH
FT                   KMILNMISTAVMVKIGKVYENLMVDVNVSNKKLKERAISIIQSLTNASYDTARYTLEQA
FT                   DHHVKTAIVMLKSKHRSETSTDITR"
FT   CDS_pept        complement(11793..12212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="YbbJ"
FT                   /db_xref="GOA:Q45583"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q45583"
FT                   /protein_id="BAA19505.1"
FT                   /translation="MTQDISLSFYKPEHLPELQSFTLTNDDKRFTSLPKEVLSQALGIQ
FT                   DRYPVVILKDDLPVGFFILHASKETLASYSNNPFALLLSSLSLTAVHHGKGYAKKAMLL
FT                   LPAFERIFSMVRRNHLGRQSSEHTRKTPLYEKRVP"
FT   CDS_pept        complement(12225..12680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="YbbK"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q45584"
FT                   /protein_id="BAA19506.1"
FT                   /translation="MILVSSCLGGIECRYNGSHAASEKIRKLVDEKKAVMACPELLGGF
FT                   STPREPAEIIGGTGEDVLNGTAKIVTASGEDVTELYMEGAAKTLAYAKEINASAVILKE
FT                   NSPSCGSGFIYNGTFSGKKITGSGVTAALLKQAGYRVISGNELNDIL"
FT   tRNA            12856..12924
FT                   /product="tRNA-Glu"
FT   tRNA            12931..13003
FT                   /product="tRNA-Val"
FT   tRNA            13011..13084
FT                   /product="tRNA-Thr"
FT   tRNA            13106..13186
FT                   /product="tRNA-Tyr"
FT   tRNA            13194..13256
FT                   /product="tRNA-Gln"
FT   CDS_pept        13496..14059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="YbbL"
FT                   /note="putative ECF sigma factor sigW"
FT                   /db_xref="GOA:Q45585"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014294"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="PDB:5WUQ"
FT                   /db_xref="PDB:5WUR"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q45585"
FT                   /protein_id="BAA19507.1"
FT                   /translation="MEMMIKKRIKQVKKGDQDAFADIVDIYKDKIYQLCYRMLGNVHEA
FT                   EDIAQEAFIRAYVNIDSFDINRKFSTWLYRIATNLTIDRIRKKKPDYYLDAEVAGTEGL
FT                   TMYSQIVADGVLPEDAVVSLELSNTIQQKILKLPDKYRTVIVLKYIDELSLIEIGEILN
FT                   IPVGTVKTRIHRGREALRKQLRDL"
FT   CDS_pept        14073..14291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="YbbM"
FT                   /db_xref="GOA:Q45588"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="PDB:5WUQ"
FT                   /db_xref="PDB:5WUR"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q45588"
FT                   /protein_id="BAA19508.1"
FT                   /translation="MSCPEQIVQLMHMHLDGDILPKDEHVLNEHLETCEKCRKHFYEME
FT                   KSIALVRSTSHVEAPADFTANVMAKIA"
FT   CDS_pept        14863..15684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="YbbP"
FT                   /db_xref="GOA:Q45589"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR014046"
FT                   /db_xref="InterPro:IPR034701"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q45589"
FT                   /protein_id="BAA19509.1"
FT                   /translation="MAFEDIPFLQYLGNAVDILLVWYVIYKLIMVIRGTKAVQLLKGIV
