(data stored in ACNUC16935 zone)

EMBL: AB005240

ID   AB005240; SV 1; linear; genomic DNA; STD; PLN; 80770 BP.
XX
AC   AB005240;
XX
DT   18-JUL-1997 (Rel. 52, Created)
DT   14-APR-2005 (Rel. 83, Last updated, Version 8)
XX
DE   Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MOK16.
XX
KW   .
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-80770
RA   Nakamura Y.;
RT   ;
RL   Submitted (02-JUL-1997) to the INSDC.
RL   Yasukazu Nakamura, Kazusa DNA Research Institute, Department of Plant Gene
RL   Research; 1532-3, Yana, Kisarazu, Chiba 292-0812, Japan
RL   (E-mail:ynakamu@kazusa.or.jp, Tel:81-438-52-3935, Fax:81-438-52-3934)
XX
RN   [2]
RX   DOI; 10.1093/dnares/4.3.215.
RX   PUBMED; 9330910.
RA   Sato S., Kotani H., Nakamura Y., Kaneko T., Asamizu E., Fukami M.,
RA   Miyajima N., Tabata S.;
RT   "Structural analysis of Arabidopsis thaliana chromosome 5. I. Sequence
RT   features of the 1.6 Mb regions covered by twenty physically assigned P1
RT   clones";
RL   DNA Res. 4(3):215-230(1997).
XX
DR   MD5; aa011bf5f0edc2d386b5266a27555661.
DR   RFAM; RF00768; MIR405.
XX
CC   Address for correspondence: kaos@kazusa.or.jp
CC   For the latest information on annotation of this clone, please see
CC   http://www.kazusa.or.jp/kaos/cgi-bin/agd_graph.cgi?c=MOK16
CC   Genes with similarity to proteins in the databases are described
CC   in 'product' or 'note' qualifiers.  Genes that have no significant
CC   protein similarity are described as 'unknown protein'.
CC   The software programs used to predict genes include:
CC   Grail (Informatics Group, Oak Ridge National Laboratory,
CC   http://compbio.ornl.gov/Grail-1.3/),
CC   GENSCAN (Chris Burge, MIT, http://CCR-081.mit.edu/GENSCAN.html),
CC   NetGene2 (S.M. Hebsgaard, et al., CBS, Technical University of
CC   Denmark, http://www.cbs.dtu.dk/services/NetGene2/) and
CC   SplicePredictor (Volker Brendel, Stanford University,
CC   http://gremlin1.zool.iastate.edu/cgi-bin/sp.cgi).
CC   Genes encoding tRNAs are predicted by tRNAscan-SE
CC   (Sean Eddy, Washington University School of Medicine, St. Louis,
CC   http://genome.wustl.edu/eddy/tRNAscan-SE/).
CC   This sequence may not be the entire insert of this clone.
CC   It may be shorter because we remove overlaps between
CC   neighboring submissions.
CC   The 5' clone is F15A17 and the 3' clone is F12E4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..80770
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="5"
FT                   /ecotype="Columbia"
FT                   /mol_type="genomic DNA"
FT                   /clone_lib="Mitsui P1"
FT                   /clone="MOK16"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        join(985..1839,2157..2246,2385..2651)
FT                   /codon_start=1
FT                   /note="gene_id:MOK16.1"
FT                   /note="unknown protein"
FT                   /db_xref="GOA:Q501G5"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q501G5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB08371.1"
FT                   /translation="MKRAGGGVDFISSLPDEILHHILANTPTKLAIRTSVLSKRWKHVW
FT                   YETPSISIVCNRVDPDSLNKTLSSYSTPKIKSFDVTISRDVTVPEIDTWINLALSRKAE
FT                   NVSLRFTSHYRFRDTFFINSSLKQLSLTLVYCILNPKCVVSWSSLRNLSLNRCKVSDDS
FT                   IAKILTGCSLLESLTLNLCDRLNDLDLSKSLSLRRLEILGDRWTPERIVAPHIRYLRLE
FT                   NYQRPSTLVDVSSLTEANLGLSKHVLDYFTCEMETESLQYMVRQTVVKLQNIKKLTIGG
FT                   IFLQSVIPGLARLLQNSPGLKRITVNITKCNTTPDKHLDRHLKLRGLNPDQSWISKYGV
FT                   FPTVEQTSAKMKHVDSFIKLVMGNTKTLEKLVLQFGDYLDAAYQMVPTLSYDDIQIVIK
FT                   KRRS"
FT   CDS_pept        4496..5347
FT                   /codon_start=1
FT                   /note="gene_id:MOK16.2"
FT                   /note="unknown protein"
FT                   /db_xref="GOA:Q9LYX4"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LYX4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB08372.1"
FT                   /translation="MMISRRPVSSPGRVEKYPPPFMGFLRSKSNGGSTSRSRSRSRGRS
FT                   RASPLFVRRNKSAAAVAQEPSSPKVTCMGQVRVNRSKPKIKPESRDNPTRRRCEWLRNA
FT                   SFYNKFAGKIKTMTFWPKWRLCSFSCACRNLKEKDSPRSQLDHPTTESVREIKEEIEGE
FT                   ENFEIPKLFVSPATTPPINALLLTRSRSAPYRSSSLAFRFWEENNQREVESQQNVRSEK
FT                   TDSEVPIEKINGFHEPEYVDRDEEEFTKLRFVRQPVLTRSKSEPARIGEKMMVLLPDEE
FT                   EG"
FT   CDS_pept        join(8212..8281,8374..8529,8834..8919)
FT                   /codon_start=1
FT                   /note="gene_id:MOK16.3"
FT                   /note="unknown protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FYN1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB08373.1"
FT                   /translation="MKSTVMMIFLIIYLLIAVPCFAKGSEQTDSEVYEIDYRGPETHNS
FT                   RPPPETMHGKPPYIHHNTSAAGLGAHVGGKKRERDLFQGEDSEVEEEDYESCDIYMSN"
FT   CDS_pept        complement(11900..14035)
FT                   /codon_start=1
FT                   /product="receptor lectin kinase-like protein"
FT                   /note="gene_id:MOK16.4"
