(data stored in ACNUC13479 zone)

EMBL: AB005237

ID   AB005237; SV 1; linear; genomic DNA; STD; PLN; 87835 BP.
XX
AC   AB005237;
XX
DT   18-JUL-1997 (Rel. 52, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 10)
XX
DE   Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MJJ3.
XX
KW   .
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-87835
RA   Nakamura Y.;
RT   ;
RL   Submitted (02-JUL-1997) to the INSDC.
RL   Yasukazu Nakamura, Kazusa DNA Research Institute, Department of Plant Gene
RL   Research; 1532-3, Yana, Kisarazu, Chiba 292-0812, Japan
RL   (E-mail:ynakamu@kazusa.or.jp, Tel:81-438-52-3935, Fax:81-438-52-3934)
XX
RN   [2]
RX   DOI; 10.1093/dnares/4.3.215.
RX   PUBMED; 9330910.
RA   Sato S., Kotani H., Nakamura Y., Kaneko T., Asamizu E., Fukami M.,
RA   Miyajima N., Tabata S.;
RT   "Structural analysis of Arabidopsis thaliana chromosome 5. I. Sequence
RT   features of the 1.6 Mb regions covered by twenty physically assigned P1
RT   clones";
RL   DNA Res. 4(3):215-230(1997).
XX
DR   MD5; 3eaae837ecd81a30e2e6b4f2d21d091b.
DR   ENA-CON; BA000015.
DR   GOA; F2Q9V4.
DR   InterPro; IPR010264; Self-incomp_S1.
DR   RFAM; RF00005; tRNA.
DR   UniProtKB/Swiss-Prot; F2Q9V4; SPH6_ARATH.
XX
CC   Address for correspondence: kaos@kazusa.or.jp
CC   For the latest information on annotation of this clone, please see
CC   http://www.kazusa.or.jp/kaos/cgi-bin/agd_graph.cgi?c=MJJ3
CC   Genes with similarity to proteins in the databases are described
CC   in 'product' or 'note' qualifiers.  Genes that have no significant
CC   protein similarity are described as 'unknown protein'.
CC   The software programs used to predict genes include:
CC   Grail (Informatics Group, Oak Ridge National Laboratory,
CC   http://compbio.ornl.gov/Grail-1.3/),
CC   GENSCAN (Chris Burge, MIT, http://CCR-081.mit.edu/GENSCAN.html),
CC   NetGene2 (S.M. Hebsgaard, et al., CBS, Technical University of
CC   Denmark, http://www.cbs.dtu.dk/services/NetGene2/) and
CC   SplicePredictor (Volker Brendel, Stanford University,
CC   http://gremlin1.zool.iastate.edu/cgi-bin/sp.cgi).
CC   Genes encoding tRNAs are predicted by tRNAscan-SE
CC   (Sean Eddy, Washington University School of Medicine, St. Louis,
CC   http://genome.wustl.edu/eddy/tRNAscan-SE/).
CC   This sequence may not be the entire insert of this clone.
CC   It may be shorter because we remove overlaps between
CC   neighboring submissions.
CC   The 5' clone is MOP10 and the 3' clone is K18J17.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..87835
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="5"
FT                   /ecotype="Columbia"
FT                   /mol_type="genomic DNA"
FT                   /clone_lib="Mitsui P1"
FT                   /clone="MJJ3"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        join(63..191,310..622,711..1111,1255..1308,1383..1487,
FT                   1590..1664,1757..1801,1946..2074,2184..2288,2374..2442)
FT                   /codon_start=1
FT                   /product="tubulin gamma-2 chain"
FT                   /note="gene_id:MJJ3.1"
FT                   /note="sp|P38558"
FT                   /db_xref="GOA:P38558"
FT                   /db_xref="InterPro:IPR000217"
FT                   /db_xref="InterPro:IPR002454"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR017975"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR023123"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/Swiss-Prot:P38558"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09656.1"
FT                   /translation="MPREIITLQVGQCGNQIGMEFWKQLCLEHGISKDGILEDFATQGG
FT                   DRKDVFFYQADDQHYIPRALLIDLEPRVINGIQNGEYRNLYNHENIFLSDHGGGAGNNW
FT                   ASGYHQGKGVEEEIMDMIDREADGSDSLEGFVLCHSIAGGTGSGMGSYLLETLNDRYSK
FT                   KLVQTYSVFPNQMETSDVVVQPYNSLLTLKRLTLNADCVVVLDNTALNRIAVERLHLTN
FT                   PTFAQTNSLVSTVMSASTTTLRYPGYMNNDLVGLLASLIPTPRCHFLMTGYTPLTVERQ
FT                   ANVIRKTTVLDVMRRLLQTKNIMVSSYARNKEASQAKYISILNIIQGEVDPTQVHESLQ
FT                   RIRERKLVNFIDWGPASIQVALSKKSPYVQTSHRVSGLMLASHTSIRHLFSRCLSQYDK
FT                   LRKKQAFLDNYRKFPMFADNDLSEFDESRDIIESLVDEYKACESPDYIKWGMEDPGQLM
FT                   TGEGNASGVADPKLAF"
FT   CDS_pept        3264..4736
FT                   /codon_start=1
FT                   /note="contains similarity to cationic amino acid
FT                   transporter 1"
FT                   /note="gene_id:MJJ3.2"
FT                   /db_xref="GOA:Q9FFL1"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9FFL1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09657.1"
FT                   /translation="MTELSSPNLDSASQKPRISTENPPPPPPHISIGVTTGDPATSPAR
FT                   TVNQIKKITVLPLVFLIFYEVSGGPFGIEDSVKAAGPLLAIVGFIVFPFIWSIPEALIT
FT                   AEMGTMFPENGGYVVWVTLAMGPYWGFQQGWVKWLSGVIDNALYPILFLDYLKSGIPIL
FT                   GSGIPRVAAILVLTVALTYLNYRGLSIVGVAAVLLGVFSILPFVVMSFMSIPKLKPSRW
FT                   LVVSKKMKGVNWSLYLNTLFWNLNYWDSVSTLTGEVENPSKTLPRALFYALLLVVFSYI
FT                   FPVLTGTGAIALDQKLWTDGYFADIGKVIGGVWLGWWIQAAAATSNMGMFLAEMSSDSF
FT                   QLLGMAERGMLPEVFAKRSRYRTPWVGILFSASGVIILSWLSFQEIVAAENLLYCFGMV
FT                   LEFITFVRLRMKYPAASRPFKIPVGVLGSVLMCIPPTVLIGVIMAFTNLKVALVSLAAI
FT                   VIGLVLQPCLKQVEKKGWLKFSTSSHLPNLME"
FT   CDS_pept        5329..6300
FT                   /codon_start=1
FT                   /note="gene_id:MJJ3.3"
FT                   /note="similar to unknown protein"
FT                   /note="sp|P03515"
FT                   /db_xref="GOA:Q9FFL0"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FFL0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09658.1"
FT                   /translation="MEEALSEALSSFDFDELVASLADAIAATSTPKPLVEFSLHALMAE
FT                   LFKRTKTLPKAEVSRTFFRAVSIGLLRGNIRKDQLERTCDAGKAIIKRVAAILGIEIRD
FT                   KGQRKLVLTNKTVTFSRMIAIFPHWASQLMVSKESLFVNRFASFNDANRFPAQTHKLPI
FT                   AMLHSGFAGLIPRESDDMEFIDLICMCHSAFMAEFSLLITPQEQRSFHALYENQKRYTE
FT                   AARGSGFNSDENRIVYLLRFGLLSSDSLDKMLKVAARVSTLSARQEEASVTRDSFTIVE
FT                   DRVKIVNDDAKWDELLKKAKRIVDASSSMRSQVAAVDSLDGV"
FT   CDS_pept        complement(7255..7632)
FT                   /codon_start=1
FT                   /note="gb|AAF02137.1"
FT                   /note="gene_id:MJJ3.4"
FT                   /note="similar to unknown protein"
FT                   /db_xref="GOA:Q9FFK9"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FFK9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09659.1"
FT                   /translation="MDQLSEKQIWYYHIIPEYQTEKSFYACVRRSGMIKFDTFYFPHML
FT                   SARETQRSIKFGDGVWSGCLYDPDIYTDGKISIQGVGGVLFPREAEIGGCVCLCLIFLI
FT                   KLGLSTKYMKSHVSFDVSCDL"
FT   CDS_pept        9650..10282
FT                   /pseudo
FT                   /note="gb|AAF02134.1"
FT                   /note="gene_id:MJJ3.5"
FT                   /note="similar to unknown protein"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(join(11836..11997,12102..12191,12278..12653,
FT                   12819..13009,13236..13403,13534..13696,14495..14634,
FT                   15024..16196))
FT                   /codon_start=1
FT                   /note="contains similarity to unknown protein"
FT                   /note="gb|AAF47871.1"
FT                   /note="gene_id:MJJ3.6"
FT                   /db_xref="GOA:Q9FFK8"
FT                   /db_xref="InterPro:IPR000967"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR034078"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9FFK8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09660.1"
FT                   /translation="MTNMAGTATTEFRWKSPPQPPSQEQPISDSDSDSGSDSENHQHRH
FT                   NDLSNSIFEAYLDCHSSSSPSSIDLAKIQSFLASSSSGAVSCLICLERIKRTDPTWSCT
FT                   SSCFAVFHLFCIQSWARQCLDLQAARAVTRPSSNPTEPEAVWNCPKCRSSYQKSKIPRR
FT                   YLCYCGKEEDPPADNPWILPHSCGEVCERPLSNNCGHCCLLLCHPGPCASCPKLVKAKC
FT                   FCGGVEDVRRCGHKQFSCGDVCERVLDCNIHNCREICHDGECPPCRERAVYKCSCGKVK
FT                   EEKDCCERVFRCEASCENMLNCGKHVCERGCHAGECGLCPYQGKRSCPCGKRFYQGLSC
FT                   DVVAPLCGGTCDKVLGCGYHRCPERCHRGPCLETCRIVVTKSCRCGVTKKQIWDDMTNK
FT                   IVYCKISTHARGMTLFVACSLQRSMCSLSNNGNNILCLWCHGPRPPPNREFILKPTKKM
FT                   LHIQAESTPGSPCPRCPEPVWRPCVGHHLAAEKRMICSDRTQFACDNLCGNPLPCGNHY
FT                   CSYFCHALDIRSSSLDKRSESCEKCDLRCQKERTPRCQHPCPRRCHPEDCPPCKTLVKR
FT                   SCHCGAMVHAFECIYYNTMSEKDQMKARSCRGPCHRKLPNCTHLCPEICHPGQCPLPEK
FT                   CGKKVSICQFISIWDAVSVTSEILLVSILSWIKVVVRCKCLTLKKEWVCQDVQAAHRAT
FT                   GSDPKEVPKNQFGVGLLPCDSNCKSKLQVAESVLTQRNVKEIEEKEEPSGKNASKRRKR
FT                   RGRGQDIQETTRLQKLAVTTKRILMVVMLVAMLAAVSYYGYKGLLWLSDWMNEVEEQRQ
FT                   KSRRYPRI"
FT   CDS_pept        complement(join(16639..16828,16924..17055,17181..17329,
FT                   17435..17521,17680..17762,18116..18257))
FT                   /codon_start=1
FT                   /product="signal recognition particle receptor beta
FT                   subunit-like protein"
FT                   /note="gene_id:MJJ3.7"
FT                   /db_xref="GOA:Q9FFK7"
FT                   /db_xref="InterPro:IPR019009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FFK7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09661.1"
FT                   /translation="MENLEDLKILAEQWSHQGIEYLQKIPPNQLYAAIGVLLFTTILLF
FT                   LSIRLVRRTKSNTVLLSGLTGSGKTVLFYQLRDGSSHQGTVTSMEPNEGTFVLHSENTK
FT                   KGKIKPVHLVDVPGHSRLRPKLEEFLPQAAAIVFVVDALEFLPNCRAASEYLYEILTNA
FT                   NVVKKKIPVLLCCNKTDKLTAHTKEFIRKQMEKEIEKLRASRSAVSTADIANDFTIGIE
FT                   GEVFSFTHCSNKVTVAEASGLTGETIQIEDFIREYIKP"
FT   CDS_pept        join(19088..19375,19702..19853,19979..20101,20350..20494,
FT                   20622..20683,21115..21331,21567..22490,22581..22830,
FT                   22927..23198)
FT                   /codon_start=1
FT                   /note="gene_id:MJJ3.8"
FT                   /note="pir||F71190"
FT                   /note="similar to unknown protein"
FT                   /db_xref="GOA:Q9FFK6"
FT                   /db_xref="InterPro:IPR019321"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR037700"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9FFK6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09662.1"
FT                   /translation="MKFNFNETEDAPDSRRSPTPKEPVRWVPLQSHPVFASLPSSQDEP
FT                   AVSQLFPRNFMAWDGDSRVYYWDSRRYLLHRLSLRLGEPEPSSVLAAVPSKVMQPDLQV
FT                   TFSVSKISINKSGSAVLLAGSDGICVMYLFGRASVIEDNVICRVVSIGSEIYTSSDSAI
FT                   TLLQASWHPDSDTHLGILSSDAVFRLFDLSSDTELPEQEYYLQPGEPGRSRTASSIYPA
FT                   DFSFGGDHLWDRFTVFILFTDGSIYILCPVVPFGSVYKWESVMEIYNDANMYGVKSSNS
FT                   LAVSNSSLAIEWLEATFPDLTEQGTRGENILVVKAQPYALLDASLALQGPLYKASSGDG
FT                   DEDFAVREAECKGRAVSLLYNLVSKDSILVTAWSAGQLQVDALVDEIQPVWISGNSSRL
FT                   RMNSHNKIQGVAMICESNISELPVATSNLPLDHTVWLGHPPPLLRLAMVDLALPKMREG
FT                   GSLVTLFADSLLPERIYSLHDGGIDSTVLHSLPFTSQASGKDEALKTPSVHTVLSTCQE
FT                   ESAVSPLLGFVPLSDSFGYSWIVAVLSSGECIVAEMKTWDLLLPIHVSTDKTVSSSAIE
FT                   KKEQENSCIISKELLAGPKIRIAPHALPNQRSTPANSVEGRSILLDYVKLFHENYIEYA
FT                   HKVHFELQHHAPNLKRIIDDQHQRLAEANEKISKVEKNQSFLEKRIDKAIERHDSLEQC
FT                   LQRLRSLPGTHKKPLTRAELDFKSELDQYAGVEVDALQSSIETLRARVKKSTQKSHKGT
FT                   VVAASQKKQYSKKNLIQDTQMSQLQSTLAKLSLMNSDNSKKVKIVESALKSQESSFM"
FT   CDS_pept        complement(join(23630..23729,23827..23957,24049..24155,
FT                   24241..24319,24413..24499,26236..26484,26572..26721,
FT                   26913..27428))
FT                   /codon_start=1
FT                   /product="cytochrome P450 90A1"
FT                   /note="gene_id:MJJ3.9"
FT                   /note="sp|Q42569"
FT                   /db_xref="GOA:Q42569"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q42569"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09663.1"
FT                   /translation="MAFTAFLLLLSSIAAGFLLLLRRTRYRRMGLPPGSLGLPLIGETF
FT                   QLIGAYKTENPEPFIDERVARYGSVFMTHLFGEPTIFSADPETNRFVLQNEGKLFECSY
FT                   PASICNLLGKHSLLLMKGSLHKRMHSLTMSFANSSIIKDHLMLDIDRLVRFNLDSWSSR
FT                   VLLMEEAKKITFELTVKQLMSFDPGEWSESLRKEYLLVIEGFFSLPLPLFSTTYRKAIQ
FT                   ARRKVAEALTVVVMKRREEEEEGAERKKDMLAALLAADDGFSDEEIVDFLVALLVAGYE
FT                   TTSTIMTLAVKFLTETPLALAQLKEEHEKIRAMKSDSYSLEWSDYKSMPFTQCVVNETL
FT                   RVANIIGGVFRRAMTDVEIKGYKIPKGWKVFSSFRAVHLDPNHFKDARTFNPWRWQSNS
FT                   VTTGPSNVFTPFGGGPRLCPGYELARVALSVFLHRLVTGFSWVPAEQDKLVFFPTTRTQ
FT                   KRYPIFVKRRDFAT"
FT   CDS_pept        complement(join(33673..33789,33917..34274,34456..35556,
FT                   35787..35937,36030..36068,36230..36362))
FT                   /codon_start=1
FT                   /product="arginine-tRNA-protein transferase 1 homolog"
FT                   /note="gene_id:MJJ3.10"
FT                   /db_xref="GOA:Q9ZT48"
FT                   /db_xref="InterPro:IPR007471"
FT                   /db_xref="InterPro:IPR007472"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017137"
FT                   /db_xref="InterPro:IPR030700"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ZT48"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09664.1"
FT                   /translation="MSLKNDASSSHDGGSNRESVIDDHGRRKSTCGYCKSPARSSISHG
FT                   LSAQTLTVYDYQALIDRGWRRSGTYLYKHEMDKTCCPPYTIRLKASDFVPTKEQQRVSR
FT                   RLERFLDGKLDVQPREQRGASSSGDVSDTRRKTLGAAKSEENKKVEAVMDDLSKNIDQA
FT                   VQLCIRSGEFPSNMQIPKASVKKVFCARRKKLAEGTEQILYTSNIAFPIAAAIKRIQTS
FT                   EKEGINSAEGNRLSPETISEMLLSAMHKVGETPDVSIKVCKGHINFLSSAKDSFSDRDV
FT                   VPNGNISRGANSLDGSETLHAKKDSENHQARKRKLEIHLKRSSFDPEEHELYKRYQLKV
FT                   HNDKPGHVVESSYRRFLVDSPLIDVQPSGDEKVPPCGFGSFHQQYRIDGRLIAVGVVDI
FT                   LPKCLSSVYLFWDPDYAFLSLGKYSAIQEINWVIENQARCPSLQYYYLGYYIHSCSKMR
FT                   YKAAYRPSELLCPLRFQWVPFEVARPMLDKKPYVILSDIAISHNQCSLLAGASETLVEP
FT                   AASEHEDMEQGETNDNFMGCSDEDEDEDEDDDDDDDDDEEMYETESEDSHIESDPGSKD
FT                   NDINNILIGLYGSQYRYKEMRQIITPVGRKQLEPMLQSYRKVVGAELSERMVYEIN"
FT   CDS_pept        36666..37100
FT                   /codon_start=1
FT                   /product="AtPH1-like protein"
FT                   /note="gene_id:MJJ3.11"
FT                   /db_xref="GOA:Q9FFK5"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FFK5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09665.1"
FT                   /translation="MASLWRAVIGGQNNNSEDYGGVEFWSNPERTGWLTKQGEYIKTWR
FT                   RRWFVLKQGKLFWFKDSDVTRVSRPRGVVPVESCLTAKGAEDVLNKQNAFELSTRNETM
FT                   YFIADSEKEKEDWINSIGRSIVQNSRSVTDSEIVDYDNKH"
FT   CDS_pept        complement(37253..37412)
FT                   /pseudo
FT                   /note="gene_id:MJJ3.12"
FT                   /note="unknown protein"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        join(37594..37595,37711..37821,37889..38003,38086..38118,
FT                   38442..38723,38896..38961,39090..39297,39470..39552,
FT                   39757..39976,40083..40264)
FT                   /codon_start=1
FT                   /note="gene_id:MJJ3.13"
FT                   /note="pir||T06154"
FT                   /note="similar to unknown protein"
FT                   /db_xref="GOA:Q9FFK4"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FFK4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09666.1"
FT                   /translation="MSWIIVKNLPSKHVTEERLRDVFSRKGEIADVKLKRKSDGKSRQF
FT                   AYIGFRTEQEAQDAITYVNKCFIDTYRISVEVADPPPREEGKVSPDGADEPNKAKISLL
FT                   DSKKTRKIKVVALVGDDVSDMEYYKSRTKKNLSDSDSDCETYGCEDAIHVFPIDGDIEA
FT                   DRVDKEFTIHVFGFGHQDVVFLEPIEAREALKGMGVQALQRCSPVSGAPRDILEPKALA
FT                   DNNENTSDVEENDVRRRLNLDQQVGIDSDITEVCPLYDCCGRFETMCSSFYSELQDTDE
FT                   SLKKHLTELVKQGKILSFKGTVVDGHALILSFSKNKPSGTVGKDLDKDTILTKLHVKNI
FT                   AFEATMKEVRQLFTPFGQIKSVGLPERTKGRYAACSSLTSLNASSTRYLPSLQVIEWKK
FT                   VDNSMKAIRYRSAAKYVDQENNNPKKRKSSTVVG"
FT   CDS_pept        complement(join(40463..40873,40967..41200,41279..41335,
FT                   41423..41669,41764..41879,41999..42150,42663..42858,
FT                   42951..43135,43345..43534))
FT                   /codon_start=1
FT                   /product="anthranilate synthase component I-1 precursor"
FT                   /note="gene_id:MJJ3.14"
FT                   /note="sp|P32068"
FT                   /db_xref="GOA:P32068"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/Swiss-Prot:P32068"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09667.1"
FT                   /translation="MSSSMNVATMQALTFSRRLLPSVASRYLSSSSVTVTGYSGRSSAY
FT                   APSFRSIKCVSVSPEASIVSDTKKLADASKSTNLIPIYRCIFSDQLTPVLAYRCLVKED
FT                   DREAPSFLFESVEPGSQMSSVGRYSVVGAQPAMEIVAKENKVIVMDHNNETMTEEFVED
FT                   PMEIPRKISEKWNPDPQLVQDLPDAFCGGWVGFFSYDTVRYVEKRKLPFSKAPEDDRNL
FT                   PDMHLGLYDDVVVFDHVEKKAYVIHWIRLDGSLPYEKAYSNGMQHLENLVAKLHDIEPP
FT                   KLAAGNVNLQTRQFGPSLDNSNVTCEEYKEAVVKAKEHILAGDIFQIVLSQRFERRTFA
FT                   DPFEVYRALRVVNPSPYMGYLQARGCILVASSPEILTKVKQNKIVNRPLAGTSKRGKNE
FT                   VEDKRLEKELLENEKQCAEHIMLVDLGRNDVGKVTKYGSVKVEKLMNIERYSHVMHISS
FT                   TVTGELQDGLTCWDVLRAALPVGTVSGAPKVKAMELIDELEPTRRGPYSGGFGGVSFTG
FT                   DMDIALSLRTIVFPTACQYNTMYSYKDANKRREWVAYLQAGAGVVADSDPQDEHCECQN
FT                   KAAGLARAIDLAESAFVKK"
FT   CDS_pept        complement(join(44746..45000,45132..45292,45388..45595,
FT                   45690..45843,45943..46036,46121..46226,46325..46399,
FT                   46533..46781,46978..47112,47255..47327,47422..47582))
FT                   /codon_start=1
FT                   /note="gene_id:MJJ3.15"
FT                   /note="pir||S77290"
FT                   /note="similar to unknown protein"
FT                   /db_xref="GOA:Q9FFK3"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9FFK3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09668.1"
FT                   /translation="MNLAVASFRGNFGVLSQCSSCCSLQFQPFVAATSSLNFGQTGTSR
FT                   RKKDLKLERVFRKRETLVRVTETQTEPEGNDDEDNKEGKESSADDPPTKIPTELNSQST
FT                   VVNEAPGNEEENKAQFSSQDGDKLEVSSGSPLPGVNVSIIIHVIYKDDSIMFSGCLSFI
FT                   KSCCEQPLQLDDSMRLPKETIDILRGQVFGFDTFFVTSQEPYEGGVLFKGNLRGKPATS
FT                   YEKIKTRMENNFGDQYKLFLLTNPEDDKPVAVVVPRRSLEPETTAVPEWFAAGSFGLVA
FT                   LFTLFLRNVPALQSDLLSAFDNLELLKDGLPGALVTALVLGVHELGHILVANSLGIKLG