FT                   VIVLVRMASQYLGLSTLQWLMDQAITWGFLAIIIIFQPELRRALEQLGRGRFFSRSGTP
FT                   VEEAQQKTIEAITKAINYMAKRRIGALLTIERDTGMGDYIETGIPLNAKVSSELLINIF
FT                   IPNTPLHDGAVIMKNNEIAAAACYLPLSESPFISKELGTRHRAAVGISEVTDSLTIIVS
FT                   EETGGVSVAKNGDLHRELTEEALKEMLEAEFKKNTRDTSSNRWYWRGRKNG"
XX
SQ   Sequence 15684 BP; 3993 A; 3289 C; 3690 G; 4712 T; 0 other;
     ttagccattt tgctcccctc cttttcgttt aattaaataa aggaagaaag gtacgccgat        60
     aatggatgtt acgacctcaa tcggtgtttc aaacggatag ttgataaatc tgcttgcgag       120
     atcacacagg gttaaaaaga ttccgcccaa aatacaggaa cacggaatca gcctgctgta       180
     atcagagccg acgagaaatc tcgtgatatg cggaacaacc aacccgacaa acgcaatttt       240
     tccggccagc gctacggcac tgccggttag aatgatgacg gaaagcatcg ccatgatttt       300
     aatggttttt ttcttttgcc ccaggctttt agaaatgtcg tcccctaatg atacagcggt       360
     tacctttttg ctgagagaaa tggccattat aatgccaatc aggaaaaacg gagcggcaag       420
     cttcaggaaa tctggactca tttgatgaag tctggcactg taccagaaac tgagatcctg       480
     agaaatttga aaataaatcg acatggccgc tgataagctg ctgagcagca tgcttgtgac       540
     tgtgccgatg atggcgagct gcacgggggt aaatccgttt ggcatcatgg cggcaaggcc       600
     gaatactaac accgctccta acgctgagcc gataaaagag tatatcatca tttcaatcga       660
     agatgattgc gggagcagaa ccatgcaaag cgtaatgata aacgctgaac catctgaaac       720
     acccataatg gatggcgaag ctaaataatt gcgcgtaatg ccctgcataa gcgctccaga       780
     aacagcaagg gctgccccta tgagcagagc gccggcagcc cttggaatcc gggaatgcca       840
     tataatttga tggtctgtgt ttcccggatc gaaatgaata agagatgtaa aaacaatatc       900
     tgtgctgaga tgctttgccc cataaaggat tgaaagcaaa agtgacagcg ctatagcaaa       960
     tggagaagta atcaatatga tacgtgtcca ctgttttgaa tacatacaaa aacctactct      1020
     gaattagttt tgtgtcaatt tttcagcagc cgctttcagg aaacggactt tgctccaagc      1080
     tgtgccgcct tgtgcgagag ggtccactga gttgacatac acatggtctt ctttgactgc      1140
     tttaaggctt ttccagattg gatttttctc taaatctttt aaggcatcag gtttgtctgc      1200
     attttcatca tcagaaaatt ggacgaaaat atggtccggg ttcatttcac ttaatttttc      1260
     taatgaactc agctcttgcg cttttgcagc ctttacttcg ttcggcgcct taaggcctaa      1320
     atcaccgtat agtgtggagt tgaaatacac ctgttcaggg taaatgtaaa tgttgccttg      1380
     tctgattctg atgacaagcg cttttgaatc tttcgcttta tcgttgattt ttgtttttat      1440
     ttcttttaga tcctgttcat agtctgcaat aattttcttt gcttttttct cttttccagt      1500
     cagctgggca agaagcatca tgttttcctt ccagtttgaa gagatatgag aaactgggat      1560
     cgtcgtgcct gctgtgctga ttttttgcag cgttttttcc ggaaactttg ttgaagcaag      1620
     gataacatct ggcttcattt caagaatctt ttcaatattt ggctccattt tttctccggt      1680
     tggttcggct ttatcagtga tgtctttgaa catatcaggg aatttgccgg agaatgaaat      1740
     tgcgccttgc ggatgaacgt caagcaattt cgcgtcttcc attgattcaa cgcttcccgt      1800
     aatggcaatt ttgtctgtcg gtacagttac ttcatatgtt ttatcaaggt attcaatttt      1860
     cttcttctca gatgctgtgc cgcttgcctt gctggcagtt gattcatttt tgctgccgca      1920
     agctgccgcc gtcagcgcga gaagtaagat taataaggta agagatatct ttttcatcta      1980