FT                   /db_xref="GOA:Q9LYX1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001220"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR019825"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LYX1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB08374.1"
FT                   /translation="MLKLPPRFFSVYSTLIHILASFLCSSDVRGDFPATRFDLGTLTLS
FT                   SLKLLGDAHLNNGTIKLTRELSVPTSTAGKALYGKPVKFRHPETKSPASFTTYFSFSVT
FT                   NLNPSSIGGGLAFVISPDEDYLGSTGGFLGLTEETGSGSGFVAVEFDTLMDVQFKDVNG
FT                   NHVGLDLNAVVSAAVADLGNVDIDLKSGNAVNSWITYDGSGRVLTVYVSYSNLKPKSPI
FT                   LSVPLDLDRYVSDSMFVGFSGSTQGSTEIHSVDWWSFSSSFEESSESPPPMPNSPPPSS
FT                   PSSSITPSLSTVRRKTADPSSSCRNKLCKKSPAAVAGVVTAGAFFLALFAGVIIWVYSK
FT                   KIKYTRKSESLASEIMKSPREFTYKELKLATDCFSSSRVIGNGAFGTVYKGILQDSGEI
FT                   IAIKRCSHISQGNTEFLSELSLIGTLRHRNLLRLQGYCREKGEILLIYDLMPNGSLDKA
FT                   LYESPTTLPWPHRRKILLGVASALAYLHQECENQIIHRDVKTSNIMLDANFNPKLGDFG
FT                   LARQTEHDKSPDATAAAGTMGYLAPEYLLTGRATEKTDVFSYGAVVLEVCTGRRPITRP
FT                   EPEPGLRPGLRSSLVDWVWGLYREGKLLTAVDERLSEFNPEEMSRVMMVGLACSQPDPV
FT                   TRPTMRSVVQILVGEADVPEVPIAKPSSSMSFSTSELLLTLQDSVSDCNEVLAPISTTS
FT                   CSSSEHDIFIVGKDRSV"
FT   CDS_pept        complement(18414..19041)
FT                   /pseudo
FT                   /note="gene_id:MOK16.5"
FT                   /note="pir||T08458"
FT                   /note="similar to unknown protein"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        join(19999..20185,20560..20959,21792..22048,22434..22828)
FT                   /codon_start=1
FT                   /note="contains similarity to C2H2-type zinc finger
FT                   protein"
FT                   /note="gene_id:MOK16.6"
FT                   /db_xref="GOA:Q700D2"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR033243"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="PDB:5B3H"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q700D2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB08375.1"
FT                   /translation="MQMIPGDPFSISSSMGGFVHQETHLHHLQQQIPDLNPNSNPNPNA
FT                   KPNSSSAKKKRNQPGTPDPDADVIALSPTTLMATNRFVCEICNKGFQRDQNLQLHRRGH
FT                   NLPWKLKQRSKQEVIKKKVYICPIKTCVHHDASRALGDLTGIKKHYSRKHGEKKWKCEK
FT                   CSKKYAVQSDWKAHAKTCGTREYKCDCGTLFSRKDSFITHRAFCDALTEEGARMSSLSN
FT                   NNPVISTTNLNFGNESNVMNNPNLPHGFVHRGVHHPDINAAISQFGLGFGHDLSAMHAQ
FT                   ALLQKAAQMGSTRSNSSTAPSFFAGPTMTSSSATASPPPRSSSPMMIQQQLNNFNTNVL
FT                   RENHNRAPPPLSGVSTSSVDNNPFQSNRSGLNPAQQMGLTRDFLGVSNEHHPHQTGRRP
FT                   FLPQELARFAPLG"
FT   CDS_pept        join(24437..24566,24893..25058,25158..25359,25447..25607,
FT                   25692..25785,25872..26084,26161..26238,26325..26543,
FT                   26637..26822)
FT                   /codon_start=1
FT                   /product="tetratricopeptide repeat protein 2-like"
FT                   /note="gene_id:MOK16.7"
FT                   /db_xref="GOA:Q9LYW9"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LYW9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB08376.1"
FT                   /translation="MDLFRVWSGMDFLAWRGMAYTLLLLNFVFACQLLLLQPLVSALDG
FT                   QSVDAAELFERASQSIKVKRYSDALDDLNAAIEADPALSEAYFKRASVLRHFCRYEDSE
FT                   NSYQKYLEFKSGDSNAEKELSQLHQAKSALETASTLYESKDIAKALEFVDKVVLVFSPA
FT                   CSKAKLLKVKLLMVSKDYSGAISETGYILKEDENNLEALLLRGRAYYYLADHDIAQRHY
FT                   QKGLRLDPEHSELKKAYFGLKKLLKKTKSAEDNANKGKLRVSAEEYKEAIALDPEHTAN
FT                   NVHLYLGLCKVSVRLGRGKDGLNSCNEALNIDAELIEALHQRGEAKLLLEDWEGAVEDL
FT                   KQAAQNSQDMEIHESLGKAEKALKMSKRKDWYKILGISRTASISEIKKAYKKLALQWHP
FT                   DKNVGNREEAENKFREIAAAYEILGDDDKRARFDRGEDLEDMGGGGGGGYNPFHGGGGG
FT                   GQQYTFHFEGGFPGGGGGFGGFGF"
FT   CDS_pept        complement(27049..27789)
FT                   /codon_start=1
FT                   /note="contains similarity to arabinogalactan protein"
FT                   /note="gene_id:MOK16.8"
FT                   /db_xref="GOA:Q8LEJ6"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8LEJ6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB08377.1"
FT                   /translation="MATSRTFIFSNLFIFFLVIATTYGQAPAPGPSGPTNITAILEKAG
FT                   QFTLFIRLLKSTQASDQINTQLNSSSSNGLTVFAPTDNAFNSLKSGTLNSLSDQQKVQL
FT                   VQFHVLPTLITMPQFQTVSNPLRTQAGDGQNGKFPLNITSSGNQVNITTGVVSATVANS
FT                   VYSDKQLAVYQVDQVLLPLAMFGSSVAPAPAPEKGGSVSKGSASGGDDGGDSTDSSDAE
FT                   RTGFGFGIRITTVAAIAASSSLWI"
FT   CDS_pept        complement(join(28352..28501,28614..28693,28777..29232,
FT                   29313..29481,29640..30095,30485..30556))
FT                   /codon_start=1
FT                   /note="gene_id:MOK16.9"
FT                   /note="unknown protein"
FT                   /db_xref="GOA:Q9FYM9"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FYM9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB08378.1"
FT                   /translation="MDDKDKYREVVEHWSCEGTSPALMVGDSTEITEMLSPSQHQRWRG
FT                   LVLDIQSREAHGDFLRANGSLIHSPVSKRFKFSPMSSPRTGRRVGSMSPSSSRNRTNQK