FT                   VPFFVPSWQIGSFGAITRIKNIVAKREDLLKVAAAGPLAGFSLGLILFLIGLFVPPSDG
FT                   IGVVVDASVFHESFLAGGIAKLLLGDALKEGTSISLNPLVIWAWAGLLINGINSIPAGE
FT                   LDGGKIAFSIWGRKTATRLTGASIALLGLSALFSDVAFYWVVLIFFLQRGPIAPLAEEI
FT                   TVPDDKYVSLGILVLFLSLLVCLPYPFAFTGNEAMMIGL"
FT   CDS_pept        48318..49202
FT                   /codon_start=1
FT                   /product="DnaJ-like protein"
FT                   /note="gene_id:MJJ3.16"
FT                   /db_xref="GOA:Q9FFK2"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FFK2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09669.1"
FT                   /translation="MDGNKDDALKCLKIGKDAIEAGDRSRALKFLEKARRLDPNLPIDG
FT                   LVSDLKKQSDEPAAEEDSPGSAANESSKPSDRPSLRQRGSSSSAAGSSSSSSSTEEQRT
FT                   IVREIKSKKDYYEILGLKSNCSVEDLRKSYRKLSLKVHPDKNKAPGSEEAFKSVSKAFQ
FT                   CLSNEDTRRKYDGSGSDEPAYQPRRDARRNNGFNGFYDDEFDADEIFRSFFGGGEMNPA
FT                   TTQFRSFNFGGGTRTANQASDTGFNPRVLLQILPVVFILLLNFLPSPQPIYSLSHRITT
FT                   SSNSPRIGASLTL"
FT   CDS_pept        complement(join(49834..49993,50079..50276,50390..50434,
FT                   50513..50658,50757..51007,51416..51626))
FT                   /codon_start=1
FT                   /product="t-SNARE SED5"
FT                   /note="gb|AAC06291.1"
FT                   /note="gene_id:MJJ3.17"
FT                   /db_xref="GOA:Q9FFK1"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR006012"
FT                   /db_xref="InterPro:IPR010989"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9FFK1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09670.1"
FT                   /translation="MGSTFRDRTVELHSLSQTLKKIGAIPSVHQDEDDPASSKRSSPGS
FT                   EFNKKASRIGLGIKETSQKITRLAKLAKQSTIFNDRTVEIQELTVLIRNDITGLNMALS
FT                   DLQTLQNMELADGNYSQDQVGHYTAVCDDLKTRLMGATKQLQDVLTTRSENMKAHENRK
FT                   QLFSTKNAVDSPPQNNAKSVPEPPPWSSSSNPFGNLQQPLLPPLNTGAPPGSQLRRRSA
FT                   IENAPSQQMEMSLLQQTVPKQENYSQSRAVALHSVESRITELSGIFPQLATMVTQQGEL
FT                   AIRIDDNMDESLVNVEGARSALLQHLTRISSNRWLMMKIFAVIILFLIVFLFFVA"
FT   CDS_pept        55210..55578
FT                   /codon_start=1
FT                   /note="gene_id:MJJ3.18"
FT                   /note="unknown protein"
FT                   /db_xref="GOA:Q9FFK0"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9FFK0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09671.1"
FT                   /translation="MSSRGFNIKARGLCNNNNGGGGTGAKCGRWNPTVEQVKLLTDLFK
FT                   AGLRTPSTDQIQKISMELSFYGKIESKNVFYWFQNHKARERQKCRKISTVKFDHRQDTD
FT                   LSKPRRDNVRRHQLPAKG"
FT   CDS_pept        join(56585..56771,57170..57262,57346..57427,57612..57708,
FT                   57802..57877,58009..58067,58236..58358,58523..58580,
FT                   58667..58752,58834..58899)
FT                   /codon_start=1
FT                   /product="26S proteasome regulatory subunit S12 (MOV34
FT                   protein)"
FT                   /note="gene_id:MJJ3.19"
FT                   /note="sp|O24412"
FT                   /db_xref="GOA:O24412"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR024969"
FT                   /db_xref="InterPro:IPR033858"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:O24412"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09672.1"
FT                   /translation="MDVIKTQQISARTIEKVVVHPLVLLSIVDHYNRVAKDSSKRVVGV
FT                   LLGSSSRGVVDVTNSYAVPFEEDDKDPSIWFLDHNYHESMFHMFKRINAKEHVVGWYST
FT                   GPKLRENDLDVHALFNGYVPNPVLVIIDVQPKELGIPTKAYYAVEEVKENATQKSQKVF
FT                   VHVSTEIAAHEVEEIGVEHLLRDVKDTTISTLATEVTAKLTALKGLDARLREIRSYLDL
FT                   VIEGKLPLNHEILYHLQDVFNLLPNLNVNELVKAFSVKTNDMMLVIYLSSLIRSVIALH
FT                   NLINNKLLNKEHEKAEDSKPVAIPATS"
FT   CDS_pept        complement(join(61447..61864,61979..62394))
FT                   /codon_start=1
FT                   /note="contains similarity to I-box binding factor"
FT                   /note="gene_id:MJJ3.20"
FT                   /db_xref="GOA:Q9FFJ9"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR006447"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017884"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FFJ9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09673.1"
FT                   /translation="METLHPLLSHVPTSDHRFVVQEMMCLQSSSWTKEENKKFERALAV
FT                   YADDTPDRWFKVAAMIPGKTISDVMRQYSKLEEDLFDIEAGLVPIPGYRSVTPCGFDQV
FT                   VSPRDFDAYRKLPNGARGFDQDRRKGVPWTEEEHRRFLLGLLKYGKGDWRNISRNFVGS
FT                   KTPTQVASHAQKYYQRQLSGAKDKRRPSIHDITTVNLLNANLSRPSSDHGCLVSKQAEP
FT                   KLGFTDRDNAEEGVMFLGQNLSSVFSSYDPAIKFSGANVYGEGGYCISQDLETRK"
FT   tRNA            63415..63490
FT                   /product="tRNA-Arg(CCT)"
FT                   /note="gene_id:MJJ3.21"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        complement(join(63957..64511,64600..65088,65169..65474))
FT                   /codon_start=1
FT                   /note="gene_id:MJJ3.22"
FT                   /note="pir||T01270"
FT                   /note="similar to unknown protein"
FT                   /db_xref="GOA:Q9FFJ8"
FT                   /db_xref="InterPro:IPR024752"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9FFJ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09674.1"
FT                   /translation="MRPKAVWEPEYHRVFVDLCVEQTMLGNKPGTHFSKEGWRNILISF
FT                   QEQTGAMYDRMQLKNHWDTMSRQWKIWRRLVETSFMNWNPESNRFRATDDDWANYLQEN
FT                   PDAGQYRLSVPHDLKKLEILFAGCNVEVKNDEVSGVRKRRRSCYEEEDEDNQSMCSSSN
FT                   PQTKGYWSPSTHKLFLDLLVQETLKGNRPDTHFNKEGWKTILGTINENTGLGYTRPQLK
FT                   NHWDCTRKAWKIWCQLVGASSMKWDPESRSFGATEEEWRIYIRENPRAGQFRHKEVPHA
FT                   DQLAIIFNGVIEPGETYTPPSRSRKKLLHNRSESPQWRDTTPLSKMHVDEAETSRQNGC
FT                   YAESQEDRIDSENAQPLDDMKLMNDVMLQESPVFVEIESAKPMYSIGECIKSLNAIEEV
FT                   EQGSELYMFALDLFLKREYREIFLELKKPSLRIAWLQRLQSTSFPIPTTT"
FT   CDS_pept        67499..68722
FT                   /codon_start=1
FT                   /note="contains similarity to C3HC4-type RING zinc finger
FT                   protein"
FT                   /note="gene_id:MJJ3.23"
FT                   /db_xref="GOA:Q5EAE9"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5EAE9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09675.1"
FT                   /translation="MSSSSLILLFSTLSLFLNVSLADNHTAVVITTSDTPPPLPPPSPP
FT                   PRHNFTSSLMPGIAVVIAVLTAFFSLTFLLLLYVKHCKRRNGSVYVNHPQRFAITRYGG
FT                   GYYNGGGVVGGRKNSGIDRSVIESLPVFRFGALSGHKDGLECAVCLARFEPTEVLRLLP
FT                   KCKHAFHVECVDTWLDAHSTCPLCRYRVDPEDILLIGDCNSWFELQFSKDESNSVNNNP
FT                   PGLTRFIPVSRISGRHSSAGERASRLNEIRTSSSYKSNPMSFRRSLDSSLKVNDAGEEK
FT                   SESVAVNCLDRLQRKDGLLLIPNRESFEGRFEHRIIISGGNRDDQRWSEVRPSDLLYLR
FT                   SEMILSDCRKLAAAEGGRDVINGRSVSELTGIERRRRWGGEPRQRQATAVISRWLAWSH
FT                   RASASSIV"
FT   CDS_pept        complement(join(72829..72978,73281..73509,73618..73721,
FT                   74134..74574))
FT                   /codon_start=1
FT                   /product="phosphate/phosphoenolpyruvate translocator
FT                   protein-like"
FT                   /note="gene_id:MJJ3.24"
FT                   /db_xref="GOA:Q6DBP3"
FT                   /db_xref="InterPro:IPR004853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6DBP3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09676.1"
FT                   /translation="MATNGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMC
FT                   HMTACSLLSYVAIAWLKMVPMQTIRSRVQFFKIAALSLVFCVSVVFGNISLRFLPVSFN
FT                   QAIGATTPFFTAVFAYLMTRKKEAWLTYFTLVPVVTGVVIASGGEPSFHLFGFLMCIAA
FT                   TAARALKSVLQGILLSSEGEKLNSMNLLLYMAPIAVVLLLPATLIMEKNVVGITIALAR
FT                   DDFRIVWYLLFNSALAYLVNLTNFLVTNHTSALTLQVLGNAKGAVAVVVSILIFKNPVS
FT                   VTGMLGYSLTVCGVILYSEAKKRNKN"
FT   CDS_pept        join(76633..77006,77308..77548)
FT                   /codon_start=1
FT                   /note="gb|AAD32776.1"
FT                   /note="gene_id:MJJ3.25"
FT                   /note="similar to unknown protein"
FT                   /db_xref="GOA:Q9FFJ5"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FFJ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09677.1"
FT                   /translation="MESVQPHLETFVSVKVINSSSGCDGDGEPRRSSGAVEKEEEIVKD
FT                   EERRSNASVCSVEIDLELGLPEKVVHLSQSERDCRICHMSLDAANLESGVPIELGCSCK
FT                   ADLAAAHKHCAETWFKIKGNKICEVCGSIAGNVVGSVEVESEESRNEANGVENLTLRTS
FT                   GPRLVEGRSFWQGHRFLNFLLACMVFAFVISWLFHFNVPST"
FT   CDS_pept        complement(join(77991..78623,80119..80484,80861..81181))
FT                   /codon_start=1
FT                   /note="emb|CAB81597.1"
FT                   /note="gene_id:MJJ3.26"
FT                   /note="strong similarity to unknown protein"
FT                   /db_xref="InterPro:IPR006873"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FFJ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09678.1"
FT                   /translation="MRKLCPNYNLEDGLETVLEVPMPEELFAASKTKPGWNQMKSYWSK
FT                   PTATATGTATATNMTRLFGGRNAEIQLLLGVVGAPLIPLPVQPDHHNDYENPIHKDIKD
FT                   QPLEMSMAQYIVKQYIAAVGGDRALNAVESMYAMGKVRMTASEFCTGEGSLNSKMVKAR
FT                   SIKSGGGEVGGFVLWQKGIELWCLELVVSGCKISAGSDAKVAWRQTPWHPSHASRGPPR
FT                   PLRRFLQGLDPKSTANLFARSVCMGEKKINDEDCFILKLDAEPSALKARSSSNVEIIRH
FT                   TVWGCFSQRTGLLIQLEDSHLLRIKAQDDNSIFWETTMESLIQDYRTVDGILVAHAGKS
FT                   SVSLFRFGENSDNHSRTRMEETWEIEEMDFNIKGLSMDCFLPPSDLKKDDDEEEEIECG
FT                   LAANNEKLPMKIRSASLRISSSKVLAIVEEEDESEVTEET"
FT   CDS_pept        complement(join(83414..84047,84126..84292,84613..85332))
FT                   /codon_start=1
FT                   /note="gene_id:MJJ3.27"
FT                   /note="pir||T12704"
FT                   /note="strong similarity to unknown protein"
FT                   /db_xref="GOA:Q9FFJ3"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9FFJ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09679.1"
FT                   /translation="MATELNPKNFPVLSYVLDRLPSFTAKSSSSSDVEPPPSKSDPSSS
FT                   SNHSIEIVTQMPHLAHPDVLASMTNATADVSQTRSVLRTLGPRPDHETVDRARARLREI
FT                   DASLSESFEEIALSPNDIDVAEKEQKRREAVEQEKIWYKSILKLNELHESYEKLLKEAE
FT                   ERLVRIYESAEKNAAAVAEEEAAEVEVNEEVVSILQQAAENPLDRVDLSGRKLKLLPEA
FT                   FGKIQGLLVLNLYNNQLQAIPDSIAGLHNLLELDVSTNFLETLPDSIGLLSKLKILNVS
FT                   CNKLTTLPDSICHCGSLVVLDASYNNLTYLPTNIGFELVKLEKLLIHLNKIRSLPTSIG
FT                   EMRSLRYLDAHFNELNGLPNSFGLLTNLEYLNLSSNFSDLQDLPASFGDLISLQELDLS
FT                   NNQIHSLPDAFGTLVNLTKLNLDQNPLVVPPDEVVKQGVDAVKMYMGKRWVSMLEEEEK
FT                   MANMKDEMDQTNTDWLTRTTSKLKTYVTEVSEYLGSNPPRDPYLDQQL"
FT   exon            86268..86742
FT                   /product="glucuronosyl transferase-like protein"
FT                   /number=1
FT                   /note="CDS is reported in Acc# AB017060"
FT                   /note="gene_id:MJJ3.28"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   exon            87194..87835
FT                   /product="glucuronosyl transferase-like protein"
FT                   /number=2
FT                   /note="CDS is reported in Acc# AB017060"
FT                   /note="gene_id:MJJ3.28"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
XX
SQ   Sequence 87835 BP; 28070 A; 16447 C; 15945 G; 27373 T; 0 other;
     gatcatcctc ttcaggcgta gtagtctcga aacacttagg tagggtttta cagaggaaga        60
     agatgccgag ggagataatt acgcttcagg ttggacaatg tgggaaccag atcggtatgg       120
     agttctggaa acagctttgc cttgagcacg gcatcagcaa agatggtatt ctcgaggact       180
     tcgctactca ggtcctcttt cttcgaattc gtttctatgc atcgattaat tgaattccat       240
     ggttgctggt ttgttgttgt tgttcataga attgtggatt tgattgatga actacttgta       300
     tgtatgtagg gaggtgatag aaaagatgtg tttttttacc aagcggatga ccaacactat       360
     ataccaagag ctctcctcat tgatttggag cctagagtta tcaatggtat tcagaatggt       420
     gaataccgga atctctacaa tcatgaaaat atcttccttt ctgaccatgg cggtggtgct       480
     ggtaataact gggccagtgg atatcaccaa gggaaaggtg ttgaagagga aatcatggac       540
     atgattgatc gtgaagctga tggaagtgac agtctggagg gttttgttct ttgccactct       600
     attgctggag gcactggctc aggtatttta ctttttattg ccaatcccta tcttcgttta       660
     gcttatgttt attcactgaa tgactttttt ttatgtattt tcacatgaag gaatgggatc       720
     ttatttgttg gagactttga atgatcgtta tagcaagaag ttggttcaga catacagtgt       780
     atttcccaat cagatggaaa cgagtgacgt tgttgtccag ccctacaact cactgttgac       840
     gctgaagcgg cttacgttaa atgctgattg tgttgttgtt cttgacaaca ctgcattgaa       900
     cagaattgct gtggagcgtc tacatttgac taatcctact tttgctcaga ccaattcttt       960
     ggtgtcaact gtgatgtctg ctagcacaac aacgttgcgt tatcctggat acatgaataa      1020
     tgacttggtt ggcttgcttg catctttgat cccaactcca aggtgtcact tcctcatgac      1080
     tggatataca ccgttgactg ttgagcgcca ggttagatat ctcaatcagt tttataacta      1140
     atatcatcaa accattttta tgggaagctg ctgttatctg gaacatgact tctgaatgtt      1200
     atgattgaca ttttcattga tttcctactc tcttatgtga attgttcttg gcaggcaaat      1260
     gttattcgta aaactactgt gctggatgtt atgaggagac ttctacaggt gagctgtttg      1320
     ctttctccag tcttttttcg aaaattgaat tagattttct tctaacatga ttgtattcgc      1380
     agacaaaaaa tatcatggtt tcgtcttatg ctagaaacaa agaagctagt caggcaaagt      1440
     acatatcaat attgaatata attcaaggag aagtcgatcc cactcaggta cttttatgta      1500
     ctaatttttt tgttcgatat attgaggatg aatcggtaat tctttcttgt tgatgttatc      1560
     tgctctgttg tctcactact tgatattagg tgcatgagag tttgcagagg atacgagaaa      1620
     gaaagcttgt caatttcata gactggggac cagcaagcat acaggttcta accgaattgc      1680
     gtcgtcaaat taattattgc ttttggattt accatggact tgcatcacaa ttttttccat      1740
     atcttactct caacaggttg ctctttccaa gaagtccccg tatgttcaaa cttcccatag      1800
     ggtaatctta tatcactcta tatatatctg tcatgcactc atgctgagag ttggtactcc      1860
     ttacagttaa tgtctaaggc tgcagttcct gctttagtag atacatcgaa gactcttaag      1920
     tttggtggtg tatttgatat ttcaggtcag tggtcttatg ttagcaagcc acactagtat      1980
     caggcacctt ttcagcagat gtttgagcca atatgacaaa ttgaggaaga agcaagcttt      2040
     tcttgacaat taccgaaagt ttccaatgtt tgctgtaagt tgactgctca aatatatcgg      2100
     ctgatgttta gtgcaaccca ccctattatt agcattgaca gttaatgttg aaatcatgag      2160
     aatctacatg ttgatatgga caggacaatg atctttcaga gtttgatgaa tcaagggaca      2220
     taattgagag tttggtagac gaatataagg cctgtgagtc tccagattac atcaaatggg      2280
     gaatggaggt atataagcta agcttttgcc atctatagtc acacactaaa ggaagaactt      2340
     ataatgatta tcgaatatat gtgactctct caggaccctg gacagcttat gactggtgaa      2400
     ggcaatgctt caggagttgc ggatcctaag ttagcgttct gaacaaaaaa taaaaactca      2460
     agagtaagtc atatgatgtt tcacttttaa ctgagatttt caggtcatga taggttttct      2520
     ttggtaggat cagtagtagt aacgataaag agtgttggca ttgtaaacct tgaatagtat      2580
     tatgatgtgg atgagtttca atctatgaga tgaatgtgtt ttttttgggt actttctaag      2640
     attaagagca cctaaaagtt gcatagcagg aatcttgaat tgtattagta acatatattc      2700
     ttggaatcct atgcatattg aagttacacc aatgtaacat cgtggacccc tcctacctta      2760
     aagtttgtag ctgcgagaaa acaggttgtt ctaatagtgc agcaacaaaa acaacctcgt      2820
     tttaaccttg agatgcatgc ttattaggtg agtgagtgct aaaatataaa agattttctt      2880
     ttgggtcggc aatacaggaa tttattcatt gatggatttt atctaatagg gtttttaaaa      2940
     aatattaaag aaaaaagaag gttttatcgt tatctaacat ctcttatgaa tttattatcc      3000
     tacataagtt gtcaataaga agccttgttt cctttttctt tctgtatttc aatataagat      3060
     aaatttctga aacctggaac aacaacatct gcgattgttt ctgggtattc attcttttca      3120
     caaagtgtaa agctttaatt ttcgatttcg cggagctcaa agtttcaaac ttttccatgt      3180
     ttcttgtttc ttctagctct gttctgtgta cgtcgaagca acttccctag cactttctca      3240
     attattttaa gttccaattc tcgatgactg agcttagctc tccgaatctt gactccgcct      3300
     cgcagaagcc aagaatctcc accgaaaacc ctcctcctcc tcctcctcac ataagcattg      3360
     gtgtcaccac cggtgaccct gctacgtctc cggcgagaac cgtcaaccaa atcaagaaaa      3420
     taacggtact gccactagtt ttcctgatat tctacgaggt ctcaggcggt ccgtttggga      3480
     ttgaggatag tgtgaaagca gcaggaccat tgttagccat tgttggattc atcgtcttcc      3540
     cttttatatg gagtatccct gaagcactca tcactgctga gatgggaaca atgttcccgg      3600
     agaacggtgg ttacgtcgtg tgggtcactt tagctatggg accttattgg gggtttcaac      3660
     aaggttgggt taaatggcta agtggcgtta tagacaacgc tctttatccg attctcttcc      3720
     ttgactatct caaatcagga atcccgatac tcggtagtgg gatccctcga gtcgctgcga      3780
     ttctggtgtt gactgtagcc ttgacttact tgaactacag gggtttaagc attgttggtg      3840
     tagcagctgt tcttctcggc gttttctcca tccttccgtt tgtggtgatg tctttcatgt      3900
     cgattccaaa gcttaaacct tcgagatggc ttgtggttag caagaagatg aaaggtgtta      3960
     actggagctt gtatctcaat acactcttct ggaatctcaa ctattgggat tcagttagta      4020
     cgcttacggg tgaagttgaa aacccgagta aaacattacc aagagctctg ttttatgctc      4080
     tgcttcttgt tgtgttttct tacatcttcc cggttttgac cgggacagga gctatagctc      4140
     ttgatcagaa gctatggact gacgggtatt tcgctgatat cggtaaagtt ataggaggag      4200
     tttggttggg atggtggatt caagctgcag ctgcgacatc taacatggga atgtttttgg      4260
     ctgaaatgag cagtgattct tttcagctac ttggaatggc tgagaggggg atgcttcccg      4320
     aggtctttgc caagagatcg cgctacagaa ctccatgggt cgggatactg ttctcggcct      4380
     ctggtgtgat tatcttgtca tggttaagct ttcaagagat tgtggctgca gagaatctgt      4440
     tatactgttt tggaatggtt ttggaattta ttacgtttgt gaggttaagg atgaaatatc      4500
     cagctgcctc aagaccgttc aagatacctg taggggtttt gggatcagtc ctcatgtgca      4560
     ttcctccaac agtactgatc ggtgtcatca tggcatttac taacctgaaa gttgcgctgg      4620
     tgagccttgc agctatagtg attgggcttg tgttgcaacc ttgtcttaag caagtggaga      4680
     aaaagggatg gctcaagttc tcaacaagtt ctcacctacc aaacctgatg gagtaaagac      4740
     caccgaagat ggtgatgctt ttggttttac ttttgatctt acaggtaatg atcattgctt      4800
     ctggattttg gatcagaact taaaagctta ttctatgcct tactagatga agacttttct      4860
     tttcaatgga ttttggattt ctttgatttt tcattataca gtaacttaca ccgcatggga      4920
     gacatttctg atcatagaaa aaggacaaaa ttacttgcta tatttcgcca tcttacacaa      4980
     tcctcttaga gttttagtcg attcattgac aacaagggat agtctacgta caagaaagaa      5040
     aaggaaacaa caacaacaaa acaagaagaa gaaacagtga acacacaagc ttatgttagt      5100
     atgttacaga tagtatatat aatttttttc gtctatccaa aattctccta attaataaca      5160
     ctaatgttta tgacttatga gtctatcact taacactaat tacgttttta accctttgta      5220