     tagagcctcc tgttcaattg ataactatta tcaattggaa ttatagagaa tgaacagata      2040
     taacaccatg gacaaattcc tgatttatca tggacaatct ccggatagta aagaaacagt      2100
     ttgctgaacg atgcgttcgt gcccgcaagc tgagtattca ttccacgggt caagggatag      2160
     aagataaaca cggttatctc gtaccgcgct taggttttgc catgcttctg tctgctgtaa      2220
     ttgctggtag taagctatgg tctccggctc tttaaaaaga aaaagcatca tacagtcagc      2280
     ttggtaattt gcgatatttt ctaacgaaat cgcttgttct gaaggtgtgt cagccgttgt      2340
     tgccgagctg aatcctaaat ccccaaagaa aacttcgcgg acacttcggt tatgagccag      2400
     atagaagttt tgcttatgca gcctcaaaaa gagaaaacgc agcccttgaa cgtgctgaag      2460
     tgtttttttg gcggccgttg tctgctggtc ataatccgct agccactttt ctgcttcgga      2520
     ctcctccttt aaaaatgagg cagtttgcag aaagtgggtt ctccagcttt cttctgaagg      2580
     aaggtacatg acttctgcga tgcgattcag gcgatcttgt tcttctggag aaatagaatc      2640
     catgctgaca atcacatctg gttctgcctg tgataacgtg tacaggtttt cttcccactt      2700
     ttcattaaac cggtatgcac tgagctggac gggtatatct gtcgaataat gctgatagta      2760
     gtaagacgtc catttcggat gcagagcggc cgcaaaaggt atgtggtgaa gagggatgag      2820
     atggcccatt gtgccccttc cgtatgcggc gattttcttt cggcgttttt tcatatagct      2880
     tgtaggtgaa cagcctgtat attttttaaa gattctgctg aaataaaatt catcttgata      2940
     accggtttgg tgtgcgattt ctttcaattt gcagtttgat tttgccatga gccgttttgc      3000
     ctttgtgatt cgtgttttcg taataaattc tgttacgctc tgtcctgtcc attttttaaa      3060
     gctttcactg tagtgtttgg cactgattcc tgccatttgc gacagctggg caagcgtgat      3120
     ttttgtatcg gcatgggttt cgatatagtg ttttgttttt tcgattgctg aatgtgtatc      3180
     cgtttgatca gataaactgg cagtaaaaag atcataaatc aggctttgta cttcaatcac      3240
     acattttagc tgagaaagct gagacgattc attccatagt gcggcaagct cttgaagccg      3300
     gactgcaaga ttttcgatat gtgaaacatt cataagcttc agtttggcta attccgattc      3360
     tgtgcacggt gtgaaaatat cttgcccggt ttccttgata tagcttagaa gcctgattat      3420
     acaggcatct atatgtccat cggctgctgg cgtaaagcca aaggtctcgt taggcggaca      3480
     aacataaagt gtcttttttt gcagaggatt ggtgtttgtt ccgatcgaaa tatagccgtt      3540
     tccttttaaa tgaaaaatca gcacgaatga atcggctaat tgctgttctg agaagagatc      3600
     acttgtcttt tttagatatt caatttgtac tggttgataa atcactgcat tttgcacgag      3660
     tagaccacct tttcagaagc tttcaattga taatcatttt caataaaaat tgtaccaaat      3720
     aaatgaaagt tttcctatat aaagcgggtg ggtttttagc atgaaaaaaa cccttactta      3780
     tgtgtaaaag taagggtctt tcgttcaata agaatatgtt acacgtgtaa catacgatgc      3840
     ttatgttcta ataaatgaga tacttttttc ttgttttgct gaattgttgg agtgtttttt      3900
     catagctgtt tatgatgttc tcaaccgaag ttccattttc aatttttgtc ctgatccagc      3960
     cgttgcctgc cagtttatcg aatgaacctg ttgacaggaa ctcaaaatcc tcaggataga      4020
     gatcgtgtat ggttttaatg actgaaagac ccgttttaac ggcttcaaac ttatctctgt      4080
     ctgtcacata gagctgcaca ccgtggcaaa gcgttccttg atgtttagaa aacgtcggtg      4140
     tgaaggatgc tgccctaaat gtaacgcccg gcaaatggag gctgtttaat gtttcttcaa      4200
     gttctgtgct tttgataaag ggagctccga tcaattcgaa tggctttgtt gtccctcgcc      4260
     cttcggatat atttgttcct tcaatcagcc cggttgcagg ataaacaaat gtgctttcca      4320