FT                   NFKNRNHSADIEEGVVSPLGDGSDKSYIPRTWSLTNLLAPRKSKKTESFITHSNPESMN
FT                   GRYAVEVDPVTSMKGERLLPIRRTRSVPTFFNKDGSVKPSSVFRVIPTPSRGDEKRLEM
FT                   TQASKLSKLHDENDDGGEDVPEEEAVCRICMVEMEEDEEAFKMECMCKGELALAHKTCT
FT                   IKWFTIKGNITCDVCKQEVRNLPVTLLRVQDSQNRSRAARDIEISRFNNVWQDIPILVI
FT                   VSMLAYFCFLEQLLIIDMKSSAVAIALPFSCIIGLLASMISTTMVKKNYVWIYATVQFG
FT                   FVVLFAQLFYRVVKQPVMCIVLATMIGFGLTMTGTTAINEYLKWRRSNSHLPEEPASTQ
FT                   VV"
FT   CDS_pept        32944..34299
FT                   /codon_start=1
FT                   /note="gene_id:MOK16.10"
FT                   /note="unknown protein"
FT                   /db_xref="GOA:Q9LYW6"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LYW6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB08379.1"
FT                   /translation="MGIKILKLNIFRGSTNRHALFRALIIASALSVVPLLELTAKNHVF
FT                   GDHGAVDLVDLGRFVIPGPKLFFHKLVQPFWGKIETEKYPQVVIADLVDELMGLKLLHY
FT                   DAKILCIGQGSDSAVSGFKEMGFSVVQGVPKHPLFSFFSRKHVNELELSGDKSFDFVLC
FT                   GDVDHVASPALLVLEMERVLKPGGTGAVLVSTNANRLVKSVTSGLKQSEIVRVNNLDKF
FT                   TVIVFKRNVTETAYCIGKSQLPRDCKSVDTNRPYTEFMEPLLEQKPADFPKSVAYLPKF
FT                   LDLSLKKSLVYIDIGAAEHMDANLTPNWFFPLYPLDSKAFNVYFVDHNTSVMLSYVKKP
FT                   GVTFVYHPDLAENNSTGKKITPLEQLEPFPEDERFDFLAWFEETAKYADFVVLKMNTNQ
FT                   VEMKFLTVLLETGVICYVDELFLRCSNHKSDCINMLQTLRARGVFVHQWWED"
FT   CDS_pept        complement(join(34601..34705,34793..35258,35376..35818))
FT                   /codon_start=1
FT                   /product="RING zinc finger protein-like"
FT                   /note="gene_id:MOK16.11"
FT                   /db_xref="GOA:Q9LYW5"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LYW5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB08380.1"
FT                   /translation="MGNLISLIFCCGRRQRSNIPPAMETAPLELPPNRFVFAAVPPYLN
FT                   PNPNYVDQYPGNCLPPPVTEPPMLPYNFNHLHHYPPNSYQLPHPLFHGGRYPILPPPTY
FT                   VHQKAVTIRNDVNLKKKTLTLIPDPENPNRLLVSFTFDASMPGRITVVFFATEDAECNL
FT                   RATKEDTLPPITFDFGEGLGQKFIQSSGTGIDLTAFKDSELFKEVDTDVFPLAVKAEAT
FT                   PAEEGKSGSTNVQITQVVYTKEKGEIKIEVVKQILWVNKRRYELLEIYGIENTVDGSDE
FT                   GKECVVCLSEPRDTTVLPCRHMCMCSGCAKALRFQTNLCPVCRQPVEMLLEINKNG"
FT   CDS_pept        complement(37221..37490)
FT                   /codon_start=1
FT                   /note="gene_id:MOK16.12"
FT                   /note="unknown protein"
FT                   /db_xref="GOA:Q9FYM8"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FYM8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB08381.1"
FT                   /translation="MNTYQFNSKSNNLNYFRKSKIISSEANMCFFDNRCDQNLTVVVDV
FT                   AWWMEAVPPQIISPAKPSVSPILETILEGGETEEDNQEQENEDV"
FT   CDS_pept        complement(join(41768..41828,41958..42031,42119..42285,
FT                   42450..42519,42601..42735))
FT                   /codon_start=1
FT                   /product="transcriptional co-activator-like protein"
FT                   /note="gene_id:MOK16.13"
FT                   /db_xref="GOA:Q9LYW3"
FT                   /db_xref="InterPro:IPR009244"
FT                   /db_xref="InterPro:IPR037212"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LYW3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB08382.1"
FT                   /translation="MATATYPPPPPYYRLYKDYSENPNSAPEPPPPIEGTYVCFGGNYT
FT                   TEDVLPSLEEQGVPQLYPKDSNLDYKNELRSLNRELQLHILELADVLVDRPSQYAKRIG
FT                   EISSIFKNLHHLLNSLRPHQARATLIHIMELQIQQRKQAVEDIKRRREEAQRLLKDAYL
FT                   TLDGQ"
FT   CDS_pept        43787..44287
FT                   /codon_start=1
FT                   /note="gene_id:MOK16.14"
FT                   /note="unknown protein"
FT                   /db_xref="InterPro:IPR007608"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LYW2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB08383.1"
FT                   /translation="MASRKLFFVKPKYIYPEPKPEMSDENVFEFDESDIHNLGDHQLPN
FT                   SFDAKRSISISRLRRKPTKTGDSGNREITKTGSLPVNIPDWSKILKSEYRGHAIPDDDS
FT                   DDDDEDDDDSNDGGRRMIPPHEYLARRRGSSFTVHEGIGGTAKGRDLRRLRNAIWEKIG
FT                   FQD"
FT   CDS_pept        complement(46127..47047)
FT                   /codon_start=1
FT                   /product="polyubiquitin"
FT                   /note="gene_id:MOK16.15"
FT                   /db_xref="GOA:Q1EC66"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1EC66"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB08384.1"
FT                   /translation="MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
FT                   KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
FT                   TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
FT                   LRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
FT                   RTLADYNIQKESTLHLVLRLRGGSF"
FT   CDS_pept        join(48742..48800,49101..49170,49283..50506,50581..51006)
FT                   /codon_start=1
FT                   /product="non-phototropic hypocotyl-like protein"