     accctaattg gctcctgctt catgttgtat ataactgctc tcagaaacct aagtcgtcac      5280
     tccctctccc ttggttcttt cttcctcttg aaagctagaa agaagaaaat ggaagaagct      5340
     cttagcgaag ctcttagcag ctttgacttc gatgaacttg tagcttcgct tgctgatgcc      5400
     atcgcagcaa catcgactcc caagcctttg gtggaatttt cactacatgc tttgatggct      5460
     gaattgttta agagaactaa aaccttaccc aaagctgaag tcagcaggac attcttcaga      5520
     gctgtttcca ttggcttgct gagaggtaac attaggaaag atcaactgga gagaacttgt      5580
     gatgctggta aagcaattat caaaagagtt gctgcaattc tagggattga aatcagagac      5640
     aagggtcaaa gaaagcttgt tctaacaaac aaaactgtga ctttctcaag aatgatagct      5700
     attttccctc actgggctag ccagctaatg gtctctaagg agagcctttt tgtcaacagg      5760
     tttgcttctt tcaatgatgc caatagattt cctgctcaaa ctcataagct tcctattgct      5820
     atgcttcact ctggatttgc tggtctgatt ccaagagaaa gtgatgatat ggaattcata      5880
     gaccttattt gcatgtgtca ctctgctttc atggctgagt tctctcttct gattactcct      5940
     caagaacaga gaagttttca tgcattgtac gagaatcaga aaagatatac cgaggctgct      6000
     cgtggatctg gattcaattc tgatgaaaat aggatcgttt atcttttgag atttgggttg      6060
     ttgtcttctg atagtcttga taagatgttg aaagttgctg caagggtttc aactttgagt      6120
     gcaaggcaag aagaagcaag tgttacaaga gacagcttta cgatcgttga agatcgggtc      6180
     aagatcgtaa atgatgatgc aaagtgggat gagctattga aaaaagccaa gagaatagtt      6240
     gatgcttcaa gttcaatgag gtctcaggtt gctgctgttg actccttaga tggagtttga      6300
     tttagtgctt tattgagctt ctttcttttg tttcgtttga tctgttctta agtatagact      6360
     ttctagtctt tcttttaagt ttctttagct attgccattt ccttgctgag aggtaacata      6420
     aggaaagatc aattggagag aactagtgat aaagcaactc tcaaaagagt tactgcaact      6480
     cttgggattg taatcagaga caagggtcaa aaaaagattg ttctaactaa caaaactgtg      6540
     accattgatc cattttatgt ttgtagaatg agaagaggca acattatacc catggaggat      6600
     ttcttggcac ttgctccatc tcctcacctc cacacaatct attcagcttc ttgaccaggg      6660
     cctcttcatc agattcgtct tcacacccga aatacctttc ctgtcaatac atttgcagct      6720
     gaaattgtaa gaaaatgtgt tttataactt ttaagctgaa gaacaaacgg acaaagcata      6780
     acatcaactc acaggataag aaaaagcttc agaagtaact ttgaggagga ctaaaggctc      6840
     attgtgtact ccatgcatct ttgtagaggg agtaaaagtg gctttttgat cattaaataa      6900
     gacacaaccc atttgagatt aaataagaag gaacaatttg catgtagaga tttcagcgaa      6960
     caaatacaat tctctagata taaacaaatg cataggatat acttaaaaga aatgagatta      7020
     tttatatcac aataattacc atcttcaaac ttggttatca cccattctct caaattagat      7080
     aaaaagttgt tataaaattg aagctatgta tcccataagc aaaagaagac gaagctgtga      7140
     ttttccggtt aatcagcaga atctgagtta aaaccgaaaa gaaaacagtt taacaagaaa      7200
     gaatttatct tctctcatat cagaggagtt tgcgtttaac aacaagatgc atcatcacaa      7260
     gtcacaagat acatcaaaag atacatgaga cttcatatac ttagtagata accctaactt      7320
     aattaggaaa atcaagcaga gacaaacaca tccaccgatc tccgcctctc gaggaaagag      7380
     aacgccacca accccctgaa tcgaaatctt accgtcggtg taaatgtcag gatcgtacaa      7440
     acaccctgac cagacaccgt caccaaactt aatagaacgt tgagtttccc tagccgaaag      7500
     catatgtggg aagtaaaatg tatcaaactt tatcatccca gatcttctaa cacaagcata      7560
     aaaactcttc tcagtctgat actcagggat aatgtggtaa taccaaattt gtttctcact      7620
     cagctgatcc atcgtgaatc tcgctatagc ttcgtcgtcc ggagcaagaa ccgttgtcga      7680
     atgatgcttt ttctatgcaa aatcaaaata ttgttttagt gagctagggc acaaattaac      7740
     tcatcagcat catcatattt atgagaacac taaaataaga ggttttaagc acgaaatgac      7800
     tacttttcta attaattata tttgaaaaag tgactaattt ttaacttatt tcattttaaa      7860
     tctctagcta tttttagtta tatattagat aagaaaataa aagagaaatg agaatgaaaa      7920
     aaatatacat ttacactaaa aattcgcata accaaaggat aaactaggga gggattattg      7980
     gtttattgat ttataaggaa ttgaaaatcc aaacaaaaat catttgttat tcaatcattg      8040
     attttaaaat tctaattaaa aatcatgtgt tattgattcg atgatttata aaatactagt      8100
     taaatccttt gttattcgtt tagtcatttg tttttggatt tgagaatcca aattatgttt      8160
     taaatggaat tgaatggatt tgaaagagaa aaatataagg attcaaattc atgggtaaac      8220
     acatgttatt tcaaaatcta tatattttga tttcataatt aatagagatt ttcaaattct      8280
     atatagattt acaaatcaat aaaccaaaaa cacccctaac attagtaaaa tgaatcataa      8340
     aattgtacca ttgctcctgc actggtagac atgatacagt ttcgactttt tgagtcataa      8400
     tgcattccaa attttaacaa tgattgacaa cactaactta tggtgacaac caccaaacta      8460
     aagttagtaa tagattacat gaaaagtccc catatatcat tatttgacta cagctttctt      8520
     cgaaattcat ttcaacttta gtggacattt attctttttt gaataaaatg ttaaattata      8580
     tttaaaagaa aataattttt ttacatcaat agttgatgct tcaacttcaa tgaggtctca      8640
     gttgctgccg ttggttgact cagatggagt ttgatttaat gattttgctc cctttaacct      8700
     ctttttcgtt tcatctgttt ttaagtttag accttcttta ttaactcgtt tctttaacta      8760
     gattaatgtt aatgttctta cacaatggag agggaggatt gttatcccat tccatggtct      8820
     ttggtggttg tcacattttc ctcatttaga tcctttttga ggccctagat cacatatcta      8880
     aaacagaaac agacaaattc taaagggata gttttataca gatatatatc atgaaaaaga      8940
     aagaacaagt acaacagttt ttccaagctg ttttgctgtc tcaaaatatc aaaaaaacaa      9000
     aacaaactga taatctttct aatctcccct ttgaaatatt tttggtgact atcattgact      9060
     aaaccaaaaa gaaagaccaa atgtctcgaa gctaactgtg ttgtcactga ccaatatcag      9120
     gctaaaagct tgagaaggaa caactctcaa aaccagttag attcgagggt atcttctaga      9180
     cttttgtctt tgttcttcga cttcattcat ccaatctgaa agccacaaga gtcccttata      9240
     gccatagtat gaaacagcag ctagcatcgc cactaacatc acgaccatca gtatcctctt      9300
     tgtggtgaca gcaagtttct gcagagaaat tacaaattat atcatttttc atcttaggat      9360
     attagttttt ttcctcttct attttaccat taatttccct tttacgttta aaccttcgtt      9420
     aaattccttt tctatcgcac aatactatta tgaaatcagc tttttttttt ttttatgtat      9480
     ataatgtatt cgtaatattt cattaccaaa atcatattac ttacattaca atacttccta      9540
     agttcctata tatactttat cgttattaaa gtaaaatttc tacaaaacct tacacacttt      9600
     cttttatata aaccaaacct cccttcgcca ccttcaccgg agctccaaca tgacttcgaa      9660
     acactcatgc cccagcgtaa ggtggccaat aataaacaga atattgaata taatgatgat      9720
     aatcatgttc atcatatgca ttctcataat cctcctatag attgtgcaat ccttctacca      9780
     tcaaaaccac gctttatctt ccaagacgtc accgtcttca acttcaacgt ctccggcaat      9840
     ccatcggacc tcaacacccc agtagtccaa ttcaatctct cctttcgtaa ccctaacgcc      9900
     aatatccgaa tctactacga cacccttgac gtctacgctt tttacgggaa cgggagccaa      9960
     cagatcatta tcccgactcc tatgccttcg acttatcaag gacacaaaga agacagcgtt     10020
     tggtctcctt acatccccgt cgttccctac aacgccttgt atcttgacga tcagcaccac     10080
     tcacgtgacg ggaacatgtt gatgcttcac ctcgacggca gaattagttg gttactactc     10140
     ggtaactaac ctcggcaccc attaccacca tcttcacgtt agatgtccag cctttatcga     10200
     ctttgggagt agtgctgcca gagttatcgg cggaaataac accgttaagt acacgctcaa     10260
     caaaacttgc agtgttagtg tgaaaagaca ttaacggtga cggccgtatc aggccacgcg     10320
     cggcttttca ttattttaat cacctaatat attgttataa ctttcttgta gctgttaagt     10380
     tttttattta tattttttac ctacgtcata gagaaataat atcaagaatt gcaatcggtt     10440
     gcgttattgt tatgacgagt tttaaagatt caaaagaaat acttacaata tagtaaaaga     10500
     taaaactttt ttttttcaat tggtaacaat ttatgatgga tgattcaatt aaatacttat     10560
     tgatttataa ttgaatttta gaaatatagg agaaaatcct gactacgtca aaacttgtgt     10620
     tataaaaaaa tcaacttgtg ttattagttt atcattgtag tgtacgtaat tagaattata     10680
     ttaaaatatt gctacaaata gttttcatgc attcatatat ctttaaaatt ttcataattt     10740
     tttatattaa tatgtggaaa gtctctacat ttttcttaaa tttaaacatt tagcaccatt     10800
     tttgtttata tatattacaa cccataattt aacttcaaaa atcttgttta agaagatgtt     10860
     aaataaacct tagctttgct tcgctttccc atttgtcttt cctctcaacg ttagccttaa     10920
     tagcgacacc atgtatatat tatcgtgaac gacatataga aaacaaaaaa caaaccaaca     10980
     cagtacttga gaagttgaga agactaataa ataaccaaac acagtttctt gagactacat     11040
     gcatggttaa gttagttaac aaacacagta aacaaatatc aaatatgctt tagaaatctt     11100
     ggatgaaatc atgaaagata gtatttcttc ttatatattg aagttttcca cgataaaagt     11160
     catatgtata taatcattgt ccgaccactg ttgtaaacaa tatcgaaatg atctctgatt     11220
     gaatttagca tataataatt aaattggaat tgaaataact tggacaaaca tatgaatact     11280
     aattcgagca caccaaaaaa tcattgtttt atttttgtga aactttttta ccaaattcct     11340
     gaatttaaaa gtcgaaatca tatacaattg tatgtgaggc taagtttgcc caaaaaagaa     11400
     aaaaatgtat ggagacagga aaaattctga aggggtcaga taagatttat ggagacagta     11460
     cttggccgac caagagccgc gaatccacat agccggtatg acctccttta gtgttccata     11520
     gcaccatcgt ctaacgttta accaacgtca cgtcatggct ttcacatcgt ggatattgtt     11580
     tgtcagacaa tttgactcat atatcatgac tagagaagaa caaagtacaa caatttttgc     11640
     tgtttcgaaa tatcaaaaag ctaaaagaaa gagaacaaat caaaaaaaca aaacaaactg     11700
     ataatctttc taatctcctt tgaaatattt ccggtgacta aaccaaaaag aaagaccaaa     11760
     cgtctcaaag ctaattgtgt tgtcactgcg cagtatcagg ctagaagctt gagaaggaag     11820
     aaactctcaa aacagttaga ttcgagggta tcttctagac ttttgtcttt gttcttcgac     11880
     ttcattcatc caatctgaaa gccacaagag tcccttatag ccatagtatg aaacagcagc     11940
     tagcatcgcc actaacatca cgaccatcag tatcctcttt gtggtgacag caagtttctg     12000
     cagagaagaa accaaaaaaa cagatggtgt cttaaggaga agttaagaca tacgagacat     12060
     gtgtgttctc ggattttttc taatcaaaag acagtaatta cctgcagcct tgtggtctcc     12120
     tgaatgtcct gaccccgtcc acgccttttc cttcgctttg atgcattttt cccgctaggc     12180
     tcctccttct cctaagatgt ttgattagaa gaaagacttg tgaaagttgc tttaagagtg     12240
     agattaattc tgaaagcttt ttattgtttc tgtttacctc aatctctttg acattgcgct     12300
     gtgttaacac cgattcagcc acctgtagtt tgctcttaca gttggaatca caagggagga     12360
     ggccaacccc gaactggttc tttggtactt ctttaggatc agaacctgtg gccctatggg     12420
     ctgcttgaac atcctggcat acccattctt tcttcaaggt taggcacttg caacgaacaa     12480
     ccaccttgat ccatgataaa atcgagacaa gtaagatctc acttgtaaca gatacagcat     12540
     cccaaatgga tataaactgg caaatggata cctttttacc acacttctct ggcaatggac     12600
     actgcccagg atgacatatc tccggacaca aatgggtaca gtttggcaat tttctgcaac     12660
     agcaatatcc tctagtttca aaagtgtggt tttctaataa tgttattcac taaaatataa     12720
     aaataaagct tgggaacaag tgagttacca caaggaaacc atcagttgtt caaattgaaa     12780
     aatgaaacac aataatacag taccagcgtg ttagttacct gtgacaaggt ccacggcatg     12840
     agcgcgcctt catttggtcc ttctccgaca ttgtattgta gtatatgcac tcgaatgcat     12900
     gcaccatcgc gccacagtga catgatctct ttactagagt tttgcaaggt ggacaatctt     12960
     caggatggca tcgccgagga catggatgtt ggcatcgtgg tgttctctcc tgtacaatgg     13020
     tatgaaagat aaggaagact ggctaattga ctgactcagt agagagcttt taacagcttc     13080
     atggagttaa atatgtttat caaaaaaaaa aaaatgtgtt tatcagaagc tatcggaaca     13140
     atgcaagtta ttgtgaaaac agattcccaa ctgcaatcaa gacccgagcg taaagatgat     13200
     cgagtaagtg gtgagataca aaagataact gatacctttt gacagcggag atcacacttt     13260
     tcacaggact cacttctttt atccaatgat gaacttctta tatccagggc atgacagaaa     13320
     tacgaacagt aatggttccc acatggaaga gggtttccac ataaattatc gcatgcaaat     13380
     tgagttctgt cagagcaaat catctaagcc aatgaaaaga gaaaaacata tcaaatgtcg     13440
     gaagaagatc tcaaagtcca caaataaaaa ttaacaagtt agatattgga catgcatctg     13500
     aaataactaa tataaaagag aattgagact cacccttttc tctgctgcca ggtggtggcc     13560
     tacacagggc ctccagacag gctctggaca acgagggcag ggagaacccg gtgtagattc     13620
     agcctgaata tgcaacatct ttttcgttgg tttcagtata aattcacggt taggaggagg     13680
     tctaggtcca tgacacctat gtcataagaa gcacacaaaa accaatgttt ataagaaggg     13740
     aaatgatcag agtaggaaag aaaatggatg aaaaagacac cagcatgaga aaccttagtt     13800
     tgcacttgtg cccacatggg tattcttcat cacaaaggag tcgacatgga ggacaagctc     13860
     catagtggca tttatgaggc tgcatataaa catgacataa atttcgcaga attcaaacat     13920
     agaaccagtc acaaaagtaa aatcataaaa tccttattct aactcttctg ctaccttttg     13980
     gttttgccca tgtctgcaca atggggttat gtggcataat ttacggcatc taggaggttt     14040
     ctgatttgtt tcagtgccac agggtacctg aacaacataa aacatccaac tgcgttatta     14100
     atacaggttt aacatacagt accagatctt ctatcagaga atacagaata tattaaaagt     14160
     atcaaacatt taaaagccta tggacacaaa aagaagaagc aaaatatcta taacaacaat     14220
     aggcataaag tcatcagata tggttctcag gcttagacta aacaagacct caagatcatt     14280
     ctttccgaag ataatttagt aagtttaagc ttatagtctc gcttgttagg tgtcagtaac     14340
     atctcctgct tctaccagtt gcatctaccc aaaactaaga attttctata gatccaccat     14400
     aacaataaaa gtaccaagac tatatatcac gacttgatag taagacgcca tattgatgct     14460
     caaatcctaa ttctcacctc aaaatgtgtc tcaccacaag cacaagatat tgttaccatt     14520
     attggacaag gagcacatgg acctctgcaa tgaacacgca acaaataatg tcattccacg     14580
     tgcatgagtt gatatcttgc agtacacaat tttattagtc atatcgtccc aaatctgaaa     14640
     ccaaacggac aaagaaagtc caaagcaagc tactacagaa catactggtg acaaggagac     14700
     tggcatttat gattcctgca acggagcttt tttccacaaa tctgaaaaat tcaaacaaac     14760
     aaattagaag ccaagcgtga acaattgcac taaactggac caagagacac atcatacctc     14820
     tgagcatggt ggacattcac catcacaaca tcggcgtcta caagcatgac gtgcacaatc     14880
     tctcactctc tggcatttcc tctcacacgc caactcttga tggcaaggaa cctactctaa     14940
     attaagttcc caaaatcttt ccatcaacat ttgattttga ctataataaa gcatcatgaa     15000
     gtatcaaaaa ggctctcttt cacctgtttt ttcgttactc cgcacctgca agacttggta     15060
     actacaatcc tgcaagtctc aaggcacgga ccgcggtggc acctctctgg acacctatgg     15120
     tagccacaac caagaacttt atcacaagtg ccaccacata aaggcgccac aacatcacaa     15180
     gacaagcctt ggtagaatct cttgccacag ggacaactcc tcttcccctg atatggacac     15240
     aatccacatt ctcccgcgtg gcatcctctc tcgcatacat gtttcccgca attaagcata     15300
     ttctcgcaag aagcctcaca cctaaagact ctctcgcagc aatccttctc ctccttcact     15360
     ttaccacaag agcacttgta aaccgcgcgc tccctgcaag gtggacactc gccatcatga     15420
     caaatctccc tacagttatg gatattacaa tccaggactc tctcacagac atctccgcaa     15480
     gagaattgct tgtgtccaca tcgacgaaca tcttcaacac cgccgcagaa gcatttagct     15540
     ttcacgagct tgggacaaga agcacaaggt ccagggtgac acaagagtaa gcaacagtga     15600
     ccacaattgt tgctcaacgg cctctcgcag acctcgccgc aagaatgagg caagatccat     15660
     ggattatccg ccggaggatc ctcttccttg ccgcagtaac aaaggtaccg ccttggaatc     15720
     ttcgatttct gatacgacga tctacatttc ggacagttcc agacagcttc cggttctgtc     15780
     ggattcgaag aaggtcgcgt gactgcacgc gcggcttgta gatctaagca ctgacgagcc     15840
     catgattgaa tgcagaaaag gtgaaagacg gcgaagcatg aggaagtgca ggaccatgta     15900
     ggatcggttc gtttaatgcg ttcgagacag ataaggcacg agacagcacc ggaagaagac     15960
     gaggcgagaa aagattggat cttagcgaga tcgattgagg aaggggacga agatgagtgg     16020
     caatcgaggt aagcttcgaa gatggagttt gatagatcat tgtgacggtg ctgatgattc     16080
     tctgaatcag atccggagtc tgaatctgaa tctgaaatgg gttgctcttg tgacggaggc     16140
     tgtggtggtg atttccaccg gaactcggtg gtggcggttc cggccatatt agtcattctt     16200
     cttcttcatc tccttcttaa ggacaaagtc cagaaatttg ggggggaata agaagaagaa     16260
     gaagacacgt gatgctctcg tgagcattgt aatgaccaaa ttaccggttt aatttggatt     16320
     taccggctta gttaagacag tttctagctt atccccaagg acttctcgcg ttatcttctc     16380
     gaagttgata agcacgatca cttatctatg attatcctct tttccttttt tgcaagagaa     16440
     ttaagtcatt taacatttcc ttaaaatcat tccgatttaa aacagattat ctaactcgaa     16500
     aatacagcta ctcagttttg aacaccctaa atcatccaaa gatctcatat acaaaaggat     16560
     ctctaaactc aaatcaaagt cacagcccaa agcataagaa acttgtggta gattcaatct     16620
     atgaaggcat gttggagctc atggcttgat gtattctcga atgaagtctt caatctggat     16680
     ggtttctccg gtaagtccag atgcctcagc gacagtgact ttgttggagc aatgcgtgaa     16740
     ggagaacact tctccctcaa ttccaatggt gaagtcattc gctatatcag cagtagagac     16800
     tgcactcctt gaagccctca gtttctcact gcaaaaactc atcaaccaat gatgattagc     16860
     ttttatgcag gaagataggc tttatatata agaaaatttt gtcaagaaaa ctgaaattct     16920
     tacatttctt tctccatttg cttccggata aactccttgg tgtgtgcagt gagtttatcg     16980
     gtcttgttac agcaaaggag gactggaatc ttcttcttga caacattcgc attggtcaga     17040
     atctcgtata ggtacctatc accataaaaa accatggcaa tgcctcattt tcaacattga     17100
     gatgcaaaca tatgcaaaca tgtctcttat ctgtgtctta caatgcgtgt gtgtggaaga     17160
     gagagggtgt ttgaaattac tctgaagctg cacgacagtt tgggaggaac tccaaggcat     17220
     ccactacgaa cacaatggca gctgcttggg gcaagaattc ttctagcttg ggtcgaagcc     17280
     gagagtgccc aggaacatca acaagatgaa caggcttgat ttttcctttc tgtcacaaag     17340
     agcaagcacg ggacatggtt tagtaatatg ttattccatc catcacaatc aactgcacgt     17400
     gttgtttaca acagaacaca gtaagattct ttaccttagt attttcactg tgaagaacaa     17460
     aagtgccttc atttggttcc attgatgtta cagtgccctg atgcgacgat ccatctcgga     17520
     gctgccaatc aaacaattat cgtgttataa ctctccaaca atgacctagt cactcacact     17580
     gactcacaat agtgacacat tacaaaaaaa aagtacattt gaaggaaagt cataaacaat     17640
     attcatatga aaaaggtaac gtcaagccaa aacactcact tggtaaaaga gcacagtctt     17700
     tccacttccg gtcagcccag aaaggagtac agtgttggat ttggtacgtc tgaccaggcg     17760
     aactgcatac cccagcaaga acaacaagtt tagcaacaaa agatcaaaag tttgtttatg     17820
     tataatcaaa gaaaaatcat gaataaacct cagaaattgc aataatagtt ctaattccaa     17880
     tacacaaaat actctggctt aatcacaagt ctaaaatggt accatgagaa ctataacctc     17940
     tgcagttgta aacaatagca ggcagaagaa aagtaattga agacatttag aagaagaaca     18000
     ggctatatgt ccttatcaat ggcaaacaag atactaccag ggggagatct tacataaata     18060
     aagcaattct actaggaaag gattaagaaa caacaaagtg gtgtctaata catactggat     18120
     aggaagagca agatggttgt aaacaacaaa acaccaatgg cggcatacag ctgattcggt     18180
     ggtatcttct gaagatattc aattccttga tgcgaccact gctcagccag aattttcaga     18240
     tcttccaagt tctccattac tctctcaagt ttcacttctt ctgccaagct gttcaaaacc     18300
     tgcatccaga gatgtaattc attcctctta agacataaaa ataacctaga gttaactaga     18360
     aaactctctt ctcctacaca aacaacatgc atgggaataa tttaaaactg cttcctgaaa     18420
     acaaaaattg aaatcggaac tctctaatat ttgcaaacat tatatcaata ctggttctca     18480
     cattatcatg ttcatccttg tgataaaccc agtacagtga caataatcat cttgtgaaca     18540
     aggaacacaa tttgtttatc ccaatttaaa accagtttta ccagatcaat acaacccgta     18600
     gacccataca cgatcatccc aagttatgaa aagataaatg ctaatcctac attgatgcgc     18660
     tgtttcaacg agatgtaaaa aaatacaaac agattcctct aaaattccag ataatgaata     18720
     tagacaaaca agagctaaaa tttacccaag agtaaatgaa tccatttggt ggaagagata     18780
     gaaacgcacc gatgggagag gaggcggaag acgaatacaa cgacggtgga agcggagaag     18840
     aacacggcga cgatgattta gggttcagat ttaattttat atattaaaac cagttagtgc     18900
     ttcttcattt caatttgttt cgaagatagt taatgggccg aataaaagcc cattaaacgt     18960
     caatacgaag tcgtttcaac tgtatctgct tcatcgcttc ttttctccct tctcttcccg     19020