     ccgtcggcat gttaggcgaa gggaggacga aaggcaatcg ggtatcgtca aaatccattt      4380
     ttcgtttcca gtgtttcatt tttaccactg taagatcggc atcaatacta aattctttgt      4440
     tgaacagtga agccaattcg cctatcgtca tcccatgctt caatggaatg ggatacaatc      4500
     cgacaaatga ggcgtattca ggttctaaga ttggtccttc aatatgattc ccgccttgag      4560
     gattcggacg gtccagcacc ataaatggaa tgccgttttc tttagcggct tccattgcgt      4620
     atgccattgt ataaatgtac gtgtagaaac gggtcccgac atcctgaatg tcaaacatta      4680
     gaatatcgac atttttaagc atttctggag tcggtttttt cgtttttccg tagaggctgt      4740
     atacgggaac cccggttttt tcgtcaatgt aagagcctac ttcgtctcca gcctgggcgt      4800
     caccgcggac gccgtgttca gggccgaata aagctgtcag tttgatatcc gggttctcgt      4860
     aaaggatatc gacactgctt tttagagatg tgtttactcc ggctggattg gtgatcagtc      4920
     cgatgcgttt tcccttgagc tgttttttat agtctggcaa gagcgtgtct atcccagtct      4980
     ggactttagg ttttttagct gtttgattct ttgaatcggg tgaagcagag gcagcggtta      5040
     tcgttccgaa catcatgagc cctgtcagaa aagcgaatat tgtttttctc atgtgtccct      5100
     ccttattaaa gcggtcttcc cgttttgata tttaatccgt agccaagtgg gtaaagggtg      5160
     ttccctggtt tcgtgactga cggaatgtca actggaagtg tgcctttagg ttttgcctgg      5220
     ccgaatatcg ccatcactcc ggccggaata ttaggttgaa gataacggcc atttgcgtat      5280
     cctttaaagc catagactgc aatcagtgct tttgcttctt cgaaattggc tgcgtcatag      5340
     gggttgcgca ggctcattaa gacaaatggt ttgttgtgct gcagtgcggc tttcatgaca      5400
     gctctcggaa acacggtggc ccatttgctt gaatctgata ttgtgtcgtc gatgacaccg      5460
     tcgttgacga cagggtcatt tttgacgaca taggagccgg taatgatata atcagcctct      5520
     tttacttgtt tttcatgctc ggtcttaaat acttggctgg caaagttcat tttgctgagg      5580
     gatacgggtt tgattttctt tcgcttgatg agatcgtgaa tggtttgttc gattgaagca      5640
     gtttgttctt cgtaaggtgc cacaattaag attcggctgc cttttttagg cttgaacggc      5700
     aaagtgtgct gttcattttt taatacagtt actgcttttt cagctaattt tttctctgct      5760
     ttcaggtgct gcttgcttcc tacgattttt ttggctttgg ctattttttc ttttgtactg      5820
     tcgctgtttc gcgctggata catgccgcgt tttattttca gggaaatgat tctttcaact      5880
     gaattgttga tttgttgttc aggaatatcc ccgtttttca cggcttcttt caaagcttga      5940
     ataacacgtg cgaatttctg ttcttctttc aatgaagtga ctgaggctgg cattaatgca      6000
     atatcgacac cagcttttac ggccatgacc acagcctctt cctgtccgaa atgatctgcg      6060
     attgccttca tattgagcgc atcggtaacg atgaccccat taaagcccat ttcctgacga      6120
     agaagacctg tcatcacttt ttttgaaagt gtagctggaa ccagaatgtc cgatccatcg      6180
     agtttgcttt tgtaagtggt gtcatcaaag gcgggaaact gaacatgggc tgtcatcacc      6240
     atatcagcac cagcatcaat tgctttttga aaaggataaa gctcgacctc acgaagccgt      6300
     tcttggccat gggaaacgag cggcagtcca taatggctgt caacgtccgt gtctccatgt      6360
     cccgggaaat gtttgagggc agacgcgata tcctgccgct gcaacccttt catcgtatat      6420
     aaaccgaggc gtgatgtcag ttctcgattg gagctgaatg accgtacgcc gattacagga      6480
     ttatcaggat tattgttaat gtccacgaca gggctgaaat ctgtattgat gcctaaggca      6540
     gagagctctt ttccgatgat gctgccggtc tgatacgcat tgattctgct tctggctgcg      6600