FT                   /note="gene_id:MOK16.16"
FT                   /db_xref="GOA:Q9LYW0"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR027356"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LYW0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB08385.1"
FT                   /translation="MAFMRLGSKSEAFHREGQTWLCTTGLVSDVTIEVGDMKFHLHKFP
FT                   LLSRSGLLERLIEESSTDDGSGCVLSLDEIPGGGKTFELVTKFCYGVKIELTAFNVVSL
FT                   RCAAEYLEMTDNYGEGNLVGMTETFLNEVFGNWTDSIKALQTCEEVIDYAEDLHIISRC
FT                   VDSLAVKACADPSLFNWPVGGGKNATSGQNTEDESHLWNGISASGKMLQHTGEDWWFDD
FT                   ASFLSLPLFKRLITAIEARGMKLENIAMAVMYYTRKHVPLMNRQVNMDEQVIETPNPSE
FT                   EDQKTCLEEIVGLLPSKKGVNPTKFLLRLLQTAMVLHASQSSRENLERRIGNQLDQAAL
FT                   VDLLIPNMGYSETLYDVECVLRMIEQFVSSTEQAGIVPSPCIIEEGHLVKDGADLLTPT
FT                   TLVATLVDGYLAEVAPDVNLKLAKFEAIAAAIPDYARPLDDGVYHAIDVYLKAHPWITD
FT                   SEREHICRLMNCQKLSLEASTHAAQNERLPLRVIVQVLFFEQLRLRTSVSGWFFVSENL
FT                   DNPDNQHGANGGLLKPRGENVRERVSELEKECMNMKQELHKLVRTKRSWKNFTRKLNFK
FT                   KKSECCKPKDQATPAI"
FT   CDS_pept        complement(join(51349..51479,51571..52494,52587..52715,
FT                   52805..53049,53136..53287,53397..53483))
FT                   /codon_start=1
FT                   /product="laccase (diphenol oxidase)-like protein"
FT                   /note="gene_id:MOK16.17"
FT                   /db_xref="GOA:Q8VZA1"
FT                   /db_xref="InterPro:IPR001117"
FT                   /db_xref="InterPro:IPR002355"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011706"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="InterPro:IPR017761"
FT                   /db_xref="InterPro:IPR033138"
FT                   /db_xref="InterPro:IPR034285"
FT                   /db_xref="InterPro:IPR034288"
FT                   /db_xref="InterPro:IPR034289"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VZA1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB08386.1"
FT                   /translation="MGFLFLFCYLLAFLGYSPVDAAVKKYQFDVQVKNISRICNAKPIV
FT                   TVNGMFPGPTVYAREGDRVIINVTNHVQYNMSIHWHGLKQYRNGWADGPAYITQCPIQT
FT                   GQSYLYDFNVTGQRGTLWWHAHILWLRATVYGAIVILPAPGKPYPFPQPYQESNIILGE
FT                   WWNKDVETAVNQANQLGAPPPMSDAHTINGKPGPLFPCSEKHTFVIEAEAGKTYLLRII
FT                   NAALNDELFFGIAGHNMTVVEIDAVYTKPFTTKAILLGPGQTTNVLVKTDRSPNRYFMA
FT                   ASPFMDAPVSVDNKTVTAILQYKGVPNTVLPILPKLPLPNDTSFALDYNGKLKSLNTPN
FT                   FPALVPLKVDRRLFYTIGLGINACPTCVNGTNLAASINNITFIMPKTALLKAHYSNISG
FT                   VFRTDFPDRPPKAFNYTGVPLTANLGTSTGTRLSRVKFNTTIELVLQDTNLLTVESHPF
FT                   HLHGYNFFVVGTGVGNFDPKKDPAKFNLVDPPERNTVGVPTGGWAAIRFRADNPGVWFM
FT                   HCHLEVHTMWGLKMAFVVENGETPELSVLPPPKDYPSC"
FT   CDS_pept        join(56048..56158,56395..56484,56693..56864,57690..57760,
FT                   57841..57984,58074..58148)
FT                   /codon_start=1
FT                   /product="lysine decarboxylase-like protein"
FT                   /note="gene_id:MOK16.18"
FT                   /db_xref="GOA:Q9LYV8"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LYV8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB08387.1"
FT                   /translation="MTKKQSSRFKSICVFCGSSNGNKASYQDAAIDLAKELVMRKIDLV
FT                   YGGGSIGLMGLVSQAVHDGGRHNNNNNGNDDALFCHSVNVSQTNSKLTGETVGEVKEVA
FT                   DMHQRKAVMAKHSDAFITLPGGYGTLEELLEVITWAQLGIHDKPVGLLNVDGYYDALLL
FT                   FIDKAVEEGFILPTARHIIVSAPTARELFIKLELNMVSLDRISKHALSLFQVMSKAG"
FT   CDS_pept        join(62740..62988,63133..63219,63310..63420,63512..63724,
FT                   63806..63991,64102..66762,66840..67217)
FT                   /codon_start=1
FT                   /product="EIN2"
FT                   /note="gb|AAD41076.1"
FT                   /note="gene_id:MOK16.19"
FT                   /db_xref="GOA:Q9S814"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="InterPro:IPR017187"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9S814"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB08388.1"
FT                   /translation="MEAEIVNVRPQLGFIQRMVPALLPVLLVSVGYIDPGKWVANIEGG
FT                   ARFGYDLVAITLLFNFAAILCQYVAARISVVTGKHLAQICNEEYDKWTCMFLGIQAEFS
FT                   AILLDLTMVVGVAHALNLLFGVELSTGVFLAAMDAFLFPVFASFLENGMANTVSIYSAG
FT                   LVLLLYVSGVLLSQSEIPLSMNGVLTRLNGESAFALMGLLGASIVPHNFYIHSYFAGES
FT                   TSSSDVDKSSLCQDHLFAIFGVFSGLSLVNYVLMNAAANVFHSTGLVVLTFHDALSLME
FT                   QVFMSPLIPVVFLMLLFFSSQITALAWAFGGEVVLHDFLKIEIPAWLHRATIRILAVAP
FT                   ALYCVWTSGADGIYQLLIFTQVLVAMMLPCSVIPLFRIASSRQIMGVHKIPQVGEFLAL
FT                   TTFLGFLGLNVVFVVEMVFGSSDWAGGLRWNTVMGTSIQYTTLLVSSCASLCLILWLAA
FT                   TPLKSASNRAEAQIWNMDAQNALSYPSVQEEEIERTETRRNEDESIVRLESRVKDQLDT
FT                   TSVTSSVYDLPENILMTDQEIRSSPPEERELDVKYSTSQVSSLKEDSDVKEQSVLQSTV
FT                   VNEVSDKDLIVETKMAKIEPMSPVEKIVSMENNSKFIEKDVEGVSWETEEATKAAPTSN
FT                   FTVGSDGPPSFRSLSGEGGSGTGSLSRLQGLGRAARRHLSAILDEFWGHLYDFHGQLVA
FT                   EARAKKLDQLFGTDQKSASSMKADSFGKDISSGYCMSPTAKGMDSQMTSSLYDSLKQQR