     ccgtgaatct ggtgtctgtg tctgcatctc cttccgacga aaacagatac actcgagtga     19080
     agaaagtatg aaatttaact ttaacgagac agaggatgca ccagattcac gacgatctcc     19140
     gacgcccaaa gagccggtta ggtgggttcc tctccagagc cacccggttt tcgcttctct     19200
     tccttcctcc caagatgaac ccgccgtgtc gcagctgttt ccgagaaatt tcatggcttg     19260
     ggacggagac tcgcgcgtat actactggga ttcgagacga tatctccttc accgattatc     19320
     tctgcgcttg ggtgaacctg aaccatcctc cgtcctcgcc gcagtcccgt ccaaggtcat     19380
     ttactctctc tctctctctc tctctctctc tttctgtttt caccgctaag tcggccaaaa     19440
     tgagtattga aaagaagatt tatcgaaagc tcttttttag tgctgacatt ttactgactt     19500
     tgagaaatta ggtttaggaa gagtttgaga aattagattt cttactgatg gatgataata     19560
     ggaagatctt ttctacttgc tatgtactac tgtcaaaaac ctttagtttt cctctgttgt     19620
     ctttgctaca taagataaat tataggtgat tgattcatca tgtagtgatt gactaagctt     19680
     tactaataaa tgatattata ggtgatgcaa ccagaccttc aggtgacatt ttctgttagc     19740
     aaaatctcca tcaataagtc tggatcagct gtacttcttg ccggctcaga tgggatatgt     19800
     gtgatgtacc tatttggacg tgcttctgtg atagaagaca atgtcatttg caggtagtga     19860
     ttaacgttac cctaataaga tgcatttata ttcattgtta tcttgattat gatgttatct     19920
     tgcttaaatt aatggccttc tgcttatacg ttatcacttc ataatctatg tgttgcaggg     19980
     tagtttctat tggttcagaa atctatacta gtagtgacag tgccataacc ttgctacaag     20040
     catcgtggca ccctgatagt gacacccatt tgggaattct atcctcggat gcagttttca     20100
     ggtaacaatc ttttcggctg atagtgaagg tggatgtaca tgtcaatata ttgatcaata     20160
     tcattatgga aagatgttag agaaattgta gaaaaaatca gttcctaagg ttgtagattg     20220
     ttagtttctg ccatgcaatg acttactatg ttaccatctg gtccagtctc tcattataaa     20280
     gaatcaaatc gttttattta atcctgattt aagagctttt tagcttacta aaagatattt     20340
     gtatgctagg cttttcgatt tgtcttcaga tactgagcta ccagagcaag aatattatct     20400
     gcagcccggt gagccaggaa gatctagaac agcttcatca atttatcctg ctgatttcag     20460
     ttttggagga gatcatctgt gggatagatt tactgtaagt tcagtacaaa ttcttgctcc     20520
     acttgtttga taactgacag tgattttgtt tagttgtctt gtcaaataga gccttgagga     20580
     ttacatgttt aggtcttgac ctaatctttc aattggtgca ggtctttata ttattcactg     20640
     atggttcaat ttatatctta tgccccgttg tgccatttgg aaggtaggca gatgatggtt     20700
     ctttctcctt ttcatttctc tctggcagtt ttttaattag tttcttatcg cttgaagttg     20760
     tacctggtat gctaagtttc caagataaca tttatcaatt ttttgtggtt ttctggtttc     20820
     ttgaacaaga tatgaatgat tctcattaag ctgttttaga tcccaaatct aggctcattt     20880
     gaagcttttg aggggtaaaa tcagctgggt cccatgattc ctttgatgta tcaaatagtt     20940
     tatgcatgtt gacgcggtga cgacttgata tgcaacagat gcattccttc cacagactat     21000
     cctctttatg tcgaacttct ataagtcatg gaagatgttt tagttcgttg tgatgttttg     21060
     tgtttaactg cccttgaggt tgactgagat tgcttcggat gtatattgca acagtgttta     21120
     caaatgggaa tccgtaatgg agatttacaa cgatgctaat atgtatgggg ttaagtcatc     21180
     caattcgtta gcagttagca actccagtct ggctattgaa tggttggaag ctacatttcc     21240
     agatttgact gagcaaggaa ctagaggtga aaatatattg gtggtgaaag ctcagcctta     21300
     tgctttgctt gacgcatcac tggctttaca ggtatgaatt cctcatcttt ttgaggggct     21360
     cctcgtagat tttagctgtt tcaccaatgt tctagatatg tggtttataa gccagtggtc     21420
     ttcatcacag atttaaaccc tccttaactt gattcggaac acggacggga taaaagagat     21480
     gacacataca cacatgttcc ctaagtgttc tttgtttgtc tactgttttc cttgtaatgc     21540
     tgatctcttg ttttccttgt gtacagggcc ctttatataa agcatctagt ggcgacggag     21600
     atgaagattt cgctgttcgg gaggcagaat gtaaaggccg ggcagtgagt ctattatata     21660
     atcttgttag caaagattcg attctggtaa ctgcctggag tgctggacaa ttacaggttg     21720
     atgccctggt tgatgaaatc cagcctgttt ggatatctgg taactcatct cgtcttcgca     21780
     tgaactccca caacaaaata caaggagttg caatgatttg tgagtcaaac ataagtgagc     21840
     ttccagttgc aacttcaaac ctgccgctcg atcacactgt ttggttaggg catccaccac     21900
     cactgttaag acttgcaatg gttgatttgg ctctccccaa aatgcgtgaa ggtggctctc     21960
     ttgttacctt gtttgctgac tcccttttgc cagaacgaat atactccctt cacgacggtg     22020
     gcattgattc aacagtctta cactctcttc ccttcacaag tcaggccagt ggaaaagatg     22080
     aagctctcaa aacgccatct gttcacactg tcctaagtac atgccaagaa gaatccgctg     22140
     tatctccttt gttgggtttt gtgcctctgt cggattcgtt tgggtattca tggatcgttg     22200
     cagtcttatc ctcaggagaa tgcattgtgg cagagatgaa aacttgggat ctcttgcttc     22260
     caattcatgt cagtacggat aagacagtgt cttcaagcgc aatagagaaa aaagagcaag     22320
     agaactcgtg catcataagc aaggagctcc ttgcaggtcc caaaattaga attgcgcccc     22380
     acgctttacc taaccagcgt tcaactccag ccaattccgt agaaggcaga tcaattctgc     22440
     ttgactatgt caaacttttc catgaaaact acatcgaata tgcacacaag gtgagaaaga     22500
     agtcatgtaa acccaacaca aaaacgtcaa tgtgttttct aaccgatttt actaatgaga     22560
     tctctttgtg ttttttgcag gtccactttg agctgcagca tcatgctcct aacctgaaga     22620
     gaataatcga tgaccaacac cagcggcttg ctgaggcaaa tgagaaaata tcaaaagttg     22680
     agaaaaacca atcttttctg gagaaaagga ttgacaaagc aattgaaaga catgattctc     22740
     ttgaacaatg cttgcaacgt ctccgtagct tgcctggtac acacaagaaa cctctgacga     22800
     gagcagaact ggattttaaa tcggagctcg gtaaatcaaa tatcccccat aaattttgtc     22860
     cgcaaaagga tataccggaa cccatttcat catcttttct tttcgcttat aaatgaaaaa     22920
     ttgcagatca atatgcggga gttgaggtgg atgcgcttca atcatccatc gaaacactga     22980
     gagcaagagt gaagaagtca actcaaaaat ctcacaaggg cacagtagtc gcagctagtc     23040
     agaaaaagca gtattcaaag aaaaacttaa ttcaagatac acaaatgtca cagcttcagt     23100
     ccacactcgc caaactatcc ctgatgaata gcgataactc caagaaagtc aagatcgtgg     23160
     aatctgcgct gaaatcgcaa gaaagcagtt tcatgtagtc actcactgta acagggacgc     23220
     agttatcatt tccttgactg actaaatcct gttcaaattt gaatatatgt gctgcaccaa     23280
     attttctaac tctctccttg taagttttgt ctgttaaatc aaactacggt attactttaa     23340
     tttgtctcta caaatggtca ttttctgcaa actattccta tgaactcata agactacaaa     23400
     gagtaggtca agcaactcat gtttgaacca ttgaagcaga agagatttat gcaagcataa     23460
     ggtaaacaaa agtttttttt ttttatgtac acagaagcta aggctttata gagtaatgat     23520
     aacttttatt gtcaaacact agacccacaa ggaggcaaaa aaagaagaag aaattaatcc     23580
     tgaaaaatac tgttgttcta taaataaaat cagatgggtc tcttcttctt caagtagcaa     23640
     aatcacggcg cttcacgaag atcgggtacc gtttctgcgt tcttgtagtt ggaaagaaaa     23700
     ccagcttgtc ttgctctgca ggaacccaac tgttcaaaca aatttacaaa acaaaatcaa     23760
     atcagtctct ttagcctttt gaaatggaaa acagagctac tatcttctat gtgaaggtat     23820
     atatacctga agcctgtcac taggcggtga aggaaaacag agagtgcaac cctagccagc     23880
     tcgtaaccgg gacatagcct tggccctcca ccaaacggtg tgaacacatt agaagggcct     23940
     gtcgttaccg agttgctctg ttccacagaa ttgcaatcgt tcaataactc aaaatcaaga     24000
     atgcaaagaa agaacaccca aaccaagttc agggcttaaa atacaaacct gccatctcca     24060
     agggttgaaa gtgcgagcat ctttgaagtg gtttgggtct aaatgaaccg ctctaaacga     24120
     tgagaatact ttccaccctt ttggaatttt ataacctggt tttgttccag ttttctaaat     24180
     gttaagtttt tgatacagaa tggactcttt ttactcattt taaaagttag attattttac     24240
     ctttgatctc aacatccgtc attgcacgtc tgaaaacacc gccgatgatg ttagccactc     24300
     gtagcgtctc attaaccacc tgaatcaaaa taggtttata agatactgat gagaaatgac     24360
     tagaaagaag ataagacaag aattcttaag agctttaggt aagtacactt acacattgtg     24420
     tgaatggcat tgacttgtaa tcactccatt caagactata cgaatcactc ttcattgccc     24480
     taatcttttc atgctcttcc tgttatattc aaccaagcaa ataccaaatc aaccaacaat     24540
     aaaagaaaga aacaaggtgt aaaagcaaaa ttaattaatt aggtcaccgg tccaaccgtt     24600
     ttttgaaccg gttggtcata ttcgaagcac taatgagtaa atgactaaac tagtgaatat     24660
     agtagtacca tccttggaac aaaactagtg acatcaacaa ataattaaaa tattaagaac     24720
     caatggatga gaagcttgtc ggtcgcgcat agcacaaaca tatttatgat aaaactttta     24780
     tctttaatgt aaagagagat ttattggggg ataatcggac aagtaagata aaaaaagaag     24840
     atgaaagttg ttggcaaaca aacaaaacaa aacaaaagaa gaagatgagg tttggtaaaa     24900
     gtgtgattat gcatgcagtt caggagacaa attagtcaaa tctctgagac tgtaactcct     24960
     tacattttac aatttcctta ttaaaataaa actctaaaac tgaggtgatg atgttgtcta     25020
     ttttcgaaaa tgactacttt gacttttacg gtaattttag taccttttac acttttcagt     25080
     tttcaccttt caaaaagctc acacccactt aataatatgc ttaatcttag attataaact     25140
     catcgaatag acaaatagaa tgaaagctta cgttttctaa ttcattattt gttgacggaa     25200
     aacaaaaact ttgaaaccag tttagtatat gatatacata atttgaaata gtgaatagca     25260
     gtactagatc gtcttacccg gctaatgtcg cgtattttaa ttttcttgat acctaaccat     25320
     taattaacca agattgaagg ctataaacaa aaaccttatt ctaaaccaaa aacaaaaagt     25380
     cttttttttt tggctactat caattattag tatcaaccga ctagattgta ctgttgctta     25440
     cttgctatgt gaactagtag ttcattggag acctaagccg tttcattgat gtgtgtgtgt     25500
     cctttttata atagttttta ttaattgcaa aaaatctaga cacccgtgtg aaacgtaaat     25560
     gatggagaaa tttagaggcc aacatgcaca tatcattatg ctcccattgt tgtagtctct     25620
     gtcccatttc tttctttcac cttaaatttt atttttcccc caactacttc ttcccatctc     25680
     ttaattactt aagaaaatga aataagctta aatcagtaag attgtcccca caagaaaaag     25740
     ttcatattag ttgataacaa cacatcaccg tgttctaatt caatgttttc cactcttttc     25800
     gttattttgt tgaaagtaca gaaatgtaat ttaattagtt tttcaaagaa aagaaacaaa     25860
     accatttttg ttttgatacc ctaaacccca aataaagcaa gagcagggta aaacatgcgc     25920
     cggtggtcct tcaaaaaaac ggtttgcatg cagatgcaat gtagtgaaca ctgaatagat     25980
     cgaatcttaa ttttttaata tcttttccaa aacactaaat cttgttgatt cgcaatcaaa     26040
     ccaactacat aacacctaaa atttcattca tacgtgtcgt gtttttcatt cgctgtgtat     26100
     actcttttaa aaataattca atcaaaattc gatactaaaa tcgaatattt ttctcaaagt     26160
     tattctttat taattaaata cgaaccatgt atataaataa gtagagagat tatttaccaa     26220
     aaatgggaaa attaccttga gttgagcaag agctaaagga gtctcggtga gaaatttgac     26280
     ggcgagagtc atgatcgtgg aggttgtttc ataaccggcg acaagtaaag ccaccaagaa     26340
     gtcaacaatc tcttcatcgg aaaatccatc atccgccgca agcaacgccg caagcatatc     26400
     tttctttctc tccgctcctt cttcctcctc ctccctcctt ttcatcacca ccaccgtcaa     26460
     cgcctccgcc accttcctcc gcgcctaaaa tacacacaca tatattagga tatatattct     26520
     caaaatatga ttgaaataag aaagaattag taaatgaaac gaaatatata cttggatggc     26580
     tttgcggtaa gtggtggaga agagagggag aggaagagag aagaagcctt cgatgacaag     26640
     aagatactct ttccttaaac tctcactcca ttcccctgga tcaaagctca tcaactgctt     26700
     caccgttagc tcaaacgtta tctgcatcat acatcatcat cattaataat catcaatcta     26760
     tgcatgcatg cggtggtgac tcggcctgac tcactgagtc acaaactcgg tccgggtttt     26820
     tattttattt ttattataaa aaaaacataa gtgagaaggc cgaataaaat aataatataa     26880
     tgtttttgat aagcaagaat ttttttggtt acctttttgg cttcttccat gaggagaaca     26940
     cgagaagacc aagaatcaag attaaaccgg actaaccggt caatatcaag catgagatgg     27000
     tctttaatga ttgaagaatt agcaaagctc atggtgagag agtgcatacg tttatgcaaa     27060
     gaacctttca taagaagcag agagtgtttc cccaaaaggt tacaaatgga agcaggataa     27120
     gaacactcaa aaagcttccc ttcgttctga agaacaaacc ggttcgtttc cgggtcagct     27180
     gagaaaatcg tcggttcacc aaaaagatgc gtcatgaaaa ccgaaccgta ccgggctact     27240
     ctctcgtcga tgaaaggctc agggttctct gttttgtaag ctccgatcag ctgaaaagtc     27300
     tctcctatca gagggagacc aaggcttccc ggaggcagac ccatccgacg gtaacgtgta     27360
     cggcggagta ggaggaggaa gccggcggcg atggaagaga ggaggaggag aaaagcggtg     27420
     aaggccattg aagaagaaga tgatgatgag agaagaagag aggatgaggg agagagagta     27480
     ttaatggaga aggggagagt gggcacacgg ggggtttctg cataaagtag gacctttcat     27540
     cattatactc ttttgcattc ttcttctttt cttttctttt tcttctaaat tataagtaat     27600
     tttctaaaat acagtaagca gtgaataata acttcttcat aaaatatgaa ttttttaaat     27660
     aaggataaaa tattttcgat actattctaa attttgtttc aaacatctct aacacacaga     27720
     ttttcaaatt tatcagagag caaaattcta taatttaaaa gatttagtgc cttaaagagt     27780
     tatatttttt ctgtattata actaaaacat atttggcatg tacgaaatta attatagtaa     27840
     atatagatga atttgtgggt tgtctatgta tattattaac ttttatgcac atggtaatgg     27900
     aatcatgatt ttcttactat atgtagaatc atttatataa tttgggattg tatatcattt     27960
     gctggtaaaa aagtaattcc ggtagcttta ttccgtttat ttttggaacc agaatgttta     28020
     tggtttagtg tgttttcgta tttggttgca gagaactcac acatgcatat gctaaatatt     28080
     atttattcaa cttttaactt ctgatttttt ttttttttta acttctgatt tcgtcatgat     28140
     aatttgattg taactggact tagctaactt caaaagacac ttaagtgaaa agaaatcgaa     28200
     ccaattttaa tccattgatt atcgatcggt ttgttgatga catcaacaaa ctagtgacat     28260
     caacagataa ttaaaatata ttaaaaggat gttaatgtga aattcttatt gaatattaat     28320
     tattgtagag aaatggagga actgatgaat cataggtcaa gaattttggt tccataatta     28380
     cattttgttt ggatccttgt tgatttttca atctatgtat attggcccat gtttttgttt     28440
     ggttgtagat cttacacatc caagcacctc tctataaaaa aaaatagttt ctgatttcgg     28500
     tctttttgat ttgattatat ataaatgaga aaacttatta gttttgatgg acatggattc     28560
     aaattaacaa acaaaactct acatgagtta cagtggagga taggagttgt gagctgttct     28620
     tctctactga tttgcgtttc gaattgtttt tctagtattg catttgcatt tgcccaaatt     28680
     gagactttac ttagtgtagg aatctaatta ttatttttgg aagtttcata attattttat     28740
     catactgatt tagaataaat tttgtaaaaa cattttaaaa gaaactaatg tttttcttac     28800
     tagtgtctag cgacggctaa tggttatatt tttaaaaaat atcaatcaac aagtatccct     28860
     ataccaacat ggctcgaaac cagtacatgg gggatgggat cactgtggaa gtaccacttg     28920
     gccagtggct tcatttcgga ttggcttgcc gattccttac aaaaaataag tcgtatgaaa     28980
     gtgaaacgaa aattttaaat tggtatagaa attttgcaaa ctatagttcg atgaatgtag     29040
     tcagtgttag attcaaaaac atatactgga tatacatttg catcattagt tttcaccaag     29100
     atcaaacatg gttatgagaa aatagataat cacaaaacat tatctttcgc acaaaactaa     29160
     gaaaaaaagt tgatgaaaga agagtagcat gtgccttgtt ggtccacaaa ttgcctatga     29220
     acacttcaca tgtctctctc tttccctcac ccaaagtccc catttcatga gtttcccatc     29280
     atctcttttc tttaaaagat atatttcttt tctctaataa agttaggcct cttcataatt     29340
     tattagtgat aataccaatt atgttcagta cttcatgatg agttttgatg tacttacatg     29400
     tgacttttac gcggtatact ttttaaggac atgatataga aaggtgggtc gatacataca     29460
     tttgaattga aggattgtat atgtttttgg acttagtctt aatcaaattt ggttggattt     29520
     ggggtttatt tgattaatca cacctttgga cgatagtatc aaatactgtt gctttatagt     29580
     ttcaatttat ttatcactat taccatattt acctttctca tccactcaga aaagaatgat     29640
     ttaatttata tatgttgaaa acaaaaatgt atgaattagt ttatacaccc aaggcgaaga     29700
     ggaaaatcgg tcaatggaaa aaagagcata gaggagtaaa aaagcaaagg agtagctata     29760
     gaagtagtga ttagcaacac ttgcctctct tagctctaag tttgatttgc ctttttatct     29820
     tctacttctt atatgctatg gaatctcagt gagtccccca cctaagatca aatcttcaat     29880
     catttataac acatgcactt agtattaaaa ttacgacact aagatctaag taaaacctat     29940
     ttacaaaaat gacatcattt aatatcgtat aaataatttt caaaagtgca caaaacctag     30000
     agaacgttga atgttatatg aaacaatctc gttcacgctt ttcgtttacc acaccattat     30060
     gcaataatcc tagttagctt taatgcattt tttttttttt agctttaatg catttactta     30120
     tatgtagcta taatataggg gagaaactaa aatgacttgg tcaaaatgtt aactcgatca     30180
     cattctctaa tgattccatt atcagtttat cacctttaat cttggtggga aaccaattta     30240
     attaattatt tctgaaacca ctaataactt atattagttc gaagttttaa aaaattcgga     30300
     gtgtatgtta taacatactt tagaagtatc ttcggagacc ttaagatata cttgtactgt     30360
     tgtacacatg ttatctcatt atcgctttaa aacgtatggc gtctatgcgt acctaaagat     30420
     ccattttggt gtattagtac gtaggctcat ttatttgtat ttcaaaattt atgtatgtgt     30480
     atatatatag aaagaaagaa acggaaccaa aaagatgaaa ataaatatat ttaatgattt     30540
     gtttttggtc atttggcaga tatatactaa tcttgggata aatgaaataa ataccacagt     30600
     aggaataaaa tataatcagt aaaaattagt gcaattacct aataatttaa aatatcatct     30660
     atacttgtaa gataaaaggg gatctaaatt cttatgtatc aataataatg catatgttat     30720
     tgttgaccct aaaccccatc cccatcctca tgtttatttc cttcctcaac aaagcaaaca     30780
     ctcaaaagcg aattgctaaa agcagaaata gttcttccag ttgttgttgt tttaaaaaaa     30840
     taaaaatata tattacatta taaatgctag tggcttttaa attagtgtta ttttcaattg     30900
     ctcctaaact atttatagta tttctttaat ttttctttag atagcacact caagttccca     30960
     aactttctct gattctctcc atgtagaggt gaagtttacc actaggatac attagtatcc     31020
     cctccaagag gtaccctttt aagaattcat atgggtaggt taataaactt aaattttagt     31080
     attatatttc gtcgatatat atgacttttt gattttataa taatttacgt acataacatt     31140
     ctcaagttat ataaatatgt aaaatctcgt gttttcacaa taaaaatcta tgatacacat     31200
     aatttttgtt atagtaagta ctactttaat ttaactgtga caattatgtt agggacatta     31260
     taagatatat gcatgttcat tctttgaaaa ggatacagag taatgtttga agaattttac     31320
     catagtaaaa taagaaatga gttattcatt tacgttattg ctcgtaaata gaaatgttta     31380
     cgttctaaat ctaaggatcc caagtggcat acaaagatga aacaattttt acacaaagat     31440
     cgttctcaat aacacgtgat gaaagcgaag tcatcataat ccaaatatgt gcattattct     31500
     attattatat atgaatttca ctattttaat cttctgaata tttgacacgt cttcgtgtcc     31560
     attagttgct atagttataa tgacgatcac aattaaacag aatatactat actcttgtgt     31620
     tagtgggtaa gagttttcaa aagaagaatg catgataact ttgtcgcatt aacctgtgtc     31680
     cttgggatta atataagtac attgattatt tgatcatatt ttctttttag ctcatccaca     31740
     ttatacaaaa aaggtttgat atataactta aatacatcgg accagtaaat atataattaa     31800
     attagggaaa tataagataa attttaatat tcaaacttaa tatatgtatt tacttataaa     31860
     tttagcagca ttttctatta ggccatggct aggccaatgc atgatgcctc gtctgagaat     31920
     tgacataaat gagtcacggc tgtgagtatt ttgtaggtta caaaacctac aatagctaaa     31980
     tcacatatca taaagcaagc tgaaaataat tcaaaccata taaatatgac acgtgaaatc     32040
     cccagatata tcacctcaat tgttgcatat atatattttt tgtgtgtgaa aaataacaaa     32100
     acattcggtt cttccatata ctgtttgagt attaatctga aatttggaca ccaaacgtta     32160
     aaactaataa tagatgagtg ggatgaagaa gatgtgttga ttagacaaat cacgagacag     32220
     acgacatacc atatcttaaa aatccacgtg tgaagtgaca gttttgagct tctgtccaaa     32280
     agatttaaga tgcctctcta cctcttattt gtctcctatt gttttgtagt ttagttatca     32340
     ctctcataat ctgtacttga ttgtgacccg tacacataat tccattatta catctcattt     32400
     tttcgtagtt aacgttaaat cgtacgtatc atatccgcaa attgattttg tcatttaccc     32460
     tccaaataat catttccttt ttttttcccc ttccaaagca aagttctttc ccacaaacct     32520
     tttaccttgg aaacgaaaga gattgagttt tagtgtcctt tcctatttag gacaatcata     32580
     tgaactcaat gaataagttt ttttttgtgg taatcatgtt tctctaaaat aaaaaatcag     32640
     tagttagtaa tatacttacg gttagtttat tgatgtcaat atagagatta tacgtagatg     32700
     attgatattt atatatcacg gagaataata tatatacgtg tgatataaag ccaacaaaga     32760