     cccagcgcca tattccctgg gaaattagtg ccctccccta acctcgttac aatgccgcct      6660
     tcctgatcaa tactcagcat gagcgggatt tttggacttg ccttttggta atcgtctgtc      6720
     agttggacag tttgttttgt tgtttttaca ttttctgcaa aaaggatgat gcctccgaat      6780
     tgatatttct tgacgaggct ggcgacttca tcattcattt ttgtaagggc ttgcggagag      6840
     gactcgcctt ccttttgcca atttctaaaa tcaggcatca gcatctggcc gagtttttca      6900
     tctaacgaca tacgattgac aatctgattg gcatcgattg cacgtttgga tgcagaggct      6960
     tctgtctgtc tggccccgaa aaagcatgaa agaaagagaa cggctgaaag gataagcgga      7020
     aagacaggtc tcatagaaac ttcctcctat cgtctaatca ttcactccat cgcttcataa      7080
     atcgcggtta tgacacttcc ataactgcct gttggaaatt ggtcaccttc aaagacgttc      7140
     ggattttctt ccggatcaat aactggtgta tgctttttat ttgttaacaa tgcgatgcct      7200
     aaattgtatg ctggatcaat aattgtaact gtccccgtcc agccggtatg cccgtaagca      7260
     ttttcgctgg catgagggcc aaacatccat tccatgcttt tacttccgtt ccgcctccag      7320
     ccaagagcga atgtcggatc tgttgctgaa ggtgctgtaa acaggtcggc tgttttcctg      7380
     atcaaataaa gaaatgtttc ggtatgaacc tttgtttaac attacttgca gcagtatggc      7440
     catatcatct gcatttgaga acaatccggc atgcccagac acgccgtcca ttgagtaaaa      7500
     cgctttttcg tcatgcacct ctccttgcag cgtgtttgtg cggatgttag ggaattgaat      7560
     aacgccgtca cgtgtattgc ccatgcgttc agtagctgcg aactgtttcg gtttaaagcc      7620
     cttttgcagc ggattgtaca aggtatgctt cagcctgagc ggtttgtaga gctcttgctc      7680
     cgtgtagaca tcaagcggtt tgccggttag tttttcgaca atacatccga gtagcatata      7740
     tccaatgtca ctgtatacgt gttttgtccc ggtttgataa tcgagcggaa ttttcgtcaa      7800
     atattcaatc gttttgtccc gttcttggga atagtacttg ccggcttttt ccggcgtgta      7860
     aaagtaaaag cttgatggga gccctgaatt ggtgctggag gacatcaatg acacgtatct      7920
     tgtctttcct tttatgaggt cacccggctg atccttgaaa cccggcaaat atgcagaaac      7980
     tttttcatag acgtcaagtt ttccttggct gactaagcgc tgcaatgcaa aatttgttgc      8040
     gtacattttt gtatttgagg ctaagtcaaa catcgtgcgg gttttcattt tggccggacg      8100
     gcgcagcagt tctgatcctt cgtacttttt actgtagccg tatgctgctt tttttatgat      8160
     gcgtccatcc ttcaccacca caagaacggc gcctggaaat cctgctgcaa tatcccgttc      8220
     tatcatctga tctaccttcc ttagcttctt cgtcgagaat tgtgcagttt ctgcatttat      8280
     gattttcggc tcaatcaagt tgcctgctgt ttgtgcgaag gtttcatttg gcgcaaatat      8340
     cgatagggtt aaaatggcac tgaatatgaa cagtgtcttt gttttcacag gctagcccct      8400
     ttctgtgctt ctatcccgtt tactatccct aaaacagaaa caatttaatc gaactgagaa      8460
     gccatttcat ctttatatcc gaatgcatag gtcaataaaa aaccggccgc gtaggaaata      8520
     aagagcccaa cgatatacag gatgatttgc gaaggcagga ctagaaaaga tagcggcagt      8580
     ccggagacac caatcgcaat ggtggctact tgaaaataag cttgaaaggc gccgccgatt      8640
     ccagctccta aacatgctgt taaaaacggg acggccaagc ggcagcgtga ctccgaaaat      8700
     aagcggttca ccaatgccga gcagtcccga tggaagcccg ccggcgattg ctttcctcag      8760
     tgttgttttt ttcgtcttca cgaaaacggc aaaggccgcg cctacctgtc ctgcacctcc      8820
     catagccaaa atagggagca gaggatcatt gccaattgaa ttgatcagtt ccatgtgcat      8880