FT                   TPGSIDSLYGLQRGSSPSPLVNRMQMLGAYGNTTNNNNAYELSERRYSSLRAPSSSEGW
FT                   EHQQPATVHGYQMKSYVDNLAKERLEALQSRGEIPTSRSMALGTLSYTQQLALALKQKS
FT                   QNGLTPGPAPGFENFAGSRSISRQSERSYYGVPSSGNTDTVGAAVANEKKYSSMPDISG
FT                   LSMSARNMHLPNNKSGYWDPSSGGGGYGASYGRLSNESSLYSNLGSRVGVPSTYDDISQ
FT                   SRGGYRDAYSLPQSATTGTGSLWSRQPFEQFGVAERNGAVGEELRNRSNPINIDNNASS
FT                   NVDAEAKLLQSFRHCILKLIKLEGSEWLFGQSDGVDEELIDRVAAREKFIYEAEAREIN
FT                   QVGHMGEPLISSVPNCGDGCVWRADLIVSFGVWCIHRVLDLSLMESRPELWGKYTYVLN
FT                   RLQGVIDPAFSKLRTPMTPCFCLQIPASHQRASPTSANGMLPPAAKPAKGKCTTAVTLL
FT                   DLIKDVEMAISCRKGRTGTAAGDVAFPKGKENLASVLKRYKRRLSNKPVGMNQDGPGSR
FT                   KNVTAYGSLG"
FT   CDS_pept        join(68200..68385,68531..68851,68951..69112,69241..69315,
FT                   69488..69597,69690..69762,69899..70090)
FT                   /codon_start=1
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /note="gene_id:MOK16.20"
FT                   /db_xref="GOA:Q945K7"
FT                   /db_xref="InterPro:IPR004434"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q945K7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB08389.1"
FT                   /translation="MAANLARRLIGNRSTQILGAVNSSSGAASSVARAFCSSTTPITAT
FT                   LFPGDGIGPEIAESVKKVFTTAGVPIEWEEHYVGTEIDPRTQSFLTWESLESVRRNKVG
FT                   LKGPMATPIGKGHRSLNLTLRKELNLYANVRPCYSLPGYKTRYDDVDLITIRENTEGEY
FT                   SGLEHQVVRGVVESLKIITRQASLRVAEYAFLYAKTHGRERVSAIHKANIMQKTDGLFL
FT                   KCCREVAEKYPEITYEEVVIDNCCMMLVKNPALFDVLVMPNLYGDIISDLCAGLVGGLG
FT                   LTPSCNIGEDGVALAEAVHGSAPDIAGKNLANPTALLLSGVMMLRHLKFNEQAEQIHSA
FT                   IINTIAEGKYRTADLGGSSTTTEFTKAICDHL"
FT   CDS_pept        join(70724..70818,71008..71061,71296..71342,71440..71471,
FT                   71568..71669,71836..71980,72067..72164,72276..72346,
FT                   72433..72499,72597..72780,73006..73148)
FT                   /codon_start=1
FT                   /product="adenosine kinase"
FT                   /note="gene_id:MOK16.21"
FT                   /db_xref="GOA:Q9LZG0"
FT                   /db_xref="InterPro:IPR001805"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LZG0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB08390.1"
FT                   /translation="MASSSNYDGILLGMGNPLLDISAVVDDEFLTKYDIKLNNAILAED
FT                   KHLPMYDEMSSKFNVEYIAGGATQNSIKVAQWMLQIPGATSYMGSIGKDKYGEAMKKDA
FT                   TAAGVNVHYYEDESAPTGTCGVCVVGGERSLIANLSAANCYKVDHLKKPENWALVEKAK
FT                   FYYIAGFFLTVSPESIQLVSEHAAANNKVFTMNLSAPFICEFFKDVQEKFLPYMDFVFG
FT                   NETEARTFSRVHGWETEDVEQIAIKISQLPKATGTYKRTTVITQGADPVVVAEDGKVKK
FT                   YPVIPLPKEKLVDTNGAGDAFVGGFMSQLVKEKSIEECVKAGCYASNVVIQRSGCTYPE
FT                   KPDFN"
FT   CDS_pept        complement(73453..73797)
FT                   /codon_start=1
FT                   /note="gene_id:MOK16.22"
FT                   /note="unknown protein"
FT                   /db_xref="GOA:Q9LZF9"
FT                   /db_xref="InterPro:IPR003676"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LZF9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB08391.1"
FT                   /translation="MMKKSKLIAKAWKQMSSRVAKHRVATGNPKDQYHIPHDVPKGHLV
FT                   VYVGKDEETYKRFVIKITLLHDPIFRALLDQSKDEAYDDFTSGDSKLCIACDETLFLEV
FT                   LRCASPRYSL"
FT   CDS_pept        join(76910..77278,77349..77609,77680..77802,77884..78393)
FT                   /codon_start=1
FT                   /product="protein serine/threonine kinase"
FT                   /note="gene_id:MOK16.23"
FT                   /db_xref="GOA:Q9LZF8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LZF8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB08392.1"
FT                   /translation="MKCFLFPLGDKKDEQRSPKPVSPTSNFSDVNKSGSDFSPRDVSGT
FT                   STVSSTGRNSNTSMSARENNLREFTIGDLKSATRNFSRSGMIGEGGFGCVFWGTIKNLE
FT                   DPSKKIEVAVKQLGKRGLQGHKEWVTEVNFLGVVEHSNLVKLLGHCAEDDERGIQRLLV
FT                   YEYMPNQSVEFHLSPRSPTVLTWDLRLRIAQDAARGLTYLHEEMDFQIIFRDFKSSNIL
FT                   LDENWTAKLSDFGLARLGPSPGSSHVSTDVVGTMGYAAPEYIQTGRLTSKSDVWGYGVF
FT                   IYELITGRRPLDRNKPKGEQKLLEWVRPYLSDTRRFRLIVDPRLEGKYMIKSVQKLAVV
FT                   ANLCLTRNAKARPKMSEVLEMVTKIVEASSPGNGGKKPQLVPLKSQETSRVEEGKNKKV
FT                   LDGAEGGWLEKLWNPKNVRAC"
XX
SQ   Sequence 80770 BP; 25585 A; 14039 C; 14945 G; 26201 T; 0 other;
     gatcgtggtt ttcgagcttg gctgtgaaga tcttaccgat cctgggcaga tttacatgtt        60
     tcaaggcctt ctagctatgc tgccgccaac gactcctaat ggaaaaataa tttgaagtgg       120
     gagagaaaag aaaaccattt ggatggttga agaagaagga aagctctcca ataaagcccc       180
     ggcttcaaga acttttgtct cagcccggta ttcggttgag tttcagtcgg attagtatat       240
     ccgttttagg cttaggaccg aaatagtgaa agccaaggag tcaaaacctt tctgaagttg       300
     cgcttttggc gtagatgcta ttaggacacg ttctacactc ggatcttgag ggactaatag       360
     cttggaattg gattggatct caggatagga tttgatgtgc tttgtgttag taattgtttt       420
     tgtgtcattg ggtgaattta ggtggtttaa gagatgattt cacttagagt cgtggtgtaa       480