     tcttatggaa tatggtagaa gactaaagaa aacatgaaaa ttgatcctcc gactgttaat     32820
     ttaccacgca accaaaaaga accaaatgaa atagtaactt ttgctgtgtc gggtcgtgac     32880
     tagattttgt gtcgttgtga agaaaagctt caaaactctt tggatttaaa ttggtagttt     32940
     caaatacatt ttaaaaaaga aaaaaagaag aagaagatac tcctagtagg agaagtagct     33000
     agcggtcaaa agggtcaaga aaaaaaaaga agattacgga agacgaggag gggcacacgt     33060
     gtgagagatg tggtaaaaag tgttctgctg caaaaattct gagaatgtta aaaaaaattt     33120
     aaaaaacctt tattcttttt tacttaacac ttcccaaagt ctgaaatctg ctcgtgtggg     33180
     cctttgcctt tctttttcac tgtcaggcct ccccacgtgc gcctctctcc tcctcattcc     33240
     ctttctcctt ttactatttt ttatacattt atatctgtaa tgctgaattg ctgatatgta     33300
     gctcgataat attacaaata atatagtttt ggatatctcc caatagttat tattataaac     33360
     ttttattatc gtaataaaac ctctctattt gtagtttgtt tcttgcaaaa attaaaaagc     33420
     ataacaaaac catatgtacg taccaaagat tgacaaaaac tacttcatga acagtaagtt     33480
     agttttcaac ttcttggaca gaaatttttt caatataaag gtaatcagaa aatacaaact     33540
     taaagaaaga caccatgtac aagtctcata gtcatagata tacaacaact gaaacatgaa     33600
     tacaaacaat tttgagtttt atctaatgac taatggtacc aaagctcaat ggagcttggt     33660
     attgttgaag cttcagttga tttcatacac cattctctct gaaagctcag cgcccacaac     33720
     cttgcggtag ctttgtaaca tcggttccag ttgcttcctg cctacgggag ttatgatctg     33780
     ccgcatttcc ttccaaatcc attttttttt gtttagttgt catcaatatg aggagagttt     33840
     gataatgctc aataaatacc caattagcta tgataattca aaaagaaaca aaaaaagaag     33900
     aagaagtttg atgtaccttg tatctatatt gggatccata aagaccgata aggatgttgt     33960
     taatgtcgtt atctttggat ccagggtctg actcaatatg agagtcctct gattcagtct     34020
     catacatttc ctcatcatca tcatcatcat catcatcatc ctcatcctca tcttcatcct     34080
     catcactgca gcccataaag ttatcattcg tctccccttg ttccatgtct tcatgttcac     34140
     ttgctgctgg ttccacgaga gtttcagaag caccagctag taaagaacat tgattatgtg     34200
     aaatagcaat atcggacaat atgacatatg gctttttatc aagcatcggc cttgctactt     34260
     caaatggaac ccacctggaa acacaactcc gagtgttaaa aacttacatt taccagtctc     34320
     ttcacttcaa tgacatgtct aagaagagga cataaatatc tttttacaag taccagaact     34380
     tcatatgaga ggagatcaat gataaactaa ggcatagagt aaaaaaatat acgactcagt     34440
     ttggttgtaa cttactggaa acggagagga catagaagct cagatggacg ataggctgct     34500
     ttatatctca tcttgctgca ggaatgtata taataaccaa gatagtaata ctgaagagaa     34560
     gggcagcgag cttggttctc tataacccaa ttaatttctt gaatggcaga atattttccg     34620
     agcgataaga atgcatagtc tggatcccag aataagtata cacttgacaa acatttagga     34680
     agaatgtcta caaccccgac ggcaattagg cggccatcaa ttctatattg ttggtggaaa     34740
     gagccgaagc cacaaggcgg aaccttttca tcacctgaag gttgaacatc tattaaagga     34800
     gagtcgacca aaaaccttct gtatgaactt tctacaacgt gccctggctt atcattgtgc     34860
     actttcagct gataccgttt gtataactca tgttcttcag gatcaaaact agaccttttc     34920
     aaatgtatct ccagctttcg ctttcttgcc tgatggtttt ctgaatcctt cttagcgtga     34980
     agggtttcac ttccatctaa agaattggct cctctcgaga tgttaccatt aggtacaaca     35040
     tctctatcag aaaaagaatc tttggcagat gaaaggaaat tgatatggcc cttacagact     35100
     ttgatagaca catcaggagt ttcccccacc ttatgcattg cactcaacaa catctcagaa     35160
     atagtttcag gtgataatct atttccttct gcactattta tcccctcttt ctcagatgtc     35220
     tggatgcgtt ttattgcagc tgctattgga aaagcaatgt tgctggtgta taagatttgt     35280
     tctgttcctt cagctagttt ctttcttcta gcacagaaaa ccttcttcac tgaagctttt     35340
     ggtatctgca tattagacgg gaattcccca ctccgtatgc ataattgcac agcttggtca     35400
     atatttttag acaaatcatc cataactgct tcaactttct tattctcttc acttttagca     35460
     gctccaagtg tttttctcct tgtatctgaa acatcaccag aggaagaagc acctctttgt     35520
     tccctgggct gcacatctag tttgccatcc aagaaccttt gacaaaacat tattaagaaa     35580
     attcaggaag ctcttcaatg aacgacttca ttagagaaat ctgaagatcg tgaagaatat     35640
     ttacacatca gaatcataga tctctcctca tatgcatgtt tcaaaggtaa aacctttccg     35700
     actaagccaa taacatgaaa caactaacac cacaaaaact ttcatctatt gatccaaaaa     35760
     gagaagcaaa gtgaagctat atgcaccttt ctagtcttct agaaactcgc tgctgctctt     35820
     tagtaggaac aaaatcactt gctttcaaac gtatcgtata aggagggcaa cacgttttat     35880
     ccatctcatg tttgtaaaga taagtaccag atcttctcca gcctcggtca ataagagcta     35940
     cagaaaagta aagcaaagat acataaaaga tctctattct gtcaacaaaa ttggttcatc     36000
     acacatagag tccaataata gcaacaaacc ttggtagtca taaacggtaa gagtctgtgc     36060
     tgataaacct gcattgacat tcactatgtt tatcaatcat ttattcattg gaactttaag     36120
     atcataaaca aaatcaattc ttatcaagca tatgagcaat tcgagaagat tctactctaa     36180
     tcgatcgatt caacaaccta atccgtaaga aaagcaaaat taaacgaacc gtgagagata     36240
     ctggaccgag ctggggattt acagtagccg caagtgcttt tacggcggcc atgatcatcg     36300
     attacgcttt ctctgttgct tccaccgtcg tggctactac tcgcatcgtt tttcaaagac     36360
     ataatcgccg attattcatt cagaagaatt ttgctaagct ctttccgttt ggagaagaag     36420
     acataatctt ctttcacatt tgactttttt tttcaatatt aaaacattgt tgctgactgt     36480
     tatgcaattg gcaaaatgaa ggggttgtta tgtaattata aatattttaa gggaagaaaa     36540
     tgaaaaataa aaacattttg gggcaaaaga taaacacgaa aaaataatgg aatcgataaa     36600
     cagattttcg atagcatcgg cagatttgga tcaaaaccct aattctccag ttcaatcttc     36660
     ggaagatggc aagcctgtgg cgagcagtaa tcggcggtca gaacaacaat tccgaagact     36720
     acggaggcgt agagttctgg tcaaacccag aacgaaccgg ctggctcacg aaacaaggag     36780
     agtacatcaa gacttggcga cgccgatggt tcgtgctcaa acaagggaaa ctcttctggt     36840
     tcaaagactc cgacgtcacg cgtgtgtcac gccctcgcgg tgtcgtcccc gtagaatcgt     36900
     gcttaaccgc taaaggagca gaggatgtac tcaacaagca aaacgcgttc gagctatcga     36960
     cgagaaatga gactatgtac ttcattgctg attcggagaa ggagaaagaa gattggatca     37020
     attccattgg acgttccatc gtgcaaaact ccagatccgt taccgattct gagatcgttg     37080
     attacgataa caaacactaa agtttctctg tttttgtctt ttgtcaaagt gattatgatc     37140
     acagctttca ttgatggagt cttaaatgta aatcttacaa aatcaagaaa tgaaaagctt     37200
     tgtctctgct tgaaaacatg aactcatatc cgaaaaacat ataatataaa acctaattct     37260
     tcaagggcaa cgcttctggt tcaaagactt atatggttct tcaaacatgt acttaccaaa     37320
     tatggtaaca gaagcaatac cttttgcacg tgatcaaata caataacttc gtcgtacaga     37380
     ctaagatgca tgtatggaaa gttcctctcg tcattaagtg tcctaaaccc tacccgcttc     37440
     cattcagggc cgggtctgga aggaacaaca aaatacctaa aacccctctc ctcttcttct     37500
     tcttcctagt ccgacactct tagagtcttc aaaaacattg caagaaggaa acaaaatcca     37560
     tcttcttcgt ctattagaaa ccctaacttg agaatgtaag tattgatttc ccacaacagt     37620
     tttctttttc ctttaactaa ttaggtttag cagaaaacaa tcaatgtagg caagttattt     37680
     ttttttgttt cggccttctg taaattacag gtcttggata atcgttaaga atcttccttc     37740
     caaacatgtg acagaggaac gacttcgaga tgtcttttca cgaaaaggag aaatcgcaga     37800
     cgtgaaattg aagcgtaaaa ggtacattca aatcgagtgt ttttcacagc taattcttgt     37860
     gtcactatat ttcgttttgc ttttgcagtg atggcaaaag tagacaattt gcttatattg     37920
     gctttcgtac tgaacaagaa gctcaagatg ctatcacata tgttaacaag tgtttcattg     37980
     atacttatcg aatatctgtt gaggttatta atcttcactt aattactcag tttcacttat     38040
     gtagtactag tttcaaatct aaatcagatt ctccttggta tataggttgc ggaccctcct     38100
     ccgagggaag aagggaaggt taatgaaaat agtgaacatt ctcatgaaca agatctcggc     38160
     tagcctttca aactcttttt ctgttgtcaa cattctttat caaaaacact caaacaaatc     38220
     gaagcattca ttgtaacaaa gtttttttgg ttgaatctat ttttacgttc tttcaaaaaa     38280
     aaggaaaata ctgaacattt ttctaatgct tatgctaaag gagacaaaaa gattaagaag     38340
     aaaccagagg ttgatcatga tcctcagctt caagaatttc ttgagcttaa taataagttg     38400
     aaaacctggt ccaatgatat gtgtccatcg gcaacgatca ggtctcgccc gatggtgctg     38460
     atgagcctaa caaagcgaaa atatcattat tagattctaa aaagactaga aagattaaag     38520
     ttgttgctct cgttggtgat gatgtttctg atatggaata ctacaagagt cggacaaaga     38580
     aaaatctgtc ggattcggac agtgattgtg aaacttatgg ttgtgaagat gcaattcatg     38640
     tttttcctat tgatggggat attgaagctg acagagttga caaagagttt acaattcatg     38700
     ttttcggatt cggacatcag gatgtttaat ttggatggtg ttgcagggca atggagaaat     38760
     tagataaatt acctttccag gggcggacgt tgaatatttc accagctaag ccccgtgatt     38820
     atggagacca aagaagcact tgacttttaa cgaataggtg attattctct aacctgttct     38880
     tacttgactt ttcaggttgt tttccttgaa ccgattgagg cacgtgaagc tctgaaggga     38940
     atgggcgtac aagcgttaca agtaagcttt tgtttctcta tgtataaagt ctaaaatcct     39000
     cattctttct tcccctaaag tgcttcttgg agataaatgg ttgtcctagt ctaaccaaac     39060
     tgcttcatca catttcctta ttattacaga gatgctcccc tgtatctggg gctcctagag     39120
     atattcttga gccaaaagca cttgccgata acaatgaaaa tacgagtgat gttgaagaaa     39180
     atgatgtgag aagaagactc aacttggatc agcaggttgg aatcgattcg gatataactg     39240
     aggtatgccc actttatgat tgctgtggac gttttgaaac catgtgttcg tccttttgtg     39300
     tggtattgaa gtatctgaac taatttatgt tcgggtttag tattacagtg taagtttcac     39360
     gttaggtact gaataattta tgttgactgg cttcaagttt tctgatcaat cttgtaacat     39420
     ttcctttaaa taatgcatta tatttcagtc aaatgtcctt tatgttaaga ttctgaactt     39480
     caagacactg atgagagttt gaagaagcat ttgactgaac tggtgaagca gggaaagatt     39540
     ctgagtttta aggtaagttt tgctgacaga tgatgatatg cagttaacca tcatgtctgt     39600
     tttttatatg gttttgtaga atttgactcc gaagagacag cgaccagtgt ctacagagat     39660
     ctacaggtat attatcctag ttaagtctct ttaatttgaa acttgaagtt gattggactc     39720
     gatgaagtag ggtgacaatt ttttgtttgc tcctagggaa ctgttgtgga tgggcatgct     39780
     ttgatcttga gcttctctaa aaacaagccg agtggaacgg ttgggaaaga tttagacaag     39840
     gacacaattt tgacaaagtt acatgtgaaa aatatagctt ttgaagcaac tatgaaagaa     39900
     gtaagacagc ttttcactcc atttggacag atcaagagcg ttgggcttcc agagaggact     39960
     aagggaagat atgctggtta tggttttatt gaatttgaga caaagcaaga agctttaaac     40020
     gctaaaaagg cattatccaa cacccatttc tatggactta tcttgtgtac tcatctctct     40080
     agcctgttca tctttgacat ccttgaatgc atcctcaact cgctatttgc cgtctttgca     40140
     ggtgatcgag tggaaaaagg ttgacaatag catgaaggcg atccgatatc gttctgctgc     40200
     caagtatgtg gatcaagaaa acaataatcc aaagaaaagg aaaagctcga cagttgttgg     40260
     ttaaagaaga atcaagtttg ggagaatagc tgaatattat tgaccatggt ttctattgta     40320
     acatttttca gagcttcatt aatggagtct aattgcaatt ctcacaaaat caagaaaaag     40380
     aaaaaacttt gttctgcttg taactgtttt atacacatga actcggagtt caaagaaagc     40440
     cagcctctgt tcttgggcac aatcattttt tcacaaatgc agattcagcc aagtcgatgg     40500
     ctcgagcaag accagcggct ttgttctggc actcacagtg ttcgtcttgc gggtcactat     40560
     cagctactac accagctcca gcttgaagat aagccaccca ctcacgccgt ttgttagcat     40620
     ccttgtaaga gtacattgta ttgtattgac atgctgtcgg aaaaacgatt gtcctaaggg     40680
     ataaagcaat gtccatgtca ccagtgaagg agactccacc aaaaccgcca ctgtatggtc     40740
     cacgcctcgt tggctctagc tcatcgatta gttccatagc tttgaccttt ggtgcaccac     40800
     taactgttcc cactggtaaa gccgcacgta gtacgtccca gcaagtcaaa ccatcttgta     40860
     attctcctgt cacctacaca cagaattaga acttaagata ttaaggaaca cactatgcga     40920
     gactttagat atttgatcta ctactagtta tctaattaac aattaccgtg gagcttatat     40980
     gcataacatg ggaataacgt tcgatgttca taagcttctc tactttcact gatccgtatt     41040
     tcgtaacctt tccaacatcg ttgcgaccga gatcaaccaa catgatgtgc tcagcacatt     41100
     gcttttcatt ctctagcagt tccttttcta atctcttatc ctcaacttca ttcttccctc     41160
     tcttgctggt tcctgccaat ggccgattca ctatcttgtt ctgcttcaaa tatgatataa     41220
     aggttagctt caaaaatgat ataaagatta atgcagcttt gagaaaagag agatttacct     41280
     gctttacttt ggtgagaatt tctggacttg atgctaccaa aatgcatcct ctagcctgaa     41340
     taacagaacg aaaacagcat tgatggttta tccacaagta caaaatgcaa agttgttgag     41400
     aaatgttctc tccatcacca acctgcaaat aacccatata cggacttgga ttcacaactc     41460
     ttagtgctct ataaacttca aaggggtctg caaatgttcg ccgctcaaaa cgttgactca     41520
     gcacgatctg aaatatgtct cctgcaagta tatgttcttt ggccttgacc acagcctcct     41580
     tgtactcttc gcatgtcacg tttgaattat ccaaagatgg cccaaattgt cgtgtctgaa     41640
     gattcacgtt acctgcagcc agttttggcc tgcatagatt cacagcggaa gaaaaatgaa     41700
     caacttttaa gaatagtagc caaacggagc tgaaaaactt aatcaattca aagagatact     41760
     cacggctcaa tatcatgtaa cttggccacc aagttctcca aatgttgcat tccattactg     41820
     tatgcctttt cgtaaggaag gctcccatct agtctaatcc agtgaatgac atatgctttc     41880
     tgtaaaattt tacaaggaat ctctagtcac cacttcaaga acaagataac gcataaaaag     41940
     gaaactaaga tgcatgtctc agttaatcat aaaacatgga tggtgacaaa atgattacct     42000
     tttccacgtg atcaaataca actacatcgt cgtacagacc aagatgcatg tctggcaagt     42060
     tcctatcatc ctcaggggcc tttgaaaatg gcaatttcct cttctcaaca taacgaacag     42120
     tgtcgtacga gaaaaaacca acccacccac ctatcataat aaagaaatct tactaagaga     42180
     taccacttca tgaacaagat aaagcacaaa aagtaaacta aaacactaag ggcaatcaat     42240
     cttctatcta aaagcgcgag aaaagatatt caagaacgta aaggcgaatt gggcacaaaa     42300
     ggtagaggga aaactagatc acaacaggga cagaatgacc agcataagaa agttctctac     42360
     tttatcaatt gctcttgcct cttgggaaat cagacgtaca tgtttacaac taggaatccc     42420
     atgaccccat atgatatggt atgtagtgaa cacgggttac gtgcattaat tgctaaatgg     42480
     ttttgagata gaaatccatg aaacttgaca tttaaaaaga tcactcaaaa gcaagagctt     42540
     gtctcgaaga catccatacc attatcacat atccccagtc cttaaaacta gtggcttcat     42600
     tccttttaag ttaactattc tagaaagtga ctcattataa acaataaaga agaatctctt     42660
     accacaaaac gcatctggaa ggtcctgaac tagttgagga tcagggttcc atttctcaga     42720
     gatttttctt gggatctcca ttggatcttc gacgaattcc tcagtcatgg tttcattgtt     42780
     gtgatccatt acaataactt tattctcctt tgccacgatc tccatcgcag gctgagcccc     42840
     aacaacgcta taacgaccct atcgagacca atcacatcaa agaaacaatt aggaactgag     42900
     acatattaac agataaaaag gatatgtaca aagaaagatt atatacttac aacgctagac     42960
     atctgagaac caggctcaac ggactcgaaa agaaagctag gagcttcacg gtcatcttct     43020
     ttgaccaaac aacggtaagc aagaacagga gtaagctgat cagagaatat acagcggtaa     43080
     attggtataa ggtttgtact cttagaagca tctgccaact tctttgtatc acttactgca     43140
     gagaacaagt ccaaaaacat gtatcagaac tgttttcacg cttaagaaga ttcacattca     43200
     caatcaaacc aatcaaatta gtcagagaat agaaattata agcttgacat aaatgtcgtt     43260
     caaccatttt cccgcatttt atcggtaaaa aatcaaacaa tcaaaaaccc aaattaaaag     43320
     aaaaaacgaa gagcattgct tcacctattg aagcttccgg agaaacagag acgcatttaa     43380
     tcgaacggaa agaaggcgcg taagccgagc ttctaccgga gtatccagta acggtcacag     43440
     aagaagaaga gagataacga gaagcaacag aagggagaag ccggcgagag aaagtcagtg     43500
     cttgcatcgt cgctacgttc atagaggaag acattgtaac ggctaagaac tcggtggcgg     43560
     ccggaatgtt tgaagatcgg agaagaagat tcagaggtga cggctaaatg agtaaatttg     43620
     attagtgatt attctacgag atgtggcata tttataaaga agatgaccat gtgacttatt     43680
     tagcaattta ctttaatacc ccttacctgt attttccaat ttccctcatt ttttcactat     43740
     aagtcatgtg catgaaccat gaaggcagcg aacccttttc ggaaaaacta agcaaacttg     43800
     tcattcacaa agatattgca tcagtttcat aagcaaacga tacgaacggt cgtctttctc     43860
     aaaagtcaaa aacccttatc ttcttacttt agtgttcgaa aagtctttct ttattaatgc     43920
     cattacaaga caatcctcaa gtatgcgttt ttcatttttt tccaacaaaa ataaaaacat     43980
     agaaaagttg gtaacatgcc tgatagcgga atgttaacaa tactacttct tttaccagat     44040
     tagtatttaa tttcttcagt caattatata atagtacgaa tgtagaaact ttgacatttt     44100
     cttgaataaa caacgatcat agtaggacta tgtaaattgg aaggttgctt tagcctttag     44160
     ttgctaccaa ccaaaatcaa atccatccac attaaaagca tgtgcttttc ttcttatctt     44220
     ttaccttcca atttcataat attattcttt ccttctatta tactaatatt aatccttcct     44280
     agtcatttct ttatgttatt aaagttttga attgtttttc ttgaatagag aatttaacgt     44340
     cgttatagca tcaaatttgt cacatactct cgcatgtcta taatgtagtt taaatttcta     44400
     ttaattcgtc tgatatatat atatatatat acaaagttgt taacaatatg attatcacta     44460
     ccccataaac aaagttggtc ttttctgttt ttccaaccag tgaaagtctc tttttcaaaa     44520
     cctagattga caatcccaca cgtaattaat aactgattag caaaatatta gttcacattt     44580
     ctgtgagaaa tttggtttgt ttcctaaact gctccatgag agtaaaaata tagagcaaga     44640
     acaaaaacat aactttagat gtcaaagtag agcatagaga ccaaaacaaa aagttacaac     44700
     tatatctctg atttcttatt gtgcggtgta atgatatgag tcacttcaca agccaatcat     44760
     catggcttca ttgcccgtga aagcaaatgg gtaaggcaaa cacacaagca aggagagaaa     44820
     caaaaccagg attccaagag acacatactt atcatcaggc accgtgattt cttcagccag     44880
     cggcgcaatc ggtccacgct gcaggaagaa tatcagaacc acccagtaga atgccacgtc     44940
     gctgaacaac gccgataagc ccaaaagcgc tatggatgca cccgtgagcc gtgttgcggt     45000
     ctgaaatcat taggagacat atataattct gattactacc taatcaatct actatgggga     45060
     atggactcga acacaaagac gaatagtata agacattgtt aagcttttta agtcattcta     45120
     attagtgtta cctttcttcc ccaaatggag aaagctattt tgcccccatc gagctccccc     45180
     gcagggatac tgttaatgcc attgatgaga agtccagccc atgcccagat cacaagtggg     45240
     ttaagagata ttgaagttcc ttctttgagt gcatcaccta gtaggagctt tgctataaga     45300
     gaaaaagaaa caaaatttaa acattgatca actctccagc ttcagcctgc aacactttat     45360
     catatttgat tgagagctaa agcttaccaa taccaccagc aaggaaggac tcgtgaaaca     45420
     ctgatgcatc aactacaacg ccaatgccgt cactgggagg cacgaataac cctataagaa     45480
     acagaatcaa gcctagagaa aagccagcca aaggtcctgc agctgcaacc ttcaaaagat     45540
     cttctcgctt ggctacgata tttttgattc tcgttatagc accgaaagag cctatctgcc     45600
     atctaaaaca tgttcattaa atgtctaaaa aaaccaaatt tcagctgaaa gtttttcctt     45660
     ttctttcaaa tagaacatcg catcttcacc tgccaacttg gaacaaagaa tggaacacca     45720
     agctttattc ctaagctatt tgcaactaaa atgtgtccca gttcatgtac tccaaggaca     45780
     agagcggtga caagagctcc tggtaagcca tcttttaaca gttcaaggtt gtcaaaggcc     45840
     gatctgcaat taaattcata tatgggaggg aaatttttta ttcagttaga tgttttggaa     45900
     gcataacata ttctagagaa aacatgttca agatgttctt acagtaagtc ggattgcaag     45960
     gcaggcacat tacggagaaa caatgtaaac aatgccacca atccaaaaga accagcagca     46020
     aaccattcag gaacagctgc aaattatatg tagtatccag ctaaaactta ataatctgag     46080
     agagatatcc ttattaacat ggaagtgtat agcaatatac ctgttgtctc gggttctaag     46140
     gaccttcttg gaacaacaac ggccacaggt ttatcatcct caggattcgt gagaaggaaa     46200
     agcttgtact ggtcaccaaa attattctgc agattgatga gcaatacact attactcttt     46260
     gtcacaacat gtgcttgtca acgatcatag ttaagaaagg aaacccaaaa agcagaattg     46320
     ttacctccat cctcgtcttt atcttctcgt aacttgtagc aggcttgcct cttagatttc     46380
     ctttgaacaa taccccaccc taccaacatt ggataaaaac gtcaggagat ccaacaataa     46440
     gagaatttca gaacctcgta tttatgtttc attaaaagca aagttggtaa taacgttagg     46500
     aaaaaagact gatgagtttc tcactgtctc acctcatatg gttcttggct tgttacgaag     46560