     aggcgtcaag ccttgatgca gtccggttac gacgagagga aggaaggttg cgcccagaat      8940
     aaagcccgca gcgatgccgc cgatgtccag gatggacagt aggccggatg caatagcatc      9000
     agaaatgaat ccgcctaaag gcataaatac gacatacgtt acgattccgg tgattaacag      9060
     tgaaacggtg ggtgtgacaa tgatatcaag tgattgagga ataaaacggc gaataaattg      9120
     ttcggtgtaa gcaatgaata tggctgcgaa aaggacgccg atcagacctc ccctgcccgg      9180
     gagaagctct tctccaaata aactgatttt tgcgatctcc ggattgataa tcaagatccc      9240
     ggccaaagcc ccaagtgcgg gtgtcccgcc aaattctttc gaagcgttaa taccgacgag      9300
     aatgccgaga taagtgaaca gccctgatcc gatgactgtc aggataatcg caatttgtga      9360
     gtctgcagag agccagcctg cttgaataat tgctttggta atcccagtaa ttaaaccgga      9420
     agcgactaga gcgggaataa gagggataaa aatgctggca attttacgta agaaaagttt      9480
     aaaaggagtg gcatttttcc gattgatatc ggctttcttt ttggccgctg cttctttgac      9540
     atcggcacct tcttctgctg acacgagctt tgagaaagca gctgtaacat gattgacaac      9600
     tcctgtgccg aggataattt gtaaggtttc agcttcaacg acccccaata cgccgtcaag      9660
     ctttcttaaa gcctgagcat ccgctttgct ttcatcgtaa ggcgtaatgc gcaggcgtgt      9720
     catgcaatgc gtatatgaag aaatattgga ttttcctccg catagctcaa ggattttctg      9780
     tgcgagatga tggtagttat tttctttgct cattaaaacc cctccccttc aagatgcctt      9840
     attttattct catagattgt atggctgctc tcgttttatc tatataaccg gttgtcgttt      9900
     catactgctc agccgccatg cctaaaaaca aaacatcaat tataaaaagc tgggcgaggc      9960
     gggaagaagt ggctgcactt cgaatcaagg cttcattgga atgggctgta tacaaaggga     10020
     catcagccag tgcggagacg gatgtctgac tgaattgtgt gaggctgatc gttgtgatgc     10080
     ctttttcctt agccatggcg aacagttcaa cgatttcctg tgtctctcct gaaaacgaaa     10140
     tggcgaatac gatgtcgtct ttatctgcat ttgcgattaa agatgccaca agatgagtgt     10200
     ctgtaaacgc ggttgcttgt ttatgaatgc gaagccactt ttgctgggcg tccttggcga     10260
     caatgccgga agccccgagg ccgataaaat gcacggtatg agctttgaga agcagagaaa     10320
     ccgctcgttc aagctctttg tagtccatca ggtctgaagt atcctgaatg gcttgaatgg     10380
     cattgccggc cgttttttcg gaaatggagg gcagcggctc gtggggaaca atatcccggt     10440
     agccctgaaa cgtaggcttt gccagatcgc ctgctactct catttttaaa tcttgaaatc     10500
     cttttaaacc gagtgatttg cagagcctga tgacggcagc gtcacttgaa ttggctaagg     10560
     cgctgatttc gttgaccgtg ctttcgattg ctttgtgggg atgggctagg atataatctg     10620
     caagtttgcg ctcggatgga gggagcttat gcttcattga ttggatgatc gctaaaccgc     10680
     ctgtggccat tctagttctc tccttatcat ggatggtaat gttcgattgc tttgtcaatg     10740
     aaaccgtttg cttcatcgag taatgtctgt gcttgtttct gatctgtgct tgcttttgag     10800
     catgacgatt gctgttttga cgtgatgatc ggcttgttcc agagtgtatc tggctgtgtc     10860
     gtatgaagcg tttgtaaggc tttggatgat gctgatggcg cgttctttta gttttttgtt     10920
     gctgacgttg acgtctacca tcaagttttc gtaaaccttg ccgattttga ccattacagc     10980
     ggtagatatc atgtttagaa tcattttatg agcggttgcg gctttcatac gtgttgatcc     11040
     tgtaatggcc tcaggtccga cgacaacctc aatgctgtga tccgcatcct tgctgatggc     11100
     ggaattttca ttgcaagtaa gggcgatggt gtgtgctccg actttacggg cgtatcttag     11160