     tttatctcgt tatggttgaa aaaatacagt gaatttcagt tgggtaacgt tgaatccatc       540
     ttagtgtttc agggtgatac tagactgatt cattgtattt ggttaaaata tgttgtggtc       600
     taatgatttg tacctttgaa ttggttaatg gaaagttgtt gttgagccaa aaaaaaataa       660
     aaaaaaatca accgactctg ctaagaaaag gaaaatcagt cgattactaa cggctactta       720
     tggaaacaaa tggaaattaa ccgactttaa ttttaagcta acagtaaaaa aaacactgac       780
     gttatatgtt gaaaatttga aataaccgac tttggtttat tatttgtatc atcactattc       840
     aaattacctt tacggcccaa ctaaataata tagggctttg aagaagccca tctagaagtt       900
     aatataaatt aagtttttaa gggcacaaga atgacgtcat attagtaaac cccaattaca       960
     actctgattc tccttcccgg cgatatgaaa cgagccggcg gcggtgtcga cttcatcagc      1020
     tctctacccg acgaaatcct ccaccatatc ctcgccaata cacctaccaa gctcgcgatc      1080
     agaacctccg tcttatccaa acgatggaag catgtatggt acgagacacc ttctatctca      1140
     attgtttgca atagagtaga tcctgattcg ctaaacaaaa ccctaagtag ctactcgact      1200
     cccaaaatca agagtttcga tgttactata agcagagatg tcaccgtacc tgagattgat      1260
     acctggatta atctcgctct gtcacgcaag gctgagaatg tatctctcag attcacatct      1320
     cattatagat tccgagatac attcttcatc aattcctctc tgaagcagct tagtttgact      1380
     ttggtttatt gcattctgaa tcccaagtgc gttgtctctt ggtcatcgtt aaggaacttg      1440
     tcgttgaatc gttgcaaggt gtctgatgat tcaattgcca aaattctcac tggttgttca      1500
     ttgctcgaaa gcttgacatt gaatctctgt gatagactca atgatcttga tctgagcaag      1560
     tcactaagtt tgagaagact ggagatactt ggagaccgtt ggacaccaga gaggattgta      1620
     gcgccacaca ttcgttattt gagattggaa aactatcagc gaccatctac tttagtggat      1680
     gtctcatctt taaccgaagc taatctcggt ctttcaaaac atgtacttga ctatttcaca      1740
     tgtgaaatgg agactgaatc gcttcaatac atggtgcgac agacggtggt taagttgcaa      1800
     aacataaaga agcttactat tgggggaatt tttcttcagg taatgatgac caattctcta      1860
     atgcctacga ttttctatgt cgtagagtcg tgctatagga taacttagtt gcacattcaa      1920
     atgttggatt atggataagt tttcaacttt aaggagcata tgaagtctct ctgtggaata      1980
     tggaaacttg aagttgttcg gtatagtaga gatatatgtc tctgtagtca cttacttttt      2040
     gtgcttttgt cattcttttg ctagattcta tctcttgccg agctctgtgg tgttactctt      2100
     ccagtcttcc agaattcaat atcgaagctt tgactgttga aacgaggatt gatcagtctg      2160
     tgattcctgg tctagcaagg ctgctacaaa actctcctgg acttaaaagg ataacagtta      2220
     acataacgaa gtgcaacacc acaccggtat cttttctaca gattattctt tttaagaacc      2280
     gtttccttca ctttttgggc taatgcagat agatgtgaga tattttgtag aatcaaagat      2340
     cacttctagt agtttgcttg agcattcttt ttttatgtcg acaggataag catcttgaca      2400
     gacacttgaa attgcgaggc ttgaatcctg atcaaagctg gatatcgaaa tatggggtct      2460
     ttccaactgt ggagcagaca tctgcaaaga tgaaacatgt ggattcgttc ataaaacttg      2520
     tcatgggaaa cacaaagaca ttagagaagc tggttttaca gtttggagat taccttgatg      2580
     cagcatatca aatggttcca acattatctt acgacgatat ccaaattgtg atcaagaaaa      2640
     gacgatctta aatagtacta gtatattagt atatgctatg gaccaccgta gatggcttaa      2700
     ttgtcttggt taacgtgtct acaaattaat tgttttgatc ttaaatttat gattcagagc      2760
     tttaggtttc tgtgttcaca ttgaagggaa caacagttat agctagtctt gtaggttagt      2820
     ctccgtgtga ttgtcgtttt tgatgtgtct tcactgatca gtacacgcaa aaggcaaaac      2880
     tttcctccgt ccaaagcgga tctctatatt acgtttctgt agaaacttaa ggtctctctc      2940
     acacatgtgg tgaaaagtga tagttgaagc aatgtttgaa aattaatatc taaagcttct      3000
     aattgacaaa taaaaagtgt caaaaaggaa aaaataaaat ttcaagggtt gatttttttt      3060
     tttttttttt tttaatatat atatatatat catgcttttg ctttagtttg atttatttga      3120
     cttcttggta tagtttttgg tttattccat tcacgaaaat taatttgaag agaaatcttt      3180
     tgacttttgc tttgaatgtt tagatgaatg aaatctagaa accaaacaac aacttgaaat      3240
     ttaatttggt ttaatataga ttggtttagt tggattccat ttcccccatt cgttattttt      3300
     gtttaggtta tatgtggcta aaaaggaata tatttgcatc catttgtatt tttgggttga      3360
     tatgtttgat gggtttagtg agaatattgg tagtgggaga caagagttga tttggatagt      3420
     tgagtgttgc tattgtttgt ctcaaaagat ttccacttta tgtttttagt catttccaaa      3480
     tcattaacat caaaagctag gtcaaattca tacttcatat gtcccaaaat atttatcaag      3540
     gattctgctt ttagaccatc aacttctagt gatctcttat tattattggc cagtatatag      3600
     caattctgga gttgggtcca ttctataatc catagacaaa tttctttcaa aactttgggt      3660
     agatttttgt aatatcgtct ttaagtttat tattcagaac aatgttactt ctagagattg      3720
     taattttacg tatgtagatt gtagatccat catatttatt tattatcgta gaattatcct      3780
     aaacacgtgt atgaaatatt ttggtttaaa tcgaacgagt cacaaaaatc aaaatttgtg      3840
     gacatgcaaa ttttgaaatg tactcatatt tcttttggat ataagtcttc gtccaaaaca      3900
     aagtcttgtt tgtgtatgat gttgaacttc acaaatgact gataacgtaa cgtaatttca      3960
     cacgagtgac ctcaatataa aaaagggatt gtgttccata ttcaacaaaa cgacactaat      4020
     gacccatgat taaactaaga aatgtagatt taaatgttct ataagattcg tttcaaagca      4080
     gtcaaagact caaagtcgca taaaagcaca aattaaagaa gattagtcta tagggaatct      4140
     taaagaataa gttgttgggt ttacccatat atgcacttat taatctatat agtagggaac      4200
     cacaaagaaa tttaaaaacc aaagtagatt aagaagttaa tctccaaaat aagtagagaa      4260