     aaggtgtcaa atccaaatac ttggcccctg agaatatcaa tggtttcctt ggggagtctc     46620
     atggaatcgt ccaattgtaa tggctgttca caacaacttt ttatgaaaga taaacaacca     46680
     gaaaacatta tgctgtcgtc tttgtaaata acatggatga taatacttac attcacacca     46740
     ggaagaggag aaccactgct aacttctaat ttatcaccgt cctattccaa atgcagtaga     46800
     gtacaacaca ttcagaaaca aaaccaagaa acaacgcata tggacacgtt atgccatgtt     46860
     ttcaaattag attcaattac tttcaagttt aaattactag actaccaaaa cttaaactta     46920
     caaattgagc tttaacttca ctatggatgc attagtttcc aagtaagaag acaatacctg     46980
     agaactgaac tgagctttgt tttcctcctc attgcccggc gcttcattca caaccgttga     47040
     ctgtgaattc aactcagtag gaatttttgt aggaggatca tctgcagagc tctctttgcc     47100
     ttctttatta tcctgcaaag aagaacttac gaactcagac gcgtatacgt accaacactt     47160
     ctaatggacc acgaaaaagt ttccacatag ggaaaatcat aaacagaatc atagtctcta     47220
     gaagaaaaag ccacattgat acaaaagcaa atacctcatc atcattgcct tctggttccg     47280
     tttgcgtctc cgtcactcta accaaagtct ctctctttct gaaaactcta aattcaaagc     47340
     caccagaata agtagacaaa gaagtagcag tgctcacgcc tcacggatta acaaaagaag     47400
     aagatgaata aaacaatata cctttcaagc ttcagatcct tcttccttcg agatgttcct     47460
     gtttgcccaa aattgagact ggaagtagca gctacaaaag gctgaaactg aagactacaa     47520
     catgagctgc attgcgacaa gacgccgaaa ttgccgcgaa aactagccac cgcgagattc     47580
     atgtccttaa gaaagcgacc aacaaaattc gaaaagtcga gacttttaga ttctccgatc     47640
     aaaactctga tgccattatt acaaagtaaa gatttttaat ttatgttctt cagatacttg     47700
     tacgatttca gatgctgtgt cctctcgtgg ttctcttatc gttggaggag agaggatctt     47760
     tcatttatcc gttggaggag ctctttccaa gaataacgcc tcgtcgtttt cgccttttag     47820
     agcgacatgt agttcctttc ttaatatctc aaacgacacg tttatgtggt aaggatagaa     47880
     tttgggcctt aaaattaaac aattaggctt tagatatact aggtcttaaa tatattggac     47940
     ctggtgcaaa tgcaaagaac cgggcctgaa taagaaagac caaagcccga ttatccccag     48000
     ttttttgccg acacgactgc cccttcttga taataaaaac ggcatacatg ttcttttatt     48060
     taaacgacac taggttctct acttaatata caaaacgcca cgcatgtttg cacgcaatcc     48120
     ttctgaaagt cgttcatctg tagaaaggct tgaaagctgt gtgcggattg tggaagagga     48180
     ggcgatattt ttcaatcgtc gctcgtttgg gaaagtcctc acatcttaga tgaactccaa     48240
     tcgcttcgag aaactctaat tcctcgggag tttccgatag catcatcggg aaattgtttt     48300
     tccgttgaac aatcacaatg gatggtaaca aagatgacgc gttgaaatgc ctaaaaatcg     48360
     gcaaggatgc tatagaagca ggagatagat ctcgcgcttt gaaatttctt gagaaagctc     48420
     gtcgtcttga tccaaatctt ccgatcgatg gtcttgtttc ggatctgaag aagcaatcgg     48480
     atgaaccagc ggcggaggag gattcgccgg gatctgctgc caacgagtca tctaagccgt     48540
     cggatcgacc ttctcttcgt caacgtggat cttcgtcatc agccgcggga tcgtcatcat     48600
     cttcgtcttc cacggaagaa caacgaacga tcgtgaggga gataaaatcg aagaaggatt     48660
     actatgagat ccttggattg aaaagtaact gttcagtgga agatttgagg aaatcttatc     48720
     ggaaactctc gttgaaagtt catcctgata agaacaaagc tcctggttct gaagaagctt     48780
     ttaaatccgt ctctaaagct tttcaatgcc taagcaacga agacactaga agaaagtacg     48840
     acggcagtgg ttccgatgag cctgcttatc aaccacgccg agatgcgaga agaaacaacg     48900
     gattcaatgg attctacgac gatgaatttg atgctgatga gattttcaga agcttctttg     48960
     gtggtggtga aatgaatcct gctactactc agttccgatc attcaatttt ggtggaggaa     49020
     ctagaacagc taatcaagct tctgatacag gattcaatcc tcgtgtactt cttcaaatac     49080
     ttcctgttgt gttcatacta ctactcaact ttttgccttc tcctcaacca atttactcgc     49140
     tttctcatcg tataactacg agctcaaatt caccacgcat aggggcgtca cttactttgt     49200
     gagatcagcc aagttcgagc aggaatatcc gataagtagc ttcgagagac agagggttga     49260
     agagcaagtt gatagagatt acttgtctat acttggccag aattgtcgcc atgagcttca     49320
     gagacaacaa tggggatata tccgcgaaac gccacgttgc gacatgatga agaggtttga     49380
     tgcagctgct gcataaacca tccaggtcag agagagactg aagcaccaag ttagtaaact     49440
     caaatccaag aaacttggtt ggattgttct gagacatagc tatggtactt actaacttct     49500
     gagcattttt gttgatgctt cagtagtttg atttctaagt cccaaactca tatacgttga     49560
     ttactgtcct ccttatgatg tttagtatga aacatattat gtgtgattat atcttaatta     49620
     gaataataat tactttgttt gctttgaatt tttacttgag ttaaatgcta ttacatcaga     49680
     agtttcctgg taaaatacaa ctgagtcttg cagaaaaatt aaactttttg acactccact     49740
     atccacacaa aaaaaaggag ccctagaagc ttacaagctt aacatatgta tagatttgat     49800
     acccccagga acaagagata aaatggtatt gttttaagcc acaaagaaga ggaaaacaat     49860
     caggaacaag atgataacag caaagatctt catcatgagc catctatttg acgaaattcg     49920
     agtgagatgc tgcagaagag cgctacgtgc tccctctaca ttaactaacg attcatccat     49980
     attgtcatcg attctgttcc ataaaactaa caggtgttag atgatgttcc cagcaactcg     50040
     gaaaatgtcg ggttgtgggt aagaaaacgt taacgaacct gattgctagc tctccttgtt     50100
     gtgtgaccat tgtagctagc tgcgggaata ttccactgag ctctgttatt cttgattcaa     50160
     cactgtgaag tgcaaccgct cgactttggc tatagttctc ctgctttggg actgtttgct     50220
     gcaacaagga catctccatt tgctgtgaag gagcattctc gatcgcggat ctgcgtctgt     50280
     tttagcatga cataaacaaa acatcatgtt ttatacatca ttttgacctt caagcataac     50340
     ggtgaacaaa cacaatcaag agttgtaagt aatgggaatt aggacatacc tgagctggct     50400
     acctggcgga gctccagtat ttaatggagg taatctgatc ggttacagga gacaaaacct     50460
     aattagataa gaacaactat tacataggaa gtagttctta aacaaaactc acagtggttg     50520
     ttgtaaattc ccgaaaggat ttgatgaact tgaccaagga ggaggctcag gtacagattt     50580
     tgcattattc tgaggcggac tatctactgc attttttgtg gaaaagagtt gtttccggtt     50640
     ttcatgagcc ttcatgttct gcaggaagac aagacatatc tcaataaaac actgtccatt     50700
     gtaggataat aggcagatac aaatcaataa aaggttgaca aatctgcaaa tccaacctct     50760
     gatctcgtag ttagaacatc ttgaagctgc ttagtagctc ccataagtct ggttttcaag     50820
     tcatcacaaa cagcagtgta atgaccaact tggtcctgtg aatagttccc atcagcaagc     50880
     tccatgttct gaagggtttg caaatccgag agagccatat tcagccccgt gatatcgttc     50940
     ctgatcaaca cagttaactc ctgtatttcc acagtccggt cattgaaaat cgtcgattgt     51000
     tttgccactg tgattcatca aaagtttcag gtaaacaaaa actaaggctg ctctcaattg     51060
     taatcacaac aatgtcacta gaatcgttta aagatcatat gcaatacatc taaacacaga     51120
     caaataactt ccgcagcaag caacatggaa ttttctattt tcttctaagc accatttctt     51180
     gttgcaagct aaatgcataa aagcagggtt tacgttacac ctttcctaca agacagctat     51240
     aggaatctat gtattaacct cgttagaatc caaaaaaaaa aaaaaaaaaa gcctaatttc     51300
     attatccgga tcaaataccc taacatttct catgtttatt caaatccaga cgaaattgat     51360
     tccagcagaa attaaatatg aagatgacga gcatagatct gatactggat cgtacattta     51420
     gcgagcctcg tgatcttctg tgacgtttct ttaataccta acccgatccg ggaagccttc     51480
     ttattgaatt cggatcccgg agacgaccgt ttggatgatg ccggatcatc ttcatcttga     51540
     tgaacggacg ggattgcccc gatcttcttc aatgtttggg acagtgaatg aagctccacc     51600
     gtccgatctc tgaacgtcga gcccatcgga gggtcggaat tgaactaaag tcaccggcaa     51660
     attgatgaat ttcctcagat gatgagcttt atttcgagag taacgagaga tgtatcaatc     51720
     ggagaaagag actgagaaac atatagggag catattcgat ttacgtcaaa ataacaaatt     51780
     ttatgttatt caattataaa tttttaaaag tttaataaaa tctaatgtta ttgaacaagt     51840
     gattctaaaa tctacttaaa aatcccatgt tattaaaaac atttgagact taagttaatt     51900
     tgaatggatt tacttacttc aaaatacaga attttaaatc tcataatttt aggttataac     51960
     aacttcttga atttgagaag attttacaat aaatcataat aaattcttaa attcactcaa     52020
     ttttttcaaa atcatataaa aactcaaaat aaatcaaatc actcgaaata taacattgaa     52080
     tacatctcca cagtagtaag aaattgatag aagtgcgtgt cattattatg ttataacatc     52140
     gaacgtcttg ttgtttttat tcttgttgga ccgtgtcccg ttttaacatt tggcaaccaa     52200
     aaggtgtgcg tttaggcatt aattaatcta actttgggcc caaaacccaa tattatttcc     52260
     gtctttttta gtttagaaaa gtctttgttt tttttgttgc tgatttccta atatcaaatt     52320
     tgtttcgtat ataagataaa tggaatgaga ccgaagtttt ggaatgagtc acatgatccg     52380
     agccagacca acaaaggaag catatgagaa gcatgagaaa aaaatcactt aagtatctta     52440
     attttgttca tgtttgttgt gaagggctta ctaagatatt aataaagaga aaagataaag     52500
     tgtgagatta gaaagttgta tataagaagt gaatggaaat taaaggtttg gggtaatgtt     52560
     ggatggatca gcgacaaacg tggaagcgag gagatccaaa aaggaagctt cccaagcttc     52620
     gcgaggcgta ggagtctaca ttttaagcat gccacaattt catgcccttg tttcccaatt     52680
     ttgcgatttt ttcatgtttt ttttctttta cgtacaaata acatttattc aaagttcaga     52740
     tgttatgatt tatgctttat gcttccatac ttaaagattt ttagttatga tttatgcttc     52800
     catgctttta ctttttttgc catggaacca tttctgtaag tatataatca tcgattataa     52860
     acctaaattg ttttcatttt tatgaaatat ttacattctt agcaaaaaaa aatagttcag     52920
     atgttattaa gtgagtgttt actgtttatc aacgaattaa ttagtgtgat aaaaatttgc     52980
     aatataaatg tattgattct ctcaatttac caatcgtttt atcttgaatg catttagaga     53040
     tgggagttcc tgtttttttt tttgcaattg gaatcataaa acgagaactt acgcaatctg     53100
     aacaaggtca tttaggatag acattttaaa ttatacaaaa tgacagtaat ttgatttttg     53160
     acaacgcatg atgttaactt aattttctta taagattttt tttttttttt ttttttaaaa     53220
     acttttgatg atcacataca cgacattgac ctaggagtta gagcaagaaa attaaaaaac     53280
     cctttgccaa gaactagtaa ccaaaactta tgtcgcatga agcttcattt cttatacgtt     53340
     atatacagta taacattaat agaaaaacta gaaatatttc tttaatggtg catgtaacat     53400
     cattgggaat tgcatgtgag tgggatttac aaatttacaa tgtgagacca ccttccactc     53460
     aatatatata tgttccaaag tgaaattttc gttttaatat aacatacttg aatatagaac     53520
     caaataatat gtatcatgtg tgacgggttc aacgttttca aatgtcctaa aagaaacaaa     53580
     gaaacaaagt ttttgattta ttattttaaa atcacaaaac catataaagt ttaaaaatct     53640
     tgttaaactt cataaaatcc gtctttaaaa tttttaatat aaaagtttga ttcatattat     53700
     tgttctttct taaaccaaca tttcgttgat gaaagatggt caaatgaatt ttttgttgtc     53760
     aagctagaga acacctaaat tttttccaat tgatattatg tatgttaaca caaaaagagt     53820
     tatctaatac gattagttaa tttatggatg attccaagta gaaacgccaa cataaacttt     53880
     gactttgagg ccgaattgat ctgcttcttt tatttctctt acaaatttga aattaaatta     53940
     gtcaagtgtg atgataaaat acataacgtt tgtacgcatt agtatgttgt gtagcggaga     54000
     gactcttgtt tataaaaaca atgtttggtt tattctaatt gtcattttat tctttggatc     54060
     tttagttctc gcttagcgtc tcgtgcatat ttttcctcaa aatcatcacc attaaatgac     54120
     tcacgtacac aataatcaca acaacataca tatatatcac catgccaaaa tacatctgaa     54180
     aaaaataaat tcctagtcgc tacactgtca tattttgatt gatatttaga ctatttagtc     54240
     attcagataa cattgttacg aggaagtata tatacatacg tagcgttgta ctactgtaac     54300
     tggttttaaa tttatagtat taattttgtt gatgttccga ttgaaaaagt cattttagga     54360
     aagaacgaaa aaatagtttg aaagtgattt ttttttaaaa agatataatc ctacactgtc     54420
     atgttttgat tgatatttag tcattttgtg tgttaattaa cactttatta tagacagggt     54480
     tagttattaa tttaaatcta aatgttcttg taaaggcttc cacttaattt tctaatcacc     54540
     atctgccgac caaactactt tatcaagtca cagcttttgt ggaaaaattt ccgttaattc     54600
     atgagctttt ctatttgttc acacttcaca caatcattaa attaaatttt gcggctaatg     54660
     ttagaattat cgtacgacaa ctgatcacac gctacatgtt ctctagctta aatttgcaac     54720
     atatataatt gaaacatcac tcaaccccac aggctacaac atcccacatt taatcaagaa     54780
     atcaatcagt tcacaattac tgatgaaatt acgcagcaag taaccctagc taactaggat     54840
     aaaagaaaac gatcaattct cgggaaaatt cagtctctcc cgaatcccaa aaacaaaagc     54900
     atgcatttcg taataaacaa cgcactgatt ctgtttgatt ttttctacct ttatcctaca     54960
     caacactagt taaacgacac aaaactcaaa acacgaacac agttacttaa tctattcccc     55020
     ttattctttc tttttgatta taatagcata tcggaaaaaa atctacaaac attcaaaaaa     55080
     acatcatcta ctcatctata tattcaaacc ttggtccatt cacatcacga agtccatcgc     55140
     ctataatcat ataacatatc caaaacccta aaacgcaaac actaagataa ctatttcttg     55200
     aaattaataa tgtcgtcgag aggattcaac attaaagcta gaggattatg taataacaac     55260
     aacggaggag gaggaacggg ggcgaagtgt ggacggtgga atccaacggt ggagcaagtg     55320
     aagcttctga cagatctgtt caaggcggga ctgcgaacac cgagcacgga ccagattcag     55380
     aagatctcta tggagctgag tttctacggt aagattgaga gcaagaacgt gttctattgg     55440
     ttccaaaacc ataaagctag agagagacaa aagtgccgga aaatctccac cgtcaagttt     55500
     gatcatcgtc aagatacaga tctttctaag cctcgccgag acaacgtacg tcgtcatcaa     55560
     ctaccagcga aaggttaatc aagatctctt tctagattgt tttataatca cattttacag     55620
     tatatattat cagtttatca ctaagacgct aataatgtgt cttggtttct tataaatatt     55680
     tttgaagttt gtaaagtaga agagaaaatg atagagacgt tgcaactctt cccattatcg     55740
     aaagttgaga gagtgagagc aaacgttact gctgcgagcc acaacgaata cacacgagag     55800
     caagcatata cgacggcgtt ttctacattc tcaacatgtg gggctgagat ggaacattcg     55860
     ccgttggatc tccgattaag ctttctatga acggatttga tattaacgta caactctagt     55920
     ggtgacgttg ctaagaaata aagacatgat gatcacattt atttagatct agctagattt     55980
     tgacaaattt cccttgtaac aatatcaacc taataatatc gttgctacat tttttttcat     56040
     tagcttcttc tcttcactta ttgcctgttc tgttctgtgg cctacccgtg aaatgagtac     56100
     ttacgattta gggttataac attaccatag tggaagggat gatatttctt tttgtatcac     56160
     atttatgatt tacacttttg aaagtctcca caacttaatt tgtcattatt ttattttatt     56220
     ttctcctcta caattcatat tttcagcact cgtttgaaaa attacttcaa aatatttgat     56280
     aaaataagaa ataaaatcct atttaattat ccaccgtctt aataaatttt cgagaaatgt     56340
     atattggaaa attgcccaat aaatgacgtg atcaggccca tcatattggg cttaacaaaa     56400
     gaaaagccca ttatagggaa ataaaataaa acgaccatat tagaagcaat ttagtgcaaa     56460
     gtggtttttc ctggagaaga agcaaactct caagctccgt cgggaaaaaa aggaaaacca     56520
     gatcggaaag ttcacgtttt tcaaatcttc tccggagaaa tcagattact tgattcttca     56580
     aacaatggat gtgattaaga cgcaacagat ttcagcaagg acgatcgaga aagtggttgt     56640
     tcatccacta gtcttgctta gtatcgtcga ccattacaat cgcgtcgcta aggattcaag     56700
     caagcgtgtc gtcggtgttc ttctggggag cagctctcgt ggtgttgttg atgtcaccaa     56760
     cagctatgca ggtatgcctt atttatcctt tttcctctag tactcttgga tcccagatct     56820
     cagattctgt tgaggtctct aaactgaaac ttgaattgag tggttattca tacctgggtt     56880
     ctaggcagat gtgtataata acaccattta ggtttttttt gtggctgttc tgttccggaa     56940
     ttgacctctt ctagagttga tgtttacttc agttaaatca cgttctcgct agggtttaag     57000
     attcaatcga gcccccgtcg agaaagagat tgttttaggt tgatttagtt gcatttaagt     57060
     ttgcagaggt gcttgcttat ctatggacac tgtcactaga aacctcttta atagatggat     57120
     gttgtttaca tatgaattcg tgttaacatg ttgacatctt gaattgtagt gccctttgag     57180
     gaggatgaca aagacccaag catctggttt cttgatcaca actaccatga gtcaatgttc     57240
     cacatgttca agagaattaa tggtattttc tcaggaaact gatgcttata ctgtttatga     57300
     cattgtagaa atccatgctt ttaacactac ctacttgctt ttcagccaag gagcatgttg     57360
     taggttggta cagcacaggc cctaaacttc gagagaatga tttggatgtt cacgcgttgt     57420
     tcaatgggtt agtttccagt ttaatcattc agatatcaat tgattggcct ttatggattg     57480
     aggatcttct ggttcttaaa ttgtgataaa gatttgtttt aggctgaaat ctgtgtttct     57540
     ttcccacttt acgttttttg tggcttcggt ttcatctcca attaaggttc actttgcttt     57600
     tggttttgca gctatgttcc aaatccagtc ctggtcatta ttgatgtcca gcctaaagaa     57660
     cttggaatcc ctaccaaagc atactatgca gtggaggagg ttaaggaggt aagatacaaa     57720
     cccttccaaa tattgtccct tttgtaaagt tgtatgctta ttataatcag atgctgatta     57780
     aacacttctt tttctctcca gaatgctact cagaaaagcc agaaagtttt cgttcatgtg     57840
     tctacagaaa ttgctgctca tgaagttgag gaaatcggta tgtccaaaag ggaaaacagt     57900
     tcttttgatg atttcatcat ctcggttgag ttttaaagaa atgtgttttg tgattgttct     57960
     gaggaagatt ttctgacact tacctgcgtc attcttgttc ttgtacaggc gtggagcatt     58020
     tgctcaggga tgtgaaagac acaacaatca gtaccctcgc gactgaggtt cttgtcttta     58080
     caatacatga aattttcatt atcttcccat taaatgtctg ttgaaatcat gatgggggac     58140
     ttgtaggatt tgtattgatg ttcttgcaag gttacttatg gacataatag ttttctgctc     58200
     gaggacataa ataactttat agtattttgc accaggtcac tgcaaaactt actgctttga     58260
     aggggttgga tgcacgtctt cgggagatcc ggagttatct tgaccttgta atcgaaggaa     58320
     agctccctct aaaccatgag attttatacc atctacaggt tagaactata tttccgtttc     58380
     gtgttctgaa ttttacaaat tatggagaaa ctatttgaca atgtccaaac ctatgtgttt     58440
     tgcgctcttt aaaatattct agtcactgtc tctgctgttg gttgatttcg tctaatgaaa     58500
     tatattctcg taaaatcgac aggacgtttt caacttgctt cctaacctga atgtgaacga     58560
     gttggtcaag gccttctccg gtgagtttct gctatcattt tgatattata ttgggctgct     58620
     ttcttagatc tgcttcatta atctttactg tatttataat gtgcagtgaa aacaaatgac     58680
     atgatgctcg ttatctatct atcatccctc attcggagtg taattgcgct ccacaacttg     58740
     atcaacaaca aggttagatc tttactttac tctctctcac ggcacacaat aatgtgattc     58800
     tgaactaaat cttgtgatga tgctgtgttt cagttactga acaaggaaca tgaaaaagca     58860
     gaggactcaa agcctgtggc catacctgcc accagctaga tcaggttttc tcgtgactta     58920
     ctgtagtcat cattgcccgc gatgaaggca gctattgtgt gttctcttcc ccaaaacaaa     58980
     gggtcaagtc agggtggggg aacgaacgag tttagtttga tatcgacatt gttgaattct     59040
     ctcagttgtt ctgattcaga atgtatcaaa gagtcttttt tcattttatc tttcaagttc     59100
     gttaggctta ggcctctttt gagggggttt tgaatacaaa agttcacgtc aatgtgtcga     59160
     aatctccaca gagatggtct tatcctattg aaattaagat tttttttttc acatttcccc     59220
     cccccctccc cccccccttc tgttatactc tcacatcgtg accgagtata cagccccggt     59280
     tgaatgttgt tcgttttcca aagtcaacat gttcttcatg tttgtcctta gtatgaaatt     59340
     tctgattaga gccattgacc acaacaaggg tgttacttat gaatttgttt actagcagaa     59400
     ctgaataatt tgcatattac ctagatgtaa aaaggaagac tatacatttt gatgagcttt     59460
     tctttaaatt gaaaagaaac aacaagaaga aaaagtaaag tgaaaaagga ttatggagga     59520
     aaataaagtt aataaatggc gtaatgttcg tgaaaaggat atttgatgcc aaaagacaga     59580
     aacgaaaaca agaacgtgct ttgatacgca ttatgcttct tctttttcta agtctacttc     59640
     ttttgaacac cttctttttc tattgtgtat tatgttaatc cttgttaagg atactcattt     59700
     tgcaaatcaa tatattactg tcctgtttta cttagatatc tataagaaaa aagtttcaaa     59760
     aatcgaaacc gttataattt tgtgtaaaca aaataaaaat caaaataacg tagctcacta     59820
     cgaaaagtaa caatgtagtt gtatactata cagacgtgac gtaagcattc aagaagacga     59880
     ctttcatatt agtatgttag ttagtggtta ggtcgcatat cccattgagg tgaccaaatc     59940
     catagtgacg aagtaaccaa agtgattaat ttatataaag aacgttctga gtgttactaa     60000
     atagacatat atagaaaggt gtcaatacaa aaattctcag ttttatgatc caaacatatt     60060
     ataagttata cggctattat tgattgacct ttcattgggt tccattcaaa cgcctcatca     60120
     aaagtggagc cacgaaaaaa aaataacaaa ttgaattgtg tgatgccact ttcgttaaaa     60180
     atatatatgg ttcatcatct tcatcgatga atgtcatagg tggtgttaga attatatcga     60240
     ctccaaccga cctacattat taagtagtat cttagggttt tattcccgca tgcaaaaaat     60300
     aaataaggtt cggatgctct taaagtgact atatatagta tatactattc actattactg     60360