     ggcgcctgcg gcgtagggtg tgcggccgct tgctgcgatg gcaatgacgg tgtcatttga     11220
     agtgagctgt atgtttctta aatcttcagc tcctgcttct tcactgtctt caatgccctc     11280
     tgctgcctgt aaaaaggctt cggggcctcc agccatgatt ccgatgacct gatctgggct     11340
     tacgctgtag gtgggaggac attcaacagc atccatgacg ccgagtctgc cgcttgtgcc     11400
     ggcgcctgta tatatgagcc ggcctccatt ttgaaacgat tcatatgcgc agtctacagc     11460
     tgttttgatg tcggggagaa cctcctgaac ggctgcagcg actttcatat cttcgttgtt     11520
     gatcatttta aggatgccga gagtgtttgc tttgtggatt tcaactgttt gactattgcg     11580
     tgattccgtt gtaagacggt gaaggtttaa tggttctgac atgaggatgc cccctgtttt     11640
     aaaatgatat atctcaatat tcagtatatt catttctgtt atgatatttc aactatgttt     11700
     ttaaattttt gaaattttat ttcacttaag actataagaa atgatgaagg atcaactgtt     11760
     ctccaagcgg cccgattctt cgccgtcctt tatcaaggaa cccgcttttc atataaaggt     11820
     gttttgcgcg tatgttcaga tgattgacgg ccaagatgat ttcgtcgcac catggaaaat     11880
     atccgctcaa aagcgggaag caaaagcatg gcttttttcg catagccttt tccgtgatgc     11940
     acagcggtta aagacaggga gctgagcagt aaagcaaatg gattgttaga ataggaagca     12000
     agcgtttctt ttgatgcatg taaaatgaaa aaaccgactg gaaggtcgtc ttttaagatg     12060
     acaaccgggt atcggtcctg tatgcccaga gcctgagaca gcacctcttt cgggagggag     12120
     gtaaagcgtt tgtcatcgtt ggtgagcgtg aatgattgga gctcgggcaa gtgttcaggc     12180
     ttatagaagg ataaagaaat gtcttgagtc atggggtggc ctccttacaa tatgtcgtta     12240
     agctcgtttc ccgaaatgac gcggtagccc gcttgtttta acagtgcggc ggttactccg     12300
     ctgccggtga tttttttgcc agagaatgtg ccgttataga taaaaccgct tccgcaagat     12360
     ggactgtttt cttttaatat gacggcagaa gcgttgattt cttttgcgta agccaatgtt     12420
     ttcgcggcgc cttccatata tagttctgtg acgtcttctc ctgaagctgt cacgattttc     12480
     gctgttccat tgaggacatc ctcgccagtg cctcctatga tttctgcggg ttcgcgtggg     12540
     gtagagaagc cgccgagaag ttcagggcaa gccatgactg ctttcttttc atcgactagt     12600
     tttctgattt tctccgacgc tgcgtgagag ccgttatatc tgcattcaat gcctccaagg     12660
     caagaactga ctagaatcat attggtttct cctctcttgc tttgcttgtc tctatcataa     12720
     aataaatggc tttagttgga gcttttcagt taaaaaagag ttaaaaagtt tgaaaataaa     12780
     aaatttaatt ttcctcttta caaacagggg gtgacctgta tataataact tttgtcagct     12840
     cgacgagaac acaacggccc gttggtaaac ggttaagcac cgccctttca cgcggtaaca     12900
     cgggttcgaa tcccgtacgg gtcaccattt ggaggattag ctcagctggg agagcatctg     12960
     ccttacaagc agagggtcgg cggttcgagc ccgtcatcct ccaccatctt gccggtgtag     13020
     ctcaattggt agagcaactg acttgtaatc agtaggttgg gggttcaagt cctcttgccg     13080
     gcactgtttt ttcaaaattt tatgtggagg ggtagcgaag tgctaaacgc ggcggactgt     13140
     aaatccgctc cctcagggtt cggcagttcg aatctgcccc cctccaccat tattgggcta     13200
     tagccaagcg gtaaggcaac ggactttgac tccgtcatgc gttggttcga atccagctag     13260
     cccagtcaca gacacctttg atcaaaaggt gtcttttttc ttttcggaaa aatcattcca     13320
     acttctaact gttcagtctg tataataatt ttaaaaatat gttaaggtag tttattcacg     13380
     aattaccatc tacaccctgc caaaaatttg ataaacttat tttataaaaa aattgaaacc     13440
     ttttgaaacg aagctcgtat acatacagac cggtgaaggc agaggttaga taaatatgga     13500