     aaattaaaaa tacattaatc aacctataaa gtgatatcat aaagagccta aaatcgattc      4320
     gtccgttgag gacaaagaca aataaaagaa atgttttctt taaaaccatt aataagtgat      4380
     gcataaaaat taaataaaaa taaaaaacgg aaaaaaaaac aagtgcagac aaaacgaaac      4440
     cagaacacgg tgaagagaag aggcgagaga gagagagaga gggaaaagga agacgatgat      4500
     gatttctcgg agacccgttt caagtccggg tcgggtagag aaatatccac cgccttttat      4560
     ggggtttttg agaagtaaga gcaacggcgg aagtacaagc aggagtagaa gtcgaagcag      4620
     aggaaggtca cgcgctagtc ctcttttcgt tcgccggaat aaatccgcgg cggcggtggc      4680
     tcaagaaccg tcgtctccga aggttacttg catgggtcaa gtccgggtca accgatcgaa      4740
     gcccaaaatt aaacccgaat ctcgagataa cccgacccga cgacgatgtg agtggctccg      4800
     aaacgcgtcg ttttataaca aattcgccgg gaaaatcaaa acgatgacgt tttggcctaa      4860
     atggagactc tgttcgtttt cgtgtgcttg tcggaatttg aaggagaaag attctccgag      4920
     aagtcaatta gatcatccga caacggaatc agtcagagaa atcaaagaag aaatcgaagg      4980
     agaagaaaat ttcgaaatcc ctaaattatt tgtgtctccg gctactactc cgcctataaa      5040
     cgctctgttg ttgacgagaa gcagatctgc accgtataga tcgtcgtcgt tggctttcag      5100
     attctgggaa gaaaataacc aacgagaagt tgaatcacag caaaatgtga gatcggagaa      5160
     aactgattcg gaagttccca tcgagaaaat caatggtttt cacgagccgg agtatgttga      5220
     cagagatgaa gaagaattca cgaagttaag atttgtacgg cagccggtgt tgacaaggag      5280
     caaatcggag ccggcgagga tcggcgagaa gatgatggtg ttgcttcccg atgaagaaga      5340
     aggttaggta gggtttaggt ctctcacgtg attagtcaat aattgcacta atcttaatta      5400
     attaatcgct ggtatgacta atttaatttg cattgtttag gataatttga ctgtgtttta      5460
     gatatagtag aggaaacaaa tttgtataaa gatttgtaac catacatata acgtaaggtg      5520
     tagatatgtt tggcattcaa aaaaaaaatg tttaacaata cactatgtaa tcattttcaa      5580
     tttgtaaatt tacattatct gtttgatttt agtatgctat ttaaattttg gcaatcaaac      5640
     aaaacataac tttttctagc ttctagagca attcaaaaca aaatttacat attcgagaat      5700
     tgaaccgtag tattattctt ttatgtttta cgttattgta aagtactaaa atgtataaat      5760
     gtttgagcaa accatgtttg acttgttgtt ataagaaaaa agaaaaaaag agctaattct      5820
     ggcccaacgt atagatgggc ttatatattg taggccattt gttcgatact aaagaccaat      5880
     tgaagaccca aaatgtaaat atgtttgtaa attcatttta ttactaatcc gatattagat      5940
     cattgatgca taagttaatg catggtaatg acatatgaaa aataagacaa aaaaaagatg      6000
     ggtgggtgtg aaaatgaaag gaggcgtgcc ttaaggaaaa acacagccat gaaatagctg      6060
     tagagatgga tatggaccca ttacaattta tgatttatga ataagagaac cacgaagatg      6120
     ttagacaaaa ttatttatgg agttctctca ctagcactta taatatatag tagtactata      6180
     tactatataa taccaaatat ttaaatttga cttccccaag actgagacat ctctgatcac      6240
     ctatattctt gaaaattcaa cttttttttt atttgtgatt ttattagtat ctcattttat      6300
     gaaaccacaa tgatttgaaa acggatgtcg ttggattttt aagattatac tgttcaaggt      6360
     ttgatggttt tcttaaaaag gtttcgaata aatatgaatc aaaatatagt tcttttcgca      6420
     tctcagtacg gtgacaagga atacaaaatg aagaaagaaa aaaatgacat tttgaaattt      6480
     cacttataag tcaaaaggtt ttcttttgtt ttaagagtat gagattctca aaaggttcat      6540
     gcatgcataa ttgcatattc attggaatgt acggatgtac ttcggttata tataaactat      6600
     ataatatttc aataaggatt taaagctttc aaacaagcta gttgatgatt tttggagtca      6660
     aactttctta aacatgacta catgagtata gttattggtc caatttgtac gcgtccattt      6720
     tctataggat cggatagtct ctggcttcaa ttagtgatac gttggagttt gaagtaaaaa      6780
     aacgaagatg aatgttttgc tctgtttaat attacagtag cattaatatt atcatcctac      6840
     acatatatgt ttaatgatgg atgaggaata taaaatatgt gttgatagtg tatattgggg      6900
     gtgcacgatc catccatcga ccgacttgaa ataaatggaa aggtagagag agtacagaga      6960
     tgtacagttg taagaaataa gtgggggata gaggaaacat tataacatta tcatctcctc      7020
     atttaatttt atcattaaac tctatataat gtttcaactt cataccagcg atttctccaa      7080
     ttaataatga tgtttattta ggagaatttt ataaaaattc tatatttgta tatcaccgcc      7140
     aaattacaat aactgtgaat ggaatgtact tacctgtttt tctaacgaca ttttctaaaa      7200
     cgaaatggaa tctatcataa attttatttt ctagctatgt cagtttttgt actgtaaact      7260
     gtaaagtaat aatacgaccc aaataagatt gtcattggac taaagtcatc acaaaacata      7320
     gttctagcag cgacttggat cttattgatc cactatcgac ttaggtttac tttggaacga      7380
     acttcgtaac taaatgtttg gtttggtatg gatttgttat tgtatgtgtt caatattaac      7440
     aaagcaacat ttatttttca atagagtaag taatgctata tataagtcgt ccttcgacga      7500
     aaataaatga ctactactaa tggtcaataa atacgtttgg atgcaagaaa gatgatacta      7560
     gataggaaca cgaattcagc ttggaagcca tgagattgaa agctaatatt gtccctcaca      7620
     catgaacttg tcttttctta tttttatttt tagatgaatg gtcgtgaaaa gaaaagaaaa      7680
     ttaatactat gttccagtct ttttaacccg ccataacatg ttgcccatct atacgaatac      7740
     aagagcacag tgttcaagac ttcaaataca agtggcatac aaattcaata atacgaaaga      7800
     cacaaacatt attcaaatgg ccatgtaata aatcaaaatt ttgcatatat tgaaaaaacg      7860
     gatacaatgt aggtacctct ttgcatggac ctctaataaa ttgttttttc ttttcttttc      7920
     agttgatcac ctagaaaaaa aagattctat gttatagtgg aacagaacta gctactcaca      7980
     atagacagag tgattgggga aaaatatata gaatacaaag ttagacatat ttacttctct      8040
     attttaatta ttttgaagaa acaaaaaaca tgacacgttt ttcagtccac gttatatata      8100