     atcaaatcaa attaatatat ggagatagag taatcatatt acgtagttag tagttactta     60420
     ctgttcgtga ttaaaaagtg agcttttctt ttatattctc aaatttttta attagaaaac     60480
     taaaagcttt caaatttata acaaagcgat tcaatataac ttctctttat ttgcacaaaa     60540
     ataagtatct ttaacgattc gttcatccaa tgaaatttcc taaatcactt ttgtttatgt     60600
     tttttaataa attccaactt gacttctttc acaaaaagaa gggaaaaaac aaagcattat     60660
     atattccttc tgatatgaaa gaaaacatat atcacatttt ctagctcttt attaaattaa     60720
     ctaaaagaaa tacggaaaaa aaaaaacatt cttaaaataa ttttaaaaca ggagcttgta     60780
     tatatgttcc acttgtacta aactgctatt tttgtttgta aagagtaata atatatccaa     60840
     ggacaccctt aatttattta taaacttaac aaaattgagg gagcaaaggg ttggtgtaat     60900
     aggtgaaaag aatgtgattc tgtgtgccga aagtggaatg cagactcagc ttctaattat     60960
     ataccgttta caagttagtg gtcagctttg ccacccatac acacacatac aaatatatcc     61020
     aaccctcact ttttaattcc tttttcttac ataaaattct atacattctt tttgctaaag     61080
     acaatttctt accttagaaa acagtatttg tgtatagttc tgtgatgaat cattttaaga     61140
     aaatataaaa cgtaaatgag taatgttata ctaatttatc tactatcatc gatcaaatgt     61200
     tcaggtttag agacaatttt ccaagaaaat gactgaccgt taaagttgca agtaaagcca     61260
     taaacccggt acttggtcct tttcaccatt attgatagtt ttggcaaaga gacatatata     61320
     ctagctaata tatgtttatt ccataaatac aagacataca tattcacatt cctctaataa     61380
     tgtaacataa ctttttaaat aaaacataat tatggtttcg ttgcaatagt taaaatttca     61440
     aaattctcat tttctcgttt caagatcttg tgagatacag taacctcctt caccgtaaac     61500
     atttgctccg gaaaacttaa tggcaggatc gtaggaagag aagaccgagg atagattctg     61560
     accaagaaac ataactccct cctctgcatt atccctgtcg gtgaacccta gtttcggctc     61620
     ggcctgtttt gagactaagc aaccgtgatc agacgatgga cggctaagat tggcattgag     61680
     aagattgacg gtggtgatgt cgtgaatgct aggccgtcgt ttgtctttcg caccggaaag     61740
     ctgtctttgg tagtactttt gggcatgact tgcaacctga gttggtgttt ttgatcccac     61800
     aaagttcctc gatatgtttc tccaatctcc tttcccatac ttgagaagcc ctaacaagaa     61860
     tctcctgcag aaaacaatta aacaaggtct cagcaaacca agaaaacaaa gtaacttgca     61920
     actcaagaca ccaaagaaga gtgaaacaag gatcacaaag attgaaaact ttgttcacct     61980
     gtgttcttcc tccgtccatg gaactccttt cctacggtct tgatcaaatc ctctggctcc     62040
     attaggaagt ttacgatacg catcaaagtc acgtggactc acaacctgat caaatccaca     62100
     aggagtaact gaacggtaac ccgggatcgg gacaagtcct gcttcgatat cgaagaggtc     62160
     ttcttcaagc ttagagtatt gcctcatgac atctgatatg gtctttccag ggatcatagc     62220
     agcaactttg aaccagcgat caggcgtgtc atcagcgtag acagcaagag ctcgctcaaa     62280
     cttcttgttc tcttctttag tccagctcga gctttgcaag cacatcatct cttgaactac     62340
     aaaccggtgg tcagaagttg gcacgtgcga gagtagtgga tgcagagtct ccatcgttta     62400
     aaggctacga gataaaagtt ctacctataa aataaagtac ttaatatttt tcctctaatt     62460
     cttggaagct tgatttgtgg gtttagtaaa agactgaagc ttcttatagg atctaaagat     62520
     atataggaat caaactggga aaactaacga atagtttaat gatggaatca aagaacctga     62580
     tttagtgaga gattatagcg tatattaatt gaagaatctg gaaagaaaca caaaagacta     62640
     agactttgaa gaatccttga gaatctgcaa aagtgggtcg tcaaagtaat acaaaacagg     62700
     caaaactcag atggtagaga gagataatca gtaagataga tagggagaga ttgtgaagca     62760
     aagggagaga agaagaaggt atttgtggtt tgtgttataa agagaaagag agagtgtaaa     62820
     agttttagcc aatggaacca ctccactccc ctacttggct tcattttatt ccaaagagga     62880
     ttcttcacaa tgacacgaat tctaaaaata acaataaact tcaattataa aattctaact     62940
     agctactagc taggccaaca tttcatatct ttccaaaatt ttaataacca ctagtataca     63000
     ccgttttttt ttgttaggta gtttttctct aatattattc aaaataaaag cgacaacaca     63060
     taaagttgtt catacttaat gatagtttac gtgttatacg tcggctatgt ctaaggctta     63120
     actaatcata aaacacacat aaaataagga gaaaaacttc aaatttacta aaaaaaacca     63180
     aaaacaatgc gattgcttta cttaacaaaa acaatgcgat tgctacaaat tgtttataga     63240
     tgtaacttaa ttaatgttat tcgagataac acgtaagctt aaacttaacg acactttatt     63300
     ctttatgtct ttttttgtat ttcgtaccac ttgaaaatga tacttctacg aaatttcata     63360
     agccgccaca aaaacaagat tgaaaaagaa agaataaata taataaatgc agaagcgcct     63420
     gtagctcagt ggatagagcg tctgtttcct aagcagaagg tcgtaggttc gacccctacc     63480
     tggcgcgtta attttagttt cttacttttt agaaaattac tccttaacct taaaggggta     63540
     attaattatt gggatgcgac taaacctttt tttgcccact ttgggtactg ttttttgtcg     63600
     tcactcgctt tatctacttt ttaattcaaa aaagattcta atcatcaact ctcactcaaa     63660
     agcccctttc acacactcca ttgttgtcgg tgtcccaaac cttgttctgc tctctcgtaa     63720
     tatgcataga actaaatgct aaatatcttc tcctaatgaa tgaaagtgag aacaattcta     63780
     acacaaacca cttaagaatt aggcaattca aaggttcatc aacatgattc tctacctgtc     63840
     tgtttttata taatccatat tcatagaact aacaaagaac gattcttttg ggtataacat     63900
     cagacagaga cagaggtcag agtacaaaaa ggatggcttg taaaatacac ttgaacctat     63960
     gttgtagtag gaataggaaa tgaagtagat tgaagtctct gcaaccatgc gattctcaaa     64020
     ctgggcttct tcagctctaa gaagatctct ctatactctc tcttcagaaa caggtccaac     64080
     gcaaacatgt agagctcact accttgttcg acctcttcaa ttgcgttgag gcttttaatg     64140
     cattctccaa tgctgtacat cggctttgcc gattcaatct caacgaatac cggactttcc     64200
     tgcaacataa cgtcattcat taacttcata tcatccaatg gttgagcgtt ttcactgtct     64260
     atccgatctt cttgagactc tgcataacaa ccattttgcc tggaggtttc tgcttcatct     64320
     acgtgcatct ttgataatgg agttgtgtca cgccattgtg gtgattcaga acgattgtgg     64380
     aggagcttct tgcgcgaacg cgaaggagga gtgtatgtct ctccaggttc tatcactccg     64440
     ttgaaaatga ttgcaagttg atcagcatga ggaacttcct tgtggcggaa ttgtcctgct     64500
     cttgggtttt cctgtaataa accaaagaca aacactatct gttcaaaatg tagtccaatg     64560
     ggagaaggat aatagttaag acaactaaca ttatcatacc cgaatataga ttcgccattc     64620
     ctcttctgtt gcaccaaagc tacgagattc aggatcccat ttcatgctac ttgctccaac     64680
     gagttgacac cagatcttcc aagctttcct agtgcaatcc cagtggtttt tcagctgcgg     64740
     tctcgtataa ccaaggccgg tattttcatt aatagtcccc agaatcgtct tccacccttc     64800
     cttgttaaaa tgagtgtcgg gtctatttcc ctttaaagtc tcttgaacca acagatcaag     64860
     aaacagctta tgtgtagacg gagaccaata cccttttgtt tgagggttag atgaactaca     64920
     catgctttgg ttatcttcat cttcttcctc gtaacaactt cttcgcctct tccttacacc     64980
     cgagacttca tcatttttca cctctacatt acaacccgca aagagaatct ctagcttctt     65040
     gagatcatgc ggaacactca accgatactg cccagcatca ggattctcct acggcacaaa     65100
     gcaatcacat tttagcattt tataaaatca acaaaaatga atgtaacaag tggttttgat     65160
     ttgtaaacct gtaaatagtt agcccagtca tcatcagttg cacgaaacct gttgctctca     65220
     gggttccaat tcataaaact agtttcaacg agtctacgcc atattttcca ctgtctgctc     65280
     attgtatccc aatggttctt aagctgcatt ctatcgtaca tggcgcctgt ttgctcctga     65340
     aacgatatca atatgttcct ccaaccttct ttcgaaaaat gtgtccctgg tttattccct     65400
     agcatcgttt gctccacaca taaatcaaca aacactctgt gatactcagg ctcccacact     65460
     gcttttggcc tcatttcttt tttaacttct gttctccaaa actcctaaca attaaaaacg     65520
     atacctttat cattgtgaac tcgtttttaa caaaagcaca gagagacaga gacatttgca     65580
     taaacattaa cccaacaatt ctagatattg aacacaaatc atataaacaa ggcattgaac     65640
     cagagaacgc agacgcaatt acttgaaacg tgtttcaggg aaaaatatga ttttgcgacc     65700
     tgagacttcg cctacttcaa aatcccagta gtaaccgaac acgaaaatgg ggaaaattgc     65760
     acgaaaccct aactcgatta atcgggagac tgaaaaacta cgatagtggt taggatttcg     65820
     ccggcgggaa ttgggaagct gaagaaggga aaacgttacc gggaatctga tggaaacgcg     65880
     acagcgattg agtggccact ctgtgacggg tgtggctgga agaagccgat cgcgattttt     65940
     cctctctttc tctgcttttt gcgtttgcgc cgcgctgtac ggattttcca aggcttttct     66000
     aagagttatg ggctgggccg agttctttgg tcatgggtca tagcccaata aattacaccg     66060
     gttcttgcct gactatttgt ttccgtttga agagatactc tgattggtta agaggacaca     66120
     gactgtgaga ctggtttgcg ttgggtccgg tcttgatttt gttcaaattt ctgctcgact     66180
     tagatgtttt ttttgctttc ttatcgaaac atttttatag ctgattatgt gaaggagtta     66240
     ggagaattga atatgggttt atcgaaaagg tgattattgt tccaatcaaa tatatttagg     66300
     tgactatcgg catcattgat aagtatagat atagtttgtg ggggagggtg accacgatta     66360
     ccaaaattaa taggggactc cagcaataag atttgcttta aatggtgccg accaaataat     66420
     aaataacatt tgctttaaat gggccgtaac gtataaatcc agatacaaaa ataatggaaa     66480
     ttagtccaaa atttaagaaa taatggtaca gaaatagcta gctagctcca gctcccccaa     66540
     atcgtcacta gggaacaaac tgctttctac tcgttttttt ttatgatttc ttttgcttat     66600
     tctgttatgg actttgtatt ttcttgtttt ctattcgtgg ttttcttgtg gactgattag     66660
     cgttaacacg ttataaatct tgtatacttt actttttgtg ttatacagaa aatcttcgag     66720
     agagaaagat aacgaggcat aacacatgat ttttaccaaa aaaatatatt aggaagacat     66780
     atatatggct tgaaaatgtg actgaaaagt tgagattcta acaaacattt tgtctcaacg     66840
     gttaaaatgt gattgcactc tctaaaccgt tagtgtgaca tcgtgagaaa gcagcagaca     66900
     catgactatg atgttaacat ttattatctt aaaatgcatg tagtctttac tctttagcat     66960
     gggagaaaaa acctcaatcc aaagtagagt ttggttatga tttcggtggt ttggcatgta     67020
     gtctttagtt ttgatagaga aaagggctaa gagacatgca ttgatgattt gattctagtt     67080
     tatgctgtta tcgactctgt gctagccatt atatttgttt agagtcagaa tttatgatca     67140
     gtacgaaaat tccaaaaaca atttctatag atatcatcat tgatatgtgt ccctatatat     67200
     taatttccat taatgaattc aatttaaaat gaaataaaaa atgttggtta ctatagtagt     67260
     tcctaaaatc aaatttgtaa ggcatgaaag atgaaagaag ggagtcatgt ttttaatgca     67320
     tcctctttgt cctcattcac tttgttttct ttccctttta taaaaacctc tctccctatc     67380
     tcacacactc acaaaagtgt ctcccttatt ttcaggcact tcaaaataaa tatacgaaaa     67440
     taaaataacc atttcttaag tctaaagacc ttctctttca actagaagcc tttaagccat     67500
     gtcttcttct tccttgatac ttctcttctc tactctctct ctctttctca atgtctcact     67560
     cgcagacaat cacacggcgg ttgttataac aacctcagat actccaccgc cacttcctcc     67620
     gccttctcca ccgccacggc ataacttcac ttcctctctc atgcccggaa tcgcagtcgt     67680
     tatcgccgtc ctcactgcgt ttttctctct cactttctta cttctcctct acgtcaaaca     67740
     ctgtaaacga cgaaacggca gcgtttacgt aaaccacccg cagcgtttcg caatcactag     67800
     atacggagga ggatattaca acggtggagg agtagtagga ggaaggaaaa actccggtat     67860
     agaccggtcc gtgattgaat ctttaccggt tttccggttt ggtgcattaa gcggtcacaa     67920
     ggatggttta gagtgcgccg tgtgtctcgc tcggttcgaa ccgacggaag ttctgaggtt     67980
     attgccgaaa tgtaaacacg ccttccacgt ggaatgtgtt gacacgtggc ttgacgctca     68040
     ctccacttgc ccgctttgcc gttaccgggt cgacccggaa gatatactct tgatcggtga     68100
     ttgtaactcc tggttcgagc tccagttctc taaagatgaa tcaaacagtg ttaataataa     68160
     tcctcccggt ttaacccggt ttattccggt tagtcgaatt tccggtcgtc attcctcggc     68220
     tggtgaacga gcgagtcgac tcaacgagat tagaacatct tcgtcgtata aatcgaatcc     68280
     gatgtcgttt cggagatcac tcgatagctc tctgaaagtt aacgacgccg gcgaggagaa     68340
     atcggaatct gtcgccgtta attgcttgga tcgtctacag agaaaagacg gattgttgtt     68400
     gattccgaat cgggagagct ttgaggggag atttgagcac cggataatta tctccggcgg     68460
     gaatcgagac gatcagaggt ggagcgaagt aaggccgtcg gatcttttgt atttacgatc     68520
     agagatgata ctcagcgatt gccggaaatt agctgcggcg gagggtggca gagatgtaat     68580
     taacgggaga agtgtgtcgg agttaacggg aattgagaga cggaggagat ggggaggaga     68640
     gccgagacaa cgacaagcca cggcggtgat ttcgaggtgg ctcgcttggt cccaccgtgc     68700
     ctccgcttcc agcattgttt aaaatttata ttatgatcct tttagttttg ttttataaca     68760
     gttttggccg gtttagtttt gttctataac atttagccca aactaattta ttagaggaat     68820
     gcaacaatgg caggtaggga taaattagtg ttgttctttt ttttttttga aatgcgaatt     68880
     ttttggagta tgcacgagtg caaggaagca caaatgattt ctttttgtat tttaattttt     68940
     gaggaaatat taaggaaagt gaaaggttga gttttttaaa attaatgtct ttcttggtgt     69000
     aataaagggc gagtattggg gatctgataa ctaagtttaa atagaaaaag aaatgactcg     69060
     tgtttgtctt tctatacatt gaactcataa cacttgaaac attatgtgct tgcaagacct     69120
     ttatcaatga gttcttatac tagaataatc aatgattttg aatatagtaa tggagtaaac     69180
     tttagacttt gtagcattgt tagtttttgg gtcctcaaaa gaaggttcca attcaaattt     69240
     tgatataaga caatgctctg acacaactca tgatccatcc acatacctct atgattgttt     69300
     gtatatacat caatttaatc acacgaaaca ttatatacaa atttgattat ctcgaaatgt     69360
     tccatacttc caaagacttt ccatgtaaca ctagtcgtat ctttatgtaa gaaccaagaa     69420
     atattcaatt caaaatataa ctcgtgattt ctgtagacag tagtacatct ctttttatga     69480
     aactttggga agaggcgatt taaaattact ttttacattt ttattttacc cttttctata     69540
     tatggagtat tgtgtttttg ttattatgaa ttgaacgcaa agaagtcata acgtgcaagt     69600
     agccagagag aactcattcc aaatataagt atgaagcaga tcatttactt tcaaagtcat     69660
     tgttgattga tacaaccaat ttggaataca attaataaga tgatgatata gtatttcatt     69720
     gactacttta atgttttgaa ttaatgatat ttcttgccat cactttacaa ctcatcattt     69780
     ccaatttcca acattctcaa aaataaaaat tattgttttt cttattcatt ttgtggtttt     69840
     tcgacagctg atcttgttcc ttgtttgtaa caaccacttc cacttgtgtt gcccactccc     69900
     tttattaact aggtatcgag aaaaataagg aaaagacgat tgtagaagca agcacacgta     69960
     gtacaagcaa aaaaaaagta gaacaagttt gctttattca tttagagaaa tcggtgtagt     70020
     ttgtatgatt gatgattcaa aatcatacaa aagtaacaat ttcttcgata aaatactagt     70080
     tttgttttat tgctcataag agagtatata aaaattcagg taaaaattta aacgcgattc     70140
     aaaaaattta actataacga aaataaatta actcataaga gaaaaaaatc caatttaatt     70200
     gtttaaaatt ttgcatgatt atcatgatac atagtctagt ctctagtgtt tgtggtatta     70260
     tcataataag tcaccatcaa aattcaaatt catgttgttt gacaaactct acatgagttc     70320
     cacaaaagag gaaaatcatc atttagaggc aaaagcatat gtcacattga gatacttact     70380
     taatgttatc taaaacagtg tttttttgtt gtcatttaca ttttatattg ttttgtttgg     70440
     acttactatc agaagaaaat gaaatggttg aataagttgc gttttgttaa tttacatgtc     70500
     gagagaaaaa tggttaacag agataaataa ttaaaatctc accagcatgg acacataaag     70560
     gagaacattc catgtggcct ttgcctgtgt tatctcatgt atagtccatc ttattactaa     70620
     ccatagataa tgacattttc atagaataac aacgaatgta ttttgtctac tagtcattgc     70680
     catgatttca tctgcataac cttactattc tcctccgaat tattgcgtgt acatacatta     70740
     aaagtttggt cgtgtaaaac gaaatgcaaa agcacccaat tccaagtgtt taaatttgtt     70800
     taaaggcctt tcattacaag tttgattgag aacttgatac atttcacatt tgacatttac     70860
     cgtcaaagta aaatctatac tgctttgatt gttgttagtc acataagcaa gaggaattat     70920
     aggtaccaaa agcattacca tgattttttt tctcttacca ctaattttta ccattgattg     70980
     ttgttttttt tttaaataac attttctttg taccattgtc cttttctttc tttctttctt     71040
     tttttcttca accattatcc ttgtctagga gaactgaaag aatggagttg cataagaata     71100
     tgggcatagc aactcttggg aaagaaagaa aataaatgat ttctaaacag actgtatatg     71160
     aaatccaaaa ttactgacaa aatcagagct caagaaaaag tggcccacga tagaatcttt     71220
     gaagttagca gagtttagag ctgcagagtc actagatatg caagatatat tatctgacaa     71280
     gtaaagtaag aaaaaaaaat ttgttttata gtttcttaat ttctttaact atgtttcctc     71340
     aaataatcct taggtactaa ttaaactaca gatgttttca gacaaaaatt agacatgata     71400
     aagaaaagtt aatatctcca aaattagaaa tttaaattta atcaaaatgg taacaatctt     71460
     tgcatgaaaa aaatcatgga aagtgtcgag tgaatccatt ggttcataga atgagagtcc     71520
     ttgggataaa aagagttgat acgtgtgtgt acatggtcct catcattatc gtcctccctt     71580
     tttcaatctc tattactttt cgcaattctt gttccttagc ttcttcatga aaagcccact     71640
     cgagtacttg aaagagtttc tagacactca aaaactcaac tgtcacagtc tccaagctta     71700
     atcaagcctt ttttggtttc ttttcagctt ttttgtctga cttgtaagtc tattatatta     71760
     accaatttac tcctatatct ctctccgacc ccattttggc tttttcctct ctctatctcc     71820
     tgaaaatttt actcttgctt tttttttctt ttccctgtcg agagagttaa tattattgtc     71880
     acattacaag ttttggtacc atgactacgt ggagtctttc tccatcacac tcatgcttcg     71940
     aagaaaccat gttttagcaa ggaggtttaa aaacactaca tagagtgtgt tctttacaca     72000
     ttttgggtca aacaatcctg aaaatttacg acatatattt ggaatggcct acttggtaat     72060
     gtgtggatta gattcatgaa agtgagatat gctgcagtga atccggatct acggcttgat     72120
     atgataatgg ctgccgttac cagataaaga aaatgaagcg agtgatttga caagacaaag     72180
     actatagaca aagacaagac tatgtcttct tcataagtaa aaataactct cttgtctcct     72240
     ttctctcttt tagatatttc ttctgcaaac tgttatcact tcctattctg attctctgct     72300
     ctgccactac acagctattt gatctgaaca actcaggaac cttgagatag cttaatattg     72360
     aattgaattc tcagataaac attgagaaaa tggattttaa gaagaagata gaaggaactt     72420
     tctctctttc gattaaatga atcaatccgt gttgttgtaa aatgttgaca tcacaaaact     72480
     aaaatgtaaa gaatcgaaga aacaaaccta attcaacaaa caacctacag aggaaaggca     72540
     agagaatccg agaagaaaga acaaaaatga aaaacaaaaa ggttacttat tcataggagg     72600
     aagttctcta aattcttgcc tttggtaatc aatctttgtg tggctttgct tctctgtttc     72660
     tgccaaaaaa aagagatgtt tttggcccag cttttcatta agacaagagt cagtttggcc     72720
     cagcaaaaga gactacttgc ctgtatatcc ataggggaga aaatataaaa catatatata     72780
     ggggggaatg atgaagaaga agtaaaagct ttgtgtgtgt ttagtgttct aatttttgtt     72840
     tcgtttcttg gcttcgctgt acaggataac tccacagacg gtgagggagt aacccagcat     72900
     tccggtcact gacaccggat tcttgaagat tagaatagag accaccactg ctactgctcc     72960
     tttggcgttt cctagcacct atcacagagc gatccaaaac gacgttttat gagtttatgt     73020
     gaatcatatc tcaaaagttc gttttgaaac gcagggaaca tcaagcatta tcatacacat     73080
     aaaaaaagca aacccaactc aacatccaat acaaatgaca ggatctcact aacaggagga     73140
     ccaagcagat aatcgtttct cactagttct acacttcctt ggactaactt tctttcaact     73200
     ccaaccaaaa cccgtatcat tttttctacc ataaacaatg atgccactaa gaatgtaaaa     73260
     ggaatgtgaa ctgtaatcac ctgtaaagtc agggcgctag tgtggtttgt gactaagaaa     73320
     tttgtcaagt tgactaaata ggcgagcgct gaattgaata gaagatacca aacgattctg     73380
     aaatcatctc ttgcaagtgc aattgtaatg ccgacaacat ttttctccat gataagagta     73440
     gcaggcagaa ggagcacgac agctattgga gccatgtaaa ggaggagatt catggagttc     73500
     agcttttccc ttcaatacaa tatttagaat cttttaagca acactcatat aaatacttga     73560
     actattgata tatagacctc taacaaggcg actacaacaa taccagccat ttcttaccct     73620
     tcagaagaaa gcaaaattcc ttgaagcact gatttaagtg ctctcgcagc tgttgctgca     73680
     atgcacataa ggaatccaaa caggtgaaag cttggctcac cctgacaaca cccataaatt     73740
     aaagaatatc aagcatagaa tcaaacacat cacacacaca aacagaacaa aatctccatt     73800
     actcgaactt ttttagcata aagttcacat ggttaagaga agatgagaga aacacaaaat     73860
     ctagcgaata caagcacaaa acaataccaa attttctcat gtgaagcata attcaacaat     73920
     gtctgagctt gtcacaaaga taaaagctag catcattggc caaacatgaa actgaatcaa     73980
     cgatatcacg ttcattgctc cagaaccata cctatgttcc caacatatct agttcattgc     74040
     tcctacatca catctacatc aacctctcta acaactcatc caaaagcata cataagggat     74100