     aatgatgatt aaaaaaagaa ttaaacaagt caaaaaaggc gaccaggatg catttgcgga     13560
     catcgtagat atttacaaag ataaaattta tcagctttgc taccgtatgc ttggcaatgt     13620
     gcatgaggcg gaggatattg cacaggaagc tttcatcaga gcgtacgtta atatcgacag     13680
     ttttgatatt aaccggaaat tttcaacttg gctttatcga atcgcgacca atttgaccat     13740
     tgaccgcatt cgcaaaaaga agccggatta ttacctcgac gcagaggtgg ctggtacgga     13800
     aggcttgacc atgtattctc aaatcgtcgc agatggtgtt ttgcctgaag atgcagttgt     13860
     atcgctggag ctctcaaaca cgatacagca gaaaatttta aagcttcctg acaaatacag     13920
     aacagtcatc gtattaaagt atattgacga actctcatta attgaaatcg gggagattct     13980
     aaacattcct gtggggactg tgaaaacgcg gattcacaga ggcagagagg ctcttagaaa     14040
     acaattaagg gatctttaag tggggtgatg aaatgagctg tcctgaacaa attgtgcagc     14100
     ttatgcatat gcatcttgat ggagatatcc ttccaaaaga tgaacacgta ttaaatgaac     14160
     atctggagac atgcgagaaa tgcagaaagc atttttacga gatggagaaa tccatagcgc     14220
     tcgtacggag cacatcgcat gtcgaagccc ccgcggattt taccgctaat gtcatggcaa     14280
     aaattgccta aggagaagaa agagctttct gtaaaaagat ggttcagaac ccatcccgtt     14340
     atcgcagctg ctgcggtatt catcattttg atgggcgggg ggttttttta acagctggca     14400
     taatgaccac aatttcagcg tgtccaagca gccgaatctt gtggttcata accacactgt     14460
     gaccgtgcca gaaggtgaga cggtcaaagg tgatgtcact gtcaaaaacg gcaagctgat     14520
     tattaaaggc aaaatagacg gggatgtaac cgtcgtaaac ggcgaaaagt atatggcctc     14580
     tgctggacaa gtcaccggtc agattgaaga aatcaatcag ttattcgact ggacatggta     14640
     caagatgaag tctgcgggga aaagtgtact cgatgcattc aatccgaacg gagaagagta     14700
     aagcgcgtta gcgctttgct ctttttttgc gggctgagag ggctggcaca tttcactttg     14760
     ctaaatcgga aatgtggtat aatgggctcg ctatgtaaag tacatatgcg taacacgtaa     14820
     aacacaaaat acgaaatgac tgaaatcttg gaggacgagg aaatggcttt tgaggatatc     14880
     ccttttttgc agtacctcgg caatgccgtt gatattctcc ttgtttggta tgtgatatat     14940
     aaattgatta tggtgatacg cggcacgaaa gcggttcagc tgttaaaagg aattgtagtc     15000
     atcgtgcttg ttcgtatggc cagccaatat ttgggcctca gcacacttca atggctgatg     15060
     gaccaagcga taacatgggg atttttagca attattatta tttttcagcc tgagctgaga     15120
     agagcgcttg aacagctagg ccgcggccgc tttttttcga ggagcggcac gcctgttgaa     15180
     gaagcgcagc agaaaacgat tgaggccatt acaaaagcaa tcaattatat ggcgaaacgc     15240
     cgtataggcg ccctgctgac cattgagcgg gatactggaa tgggcgatta tattgagacc     15300
     ggcataccac taaatgccaa agtcagctct gagctgctga tcaatatttt tattccaaac     15360
     accccgcttc atgacggtgc ggtaattatg aaaaataatg aaattgccgc ggccgcctgt     15420
     tatctgccgc tttctgagag cccgtttatt tcaaaagaac tgggcacgcg gcacagagca     15480
     gctgtcggta tcagtgaagt aacagacagt ttgacgatta ttgtgtctga agagaccggc     15540
     ggcgtcagtg tggcaaagaa cggcgacctt cacagagagc ttacagaaga agcgctgaaa     15600
     gaaatgcttg aagccgagtt taagaaaaac accagagaca cttcttctaa ccgctggtat     15660
     tggaggggca ggaaaaatgg ataa                                            15684
//

If you have problems or comments...

PBIL Back to PBIL home page