     aatatggcca tcatgtacct gaaatatcac cattcaaatt gattgagttt gttatacaaa      8160
     aaaaaaagag aagaagaagc cagaagtctg agagttttat aagtaacgaa aatgaaatcg      8220
     accgtcatga tgattttcct cattatctac ctcctcatcg ccgtgccttg cttcgctaaa      8280
     ggtatttttt tagttctttg tttttcttaa aacgtttaac taggattttt atttgtatat      8340
     tatatcgacg ttgtactata aaacataatt caggatcgga gcaaacggat tcagaggtgt      8400
     acgagatcga ttacagggga ccagagactc ataactctag acctccaccg gaaactatgc      8460
     acggcaagcc accgtacatc caccataata cctccgccgc tgggctcggt gctcatgtag      8520
     gaggaaagag taagttgcca tctccacctt tactaatatt tatttatggc atttacgtaa      8580
     atatgagtct ttggtttttt aaggggaaaa aggtaaataa cagtcattaa atgatatatt      8640
     tattattatc aaatattcaa attgtatatt ttattcttat tcttcgaaat tattatgatc      8700
     caatcaaatg aagtaaattt ccctttcttg catataatgg tgaccaaaac atgcaggatt      8760
     aattaattaa ctctgaattt gtttccaaat tccatgtatt ttgatatgtt ctcttctcca      8820
     tatatcagac tagagagaga gcgagacctt ttccaaggag aagactcaga agttgaagag      8880
     gaagattacg agagttgtga tatatatatg agtaattaat gatgttaatt gatacaaatt      8940
     tatactttaa ttatttatca tatgaagatg atcatcgatg tgtgatcagt acagttagtg      9000
     tgaataacac actactctcc tgatgtcatg tccggtcttt tatttatttc atttttcaat      9060
     tctcatgcac cgttctctat atcatttttt tcggtctgaa tcgttttgaa cttttttttt      9120
     tttaattatt aaatcagggt aatgtgtcac taaatgaata tcaatatagt aattgtttaa      9180
     atgtttgttt aaaacgataa atgtataata attttgcact ctccatatac aaaatgtttg      9240
     ggatgttgtt attacaatta caaatacgtt tattatatca tctattttgt atctatgttt      9300
     acaaataagt gtattatata ctaacataag aatattggac tatattatat ttgatattaa      9360
     gaaaatattt agacactcca actccaagaa tgcaagattg caactttgca aggtgccaag      9420
     gtctgaaaca atccaaacac ttatcattga caactgacga ggtttatttt ggttgttgtc      9480
     tttcttttat tattctatga aaattataat ttaaaattcg caagaaattg tttgtattat      9540
     tgtaacttgt acatgatatt caacaaatta aaattatgat atagatgatc atatatggag      9600
     taatctaaga cactggctcc ttcggaccca ccttttaatc acttcctcaa tcattttcat      9660
     ttttcaatta ttcattcatt ttaaaactgg accatgtgta ttatttatca caatttttag      9720
     ccagtacagt accatttctt tcgcctgaga gaaaagttta tgaattatga aaactttgta      9780
     atagagagtt tgatttgatt tattttatga tctgtcaatg ttggagtata attatttata      9840
     aacatgactt tttaatgaca cacgaacacg agtacacgac aaatgttcta tttaaaatct      9900
     atatctttgt agtttttaat gacacattac tattatttat atctttgcaa acgcttttta      9960
     ttttaattaa attttaacgg catgcttagt cagttttttt tttatgtaat ataaacttta     10020
     attaaaagaa aaaccttttg caaaaaaaac ctaaaaagat gaaaaacact tttttatgaa     10080
     aatgccaaga ataataacat taaagagaag aaacaaacta gggatacatc ggccgactta     10140
     tgttgaaaat actataggcc tcataaacag aatgggccgt ggctttaagc ccagttaata     10200
     actaatgaaa ctcgttcagc tggggttgaa caagttcttg atgttggatg tggagttgct     10260
     agctttgcag cttatcttct tcctttaggt ataaagacaa tgtattttac ccctaaagat     10320
     ggtcatgagc tctgccatag ccaccaatgt cttttgatat ggttcactgt tcgagatgta     10380
     gtcttgattg gcatgaaaat ggtacgactc ttgtgttctt ctttctgttt ctaaatgcct     10440
     tgcttggttt tgtatcaatt ggaactaaag acagtcatct gggcttgatt ctgcagatgg     10500
     tatcttgata ttattatttt gtttctaaga tttgggaaat tctttttttg ttttgttttg     10560
     ttgtagagag gttggtccag gagcagtaaa gacaaacata atgcacgagc tccttcatat     10620
     atatacaagc cattgcattt tgtggtctca agattcttgg actcatgcag tcttcggagg     10680
     atgcagctaa atctgtcatt gatgatgtag tagctccacc tgtaagatct gctctttagg     10740
     atttcttcat cttatctaca taatgtggtt gatctgctcc attgtatctt cagtactttc     10800
     ccgtgaacaa aaatttgcta aagaacgttg ggacacatca tgtcacttat ttaacgaatt     10860
     gcagcaaact cacacttgaa gatcaaagag cttctagtgg ttgcttgctt atgacataat     10920
     cctagcatcc aaactctatc aacttctggt ttcttgtagt acttgtaaac aaacgcacac     10980
     ctgcttaagt agaataaggg ccaatgcttc accactaaaa aaaagtttag ttaaagtttt     11040
     gatttgattt attataatat tttgtatatt gattgatgtt agaaattagt aagattccca     11100
     tttagtgtat gccaattttt tatgattatg accaacctcc attttctaac atattttatt     11160
     tagttagact ttgccattct tctactcaat ctcttgctca ctttttgtat tactttttct     11220
     ttctattgca tgagataatt tgtctgaatt ttgttagtaa aaacacttac caaaatctag     11280
     acgttaactt gaacttgaat tacaagacgt ttttattact aatgccagag tttatatcat     11340
     tcaagccaac tgtatgtaag ccacacaacg ctctgcaagc tatgtattct tattatgcaa     11400
     aaacaacttt tttggtggac gcaaaagaac aacattttgt gtgatatgat actacgagtg     11460
     gtctacttga tatgttggta tgattaccaa ccaaattata caggttatac agtttttttc     11520
     tctgctccca cttgtagtta actaattata gacatgggac caatttccaa accctttctt     11580
     atacagtaga actcttatca aattcaacgt aaagaaagcg acattcacca aactttacca     11640
     tccaaagttg aactagtaaa agtgtcgaac tattatagta tttctctcta ctgaaattga     11700
     actattttat acacattgtt acaaactgta gtcttgactc ttgaggttcc aaaaccaaga     11760
     attattaaaa tcgaacagaa aatatacatg taaatccaac atttttacaa ttagtatgtt     11820
     tttggttttt gtttattttc aatttacgta caaaattgtg cttcgtattt tatattaatt