     tcaaatttaa gaggtcaaaa gaagtgaaaa taccccacta gcaataacaa ctccggtgac     74160
     gacagggacg agagtgaagt aagtcaacca agcctctttc ttacgcgtca tcaggtaagc     74220
     aaacacggcg gtgaaaaacg gcgtcgtagc accaatggct tggttaaacg aaacaggaag     74280
     aaagcggaga gagatgttac caaagaccac cgacacacaa aaaacgagac ttagagctgc     74340
     gatcttaaag aactgaactc tggatcgaat cgtctgcatc ggaaccatct tcaaccaagc     74400
     aatggcgacg tagctgagta acgaacaagc cgtcatgtga cacatggtga gaaagatcgg     74460
     gtacttgaat ccgtaattgc taagcaagta cttgttcagc aacaatacac caatgttcga     74520
     tgagtaccaa gacgcgacta gcccgattgt gaaaaaccgg ccattcgtcg ccatcttcat     74580
     cgcttttctt cttcctaatc ctgggtcgac tcgatctgat gagatgagat tcaaactaaa     74640
     accctaacga atttcacgaa attgggattg gtgggaatcg aatctggaca ggagatggag     74700
     atctctcggt cctccgatac agaattttga cgcgtcgtga tgatgttatt ccatcaatgg     74760
     gtaagatttg gattaggtta caacacgcga aaatgctgga gacgaagaaa ccgggaaaga     74820
     gaagaaagtt gggatttttg gagaagaaga agaagaagct ctgcaaaaag gagagatctt     74880
     tgggctaaag ctgcaacaac acttctcttt ccttttttaa ctaatttatt ttttctttca     74940
     gtttcatgat attataattg gtgcgttatg taatgtttct ttgggctaaa gttttttttg     75000
     tttggttact tgaaaaatca aagtgtgaag atgtgtaaca atgaaggaaa ggagccattg     75060
     actttgttat tggttattac cgaatctgag ttctaaattt aatgatttac gttcatatac     75120
     taatccttga aaattcctag ctaacgaaac atttcagttc tgagcatatt taattgacta     75180
     agtaaatcga ccacgaatct aattgtaatt aacaaagcgt ttggttagtt aggcaatcga     75240
     ttttacatta atttttctaa aaatacgaac tattcagaga aaagcttatc taagtagcag     75300
     aagtttggca gaattatgat gaagttgaat aaatttagca aacgtttttg acaaagtggg     75360
     tgttaagtct agtggtagaa gaccaataaa agctttatta gtggtgtagc aaagggaaat     75420
     tatgtaatat acaatagttt agaatcgatg ctcgattctt aagtcaaaac aatggtagga     75480
     tcatctgcat ttgggcttga tgttattagc cgttacaact tgtgaagatg aattacaact     75540
     cgtataaata acaatgaaat ttgcatatga atcatttaga ttcaaatttg attttataac     75600
     cactcaattt cacattacat tagccactta taaaacaaag gatttttctt aggaatctcg     75660
     ccatatccat aaataccatc ttcctttgct tcccaagtac aatttctaca tctagaagaa     75720
     tctctaaccg ctttataaat atcgaacaca ccttttttta cttgttcttg gctaaatcca     75780
     cagaagtaga gtgtcgaatt cataaaattc acgtaaaaca tccaaccata taatccacct     75840
     ttttgtagaa tatggaagcc atgatcatca tctcttgatt tacaatgaac tcctaaaaga     75900
     taatcattgt cattataaat cacaacccta gtaagaggac ctttcattgg aaatactttt     75960
     ccatcatgtt gtagagtttc acagcctatc aaagatatta atactataaa gatgattata     76020
     aacattgagt agaaaattgt taggaaattt atgttagacg aattcatcat gaagattttc     76080
     ttaatcatga tattgcattt tctagaactt ataatttatt tatatataat gagctaactt     76140
     tacaaaaaaa attataattt acattaattt atgttgaata acctaaaata gtcatgaaat     76200
     cactagaagt ttttgtgaag taaataagaa agtaaaagtt gctttttgtt cccaaaaaaa     76260
     aaaaagacta aaagttgctt aaataaccca aaatataata gaaatacatc aattaggtta     76320
     ggtattcata tccaaaaaat taaattgaca gtaatgatcc aaaaaatagt agatttatta     76380
     gaggtgggtc tgtctaggtg tccaggtgaa caagtgagag gagagagtta atagttttgt     76440
     ctgagaatct gacgatcact taactccaaa acccagtggc aatcatgtaa ttttactgta     76500
     aagtttcaac cagaaatctc tttttttctc tctctctctg cgctgcaaag cattgatcat     76560
     catcattcat catcttcaca agtctcgttt tcataattta tatgaggatt cgtcatccgg     76620
     gtctatacga atatggaatc cgtacagcca catctcgaga cctttgtctc tgttaaagta     76680
     atcaatagct caagtggctg tgatggcgat ggagagcctc gtcggagctc cggtgcggtg     76740
     gagaaggagg aagaaatagt gaaagatgag gagaggagat ccaatgcgtc ggtgtgttcg     76800
     gtggaaatag atctggagct tggattgcct gagaaagttg tacatttgtc gcaatctgag     76860
     agagattgca ggatttgtca catgagctta gatgcagcga atcttgaatc tggtgttccc     76920
     attgagcttg gctgttcttg taaagctgat ctcgctgctg ctcataaaca ctgtgctgag     76980
     acttggttca agatcaaagg aaacaagtaa gttcaaaatc tccatatttc ttgagaatgg     77040
     ttgtttggtg gttacttcca ttaggagtac gtaaaaatct aagctttaag atagtttagg     77100
     aaaggctaaa tgactaacat ttccattgat gtaggaaagt tttttacttt ctttaggtta     77160
     ttgtcacttt tggttattga acagctttct tttgactgtc tttttgagaa gtttcagttt     77220
     tgaggccatt tgttgtcaga tgagagacgc aaagcttagc tttttctttc tttgtgatga     77280
     gattcatggt ttggttttgc tttgcagaat ctgtgaagtt tgtgggtcga ttgcgggtaa     77340
     tgttgttgga agtgttgagg tggagtctga ggaaagccgg aatgaagcaa atggtgtaga     77400
     gaatctaact ctgagaacat ctggtccacg attggtggaa ggtagaagct tctggcaagg     77460
     tcaccggttc ttgaatttcc ttttagcttg tatggtcttt gcatttgtta tctcatggct     77520
     cttccacttc aatgttcctt ctacatagca acacaagtaa tgttcaactc tccataagaa     77580
     gaagagattc attagagatc tctcggaaag gtacttcact cttgtaccaa tgcctttttt     77640
     cactattaag tttgatgtaa gtttagagag gaagaacaag acctagaaga gctcattatg     77700
     ctatttgcgg gtttaatttc tatctagaat atgtaaatct gtttcttgat tgcggatgat     77760
     gtatatagct ctagtcactc ttaagcttaa tgcaaatgca gtcttgtgaa agtctcttct     77820
     cttatctcat tgtattatga atgatctgat cacttgcatt gcattttgca tcccaagagt     77880
     tcagtgattt acagaggaac tcaaaaacca aaaatagaaa aaatcctctg tttccatgtt     77940
     gcaatagatt aaaaaggcta tgtacaaaaa ccgaaactca ggccatgctt ttatgtctct     78000
     tcagtgacct ctgattcatc ttcttcttcc acaattgcta agacctttga ggaactaatc     78060
     ctcaaagaag cgcttcggat tttcataggc agcttctcat tattagcagc taaaccacat     78120
     tcgatttctt cttcttcatc atcgtccttc ttcaggtcag aaggcggtaa aaaacaatcc     78180
     atagacagac ccttaatgtt aaaatccatt tcctcaatct cccaagtctc ttccatccga     78240
     gtcctcgaat gattatccga gttctcacca aaccgaaaca gagacaccga gcttttacca     78300
     gcgtgtgcta ccaagatacc atcaacggtc ctgtaatctt ggatcaaaga ctccattgtt     78360
     gtctcccaaa atatactgtt atcgtcttga gctttgattc ttagaaggtg agagtcttca     78420
     agttgaatca aaagacctgt tctctggctg aaacatcccc acacagtgtg ccgtatgatc     78480
     tcaacattgc tgctgcttct cgccttaagc gccgatggct cagcatcaag tttgagtatg     78540
     aaacagtctt catcatttat cttcttctct cccatgcata ctgatcttgc aaatagatta     78600
     gccgttgatt ttggatcaag accctgtttc attttgtttc aacgattaag gtctgaaacc     78660
     tttgtaatga ttccattcag acaagtacta aacacaaaga tacttgaaac aagtcaacga     78720
     caagtaactt aattcatcat tattacaaat ttcccaaaac aaacaaatgc tattggtttg     78780
     gtgacaataa aagaagatct tattaggttg taaataacta tacacttggt aatgggaaca     78840
     aaagtctact ttgttataac aaaaatacta tttggagaaa atcaagtagc aatatctttg     78900
     ttaacaaata tatctatttg ggaaccaact aatgtatact agttataagt atatattttt     78960
     ggttgttgtt gttagtggtg gaccatagat ggttccaact ttcaagttcc aacaaccttg     79020
     gtaacttgta agcattttct ccactttgaa atgagaaaac aagagcgcaa gtacatggga     79080
     cacgtcacac tttatttaag accacatcaa atctcaaaag tcataagttt acattggaaa     79140
     aaatcaatgg ttttatctta aattaaatta tatgataata tattaatatg ggtatatggt     79200
     tctcgcgtaa tgtacattag aaacgttctt cactctagta atttttaatt agtactagca     79260
     tttattcgtt atcaaatttt ccaaatcaaa atccaaacta ttcaacgaac aatattgtac     79320
     gatgaccaat tctatcgttt gacaaagttg aaggtaggtt tagctagaaa attctctttt     79380
     ggaagtaaac gtggtaaaga aaaacaaacg aagcaatgaa gaataaaaag caagaggaag     79440
     tttgatgatt gaaagatctt tttgctgatt gacaaaaaaa gaaaaatctt tttgccaaca     79500
     atcaaggaaa agaaaacgtc aactactaag aatcataaaa atcaggaata gaagaagaat     79560
     gaattattga actccaagtg gaaaagctca atcacacagt gccataatga tcagtcgttg     79620
     catatgcttt atgagacata aaggatcttt gtcttttcat gaatcaagta gaaactagaa     79680
     atgtagcata accacaagaa aaatatccac attatttttc caaataatat tatttacaaa     79740
     catttcacaa aaaccctata attctttgta taaaacaacc tatattgcct tgaacaaaaa     79800
     aaaaacccct ataatttcgc aaaaacataa tgaacaaagt aaaccaaaaa gatgaacgta     79860
     aaaaaaggag ctatgcctct ctactacatt aacaaaaaga aagaccattc ttcaaatatt     79920
     ctcgtttctc ccaatttcgt cataaattaa cttcttgata taatgtttta gggttttgtt     79980
     gtttaccatc cttagatttt gcaaataaaa aaaaaaacta aaatttggct ttctattgat     80040
     ttcccctcaa atattatatg attgaatgga tttgactaat aaacaacgga aaaggaaata     80100
     aaaagaaaaa tgaattacct ggaggaaacg gcgcaatggt ctaggaggac cacgagaggc     80160
     atgagaagga tgccacggag tttgtctcca agcgactttg gcgtcactac cggcactgat     80220
     tttgcagcct gaaacgacaa gctcaagaca ccataactct atcccctttt gccacagcac     80280
     aaagcctcct acttctcctc ctccactctt gatactcctt gcctttacca ttttgctgtt     80340
     caagcttcct tctcctgtgc aaaactctga tgctgtcatc ctcacttttc ccatcgcata     80400
     catgctctct accgcgttta acgctcgatc gcctcctacc gctgctatgt actgctttac     80460
     tatgtattgc gccatcgaca tctcctgtaa ttttccaata caaaaaaatc ttatatatga     80520
     tggcggattt aggaatcaag atattgctaa tgtttttaag tcaatcacat ttacatgtaa     80580
     attttcattt aaaacctaga caatctttta tttttttcat caaatatttt tgtacagtgt     80640
     aaataaaact caaacatgct ttttcctccc gtgtaggttc tgacaaagaa aatgttgttt     80700
     cgatagtaaa aattgtggtt ttatggcaaa aacaaacgaa acttagaaat ccatgccata     80760
     atataaaata tatcaagcac tcgatccata ttgttgattg ggtttaagat gaaattttgg     80820
     tagatgtagg gtgataaaaa aagaaggaag atgtaattac gagaggttgg tctttgatgt     80880
     ctttgtggat gggattctca taatcgttat ggtggtcagg ctgaacgggg agagggatca     80940
     aaggagcccc aacaactccg agaaggagct ggatctctgc attacgacca ccaaagagtc     81000
     ttgtcatgtt tgtggctgtt gcggttccgg tagcagtagc ggtaggtttt gaccagtaag     81060
     atttcatttg gttccatcca ggttttgtct tggacgcagc aaataactcc tcaggcatgg     81120
     gaacctctag gacggtctct aacccgtcct cgaggttgta attcggacaa agtttcctca     81180
     tattcgcaaa aacaaaaaaa aaagggtttc gaagggagaa atttaagctg agtgaagaga     81240
     gggaggctat ctgtgggaaa tttggatttg atgaaaactt aaaagagatt gaaattagaa     81300
     aaaagacatt cgtcgttgtc accaaccgac cggaacgtgg ggaggccttt tgttttgtcg     81360
     tgtctgcacg ctctctcact ctgcttacgt ctgtttattt atacacaaga catgggatca     81420
     agatatgcca agtacaatat ctattttttg gacaatcttt aattgctaac aaaaattatg     81480
     accacatcaa cctctaaccg aattgaatat gatacccacc cttaaagatt tatattgtat     81540
     aatttaatat tttttggaca aaataatcgt gcaacaaatt tactacaagc agagtattga     81600
     cccgtttgaa atcataccag aaacttcata gacttatacg atcattcttt ttttttatat     81660
     atatataata gtaaatatca tttcagttaa attggacatg atctctaaag atcggaacat     81720
     tggatgttga atccaatacc gaatgactat gaatcgaaca aattaataca ttggctatgg     81780
     caatttcgtg atatcctcgc tacctaaagt cgtaatgaaa taaaacattc ctaattttac     81840
     aacttttata aatatattaa taagtttgat tttcttaaaa tagtattaac aaaagtaata     81900
     cacgaaaaaa aaaagaacaa aaaaaaaaaa gtaatactcg agcgcataaa gttttttttc     81960
     tcttgattag ttgagttgat ataatacaat ttaagtatct agttgttgaa ttgaaaatta     82020
     tgaatttggc ttttggacat aacaaatcag aaaagctata atttaaaatt aattaacgaa     82080
     aaaaatggac ttaagcaacc tgaaaaagat aaacttgagc gggtttattg ttattttcta     82140
     atcactatga tactatttga attcactcta ttcttaaacc tatgtattct ctaactagta     82200
     ttagtatgtt aaattgttaa tattcaactg gcaagaaaaa aaaaactgtt ttaactgacg     82260
     gaatactttt gtaaattata gttgtaaaca cctaatagct aattatagta tttattaaac     82320
     atcaaagatt gcaattaaat agaccttttt gataaatatt gaatagacct tttgacttgt     82380
     tatgaatctt gatatatcaa ttagtggcat gcagagcggg agtcgttata tgtgaaccga     82440
     agttatttat gactaaatag gaacattttg gtgtaaatgt atctcccaat tcaatgaact     82500
     tttttttttt cttcatctaa ttactatttt agttctaaga ctatacaagg cttataatca     82560
     gctattgttt taattgtaag actatcgttt tctcagtttc tgcaaagata aactcagcta     82620
     ttgaatatgg tttcaaaaaa attgtatgga cttgcaaaat tatttgtata gatcttttct     82680
     atagttaaaa agtgagggct atatattttt ttttttgttt ggttgtaaaa aactatgtgt     82740
     attgcacgtt catttgttct taaaactata tgattctgtg tttcttgtat tttttttttc     82800
     tttttctttc cggaatataa aaggaatcaa atacctttgt cgttgctttc tagaatatgc     82860
     attttttttt tttgcaccgt atataaaacc tatttaattt tatatttgat ataatactgt     82920
     aaggtataat attacctttt tattgactcc gtcgttttca accattttga aatttgattc     82980
     tctcgcagtt aaatagacag ataatttctg gtgatcgtat aatattttgt aatttttatg     83040
     tttcgttttt tccaaatact gtataccaca aattatttaa aattcttcct aattttctag     83100
     tttttttttt tttgtaataa agctccatac attcgtaaac ttgaaaaaag aacttctgtt     83160
     accatctctc aaaattgttg aaggaacata aaattctttc agaaaaaaga aaaaaaaagg     83220
     taaacaaata aatgaaatgt tatgagacaa atacgaataa acaacagtaa agagtagaag     83280
     caaataaaag agaaaaaaaa actatatacc gaaacagaga agcagcggca ggaaaactca     83340
     agactgaaga tcactttgga aactgatact tgagatatcg tcacgaaaat gtaaaatgaa     83400
     gctcaaagtc atttcatagc tgctggtcaa ggtaaggatc tctaggcgga ttcgagccaa     83460
     gatactccga gacctcagta acatacgttt tcagcttcga ggtggttcgg gtgagccaat     83520
     cggtgtttgt ctgatccatc tcatccttca tattcgccat cttctcttcc tcttccaaca     83580
     tgctgaccca tctcttaccc atatacattt taaccgcatc cacaccttgt ttcacgactt     83640
     catcaggcgg gacaacaagc gggttttggt ccaagttcag tttggtcaag ttcacgagcg     83700
     tgccaaaagc gtctggaaga gaatggatct ggttgttgct caagtcgagt tcttggaggc     83760
     ttatgagatc tccgaatgaa gcagggagat cttggagatc gctgaagtta ctgctcaggt     83820
     taaggtactc gaggttcgtg agcagcccga aagaatttgg gagaccattg agttcgttga     83880
     agtgtgcatc gaggtagcgt aaggatctca tttcaccaat ggaagttggt aatgatctga     83940
     ttttgttgag atggatcaag agcttctcta gtttcactag ctcgaatccg atgtttgttg     84000
     gtaagtaggt gagattgttg tagctcgcat ccaagacaac caacgatctt taaataaaaa     84060
     aaaaaacaga agtaagaaaa aaacagagga aacagagtca acctttaaag ataaaaaaca     84120
     cttacccaca atggcagatg gaatctggta aagttgtgag tttgttacaa gagacattca     84180
     aaatcttcaa ctttgacaat aaaccgatcg aatctggtaa tgtctccagg aaattagtgg     84240
     aaacatcgag ttcgagaagg ttatgcaaac cagctatcga atcaggaata gcctgttaca     84300
     tacataacct ttgatcaaaa acaagcaaca cacacttcta aatctatctc aatctagaca     84360
     ctaccataag aaccgatcca agaatctacc tctatgctaa aagactcaaa atccagagca     84420
     aagtttacat ctttgacaag caaacacact tttgaatcta tcacaagtac tgatccaaat     84480
     gtcaaagaat tcaccctaaa gagtcaaaat ccagagcaaa gtttacatct ttgacacata     84540
     aacatatcag aattctaaca gatttgatca aaagattatg aatttgacca ttagggactt     84600
     agaaaaactg acctgaagct gattgttata gagattaaga acaaggagac cttgaatctt     84660
     tccaaatgct tcaggaagca acttcaattt ccgaccagac aaatcaactc ggtccaatgg     84720
     attctccgca gcttgttgca gtatactcac aacctcttca ttgacttcaa cctccgcagc     84780
     ttcctcctcc gccaccgcgg cagcattctt ctcggcagac tcatagatcc tcacgagcct     84840
     ctcctctgct tctttcaaaa gcttctcata agattcatga agctcgttaa gcttaaggat     84900
     cgatttatac caaatcttct cttgctccac agcttctctc ctcttctgtt ccttctccgc     84960
     cacgtcaata tcgttaggag agagagcgat ctcttcgaaa gattccgaca aagacgcgtc     85020
     gatctcacgg agcctagcac gagctctgtc gacggtttcg tgatcgggtc ttggtcctag     85080
     ggttcgaaga acagatcggg tctgagaaac gtcggcggtt gcgttagtca tggaggcaag     85140
     aacatcagga tgagccaagt gaggcatctg agtcactatc tcgatagagt ggtttgatga     85200
     tgaagaagga tcggatttgg atggtggtgg ctcgacatcg gaagaggaag aggatttggc     85260
     ggtgaatgaa gggagacgat ccaagacata agagagaaca gggaagttct tagggttaag     85320
     ctccgtcgcc attgttggga gcttgatgga agagacgatt gggagattga ggaagaagaa     85380
     gaagaagaag aagcgattat tggttcgtgt ctcatgtcct tccgtactat tagcatctct     85440
     attgccaagt caaagtcaaa gatcgttaaa ttacacgtgg ttttgtatta atacaagaca     85500
     agtgtcaatg ttatcctaca aagaagaaaa aaatcattct aaaaacactt cttacacaaa     85560
     taataatttt acacttagta gaaacaaatt aattaaggtt ttagaataga taagataacc     85620
     aagaagttta gagaaaactt taattaaggt ttttgaaaaa gtgaataatt tttgttgtta     85680
     ttttgtcttc attttaagat tgtgaggccc aatattggtg acacaaatgt tttatgggct     85740
     tgagaatgat cttagggaaa actatattgt tattcttttg gaaatgaaaa aaaaaagctc     85800
     atttttgaga ctatgcaatg gagactctgt tttcgatatg tatgataata ataataagtt     85860
     aataactttt ggaattttac tgatttttct gtaatctcat gatgattcat gatgatgaag     85920
     acgatgttat agttatacct aaacatttgc ttattttcaa cttaaaaatg tatttatttt     85980
     ataaaattca acttttaaag taaaaaaaaa taaaactcaa tatctctgat agtgacgaca     86040
     cagggagtat taaaatcgaa aaacgtcaac aaaaccggtg gaaagttgaa tgggtcgaaa     86100
     ccaaacgcat atagccataa aagcattgtc tccattatag attctccata tctgagaata     86160
     aacaaacgat tggataaacc gataaagtac atagaacttc gatctttttc acaataaccc     86220
     aaaaaaagag agaaagcaaa aaaaaaaact agagcgtttc aattacaatg gaggagaaga     86280
     gaaatggtct gcgtgtgatt ctcttccctc ttccattaca aggttgcatc aaccctatgc     86340
     ttcagctcgc caacatcctt cacgtaagag gcttctccat taccgtgatc cacacgcgct     86400
     tcaacgcgcc aaaagcttca agccatcctc tcttcacttt cttacagatt cctgatggtt     86460
     tgtctgaaac ggagattcaa gatggtgtta tgtctttgct cgcgcaaatc aaccttaacg     86520
     ctgagtctcc gtttcgtgat tgcttgcgta aagtgttgct ggaatcaaaa gagtcagaga     86580
     gggttacttg tttgatcgat gactgtggat ggctcttcac acaatctgtt tcagagagtt     86640
     tgaagcttcc gaggctcgtt ctctgtactt ttaaagccac tttcttcaat gcttatccga     86700
     gtcttccact tatccgaacc aagggatatc ttccagtttc aggtaattaa tgcttcatga     86760
     aatgcttatt tttaatggtc aaattgctat ataggaaaaa gttatctaac ttgggtagga     86820
     aattcgtatt tttgtaaaca tatttgcata ctgtgactac aaatgctctt cgcactctca     86880
     cctatgatga tgtcagtcta ttaaaaggaa aatgtgtcat ccaataaaaa taaggaaagt     86940
     aaaatttttg catttgacca aaatggtata tttgtattta ttcataattg tgttgttttt     87000
     ttaaaaaaat ggcgtcatct ctactaataa aatagcatgg catgtcaatg aatattggtc     87060
     taacaaataa aaagttaaag ttgttcacgt aactaaggaa aagagtagga tatttaggtt     87120
     atttactatg gacactctat tttgaattct ggttatcaag tttataagat tgttttgagc     87180
     ctttgtgtct tagaatcgga agcagaggac tctgttcctg agttcccgcc gcttcaaaag     87240
     agagatcttt caaaggtttt cggggagttc ggagagaaac tcgatccgtt cttacatgct     87300
     gtagtcgaaa cgacaataag atcttcaggg ttaatataca tgtcctgcga agagcttgag     87360
     aaagattcgt tgactctttc taacgaaatt tttaaagttc cggtttttgc aattggtccg     87420
     tttcacagct acttctctgc ttcgtcaagc agcttgttca cacaagacga gacttgcatt     87480
     ctgtggttag atgatcaaga agataaatct gtgatctacg ttagtctagg aagcgttgtg     87540
     aacataacgg aaacagagtt cttggagatt gcgtgtggtt taagcaatag caaacagcct     87600
     ttcttgtggg tagtacgacc cggttcagta ctcggcgcga aatggatcga accgctctct     87660
     gaagggctgg ttagtagcct tgaagagaaa ggaaagattg tgaaatgggc accacaacag     87720
     gaggttcttg cgcatcgtgc cacaggaggg tttttgacac acaatggttg gaactcaacg     87780
     ctagagagta tatgcgaagg ggttcctatg atctgcctac caggaggttg ggatc          87835
//

If you have problems or comments...

PBIL Back to PBIL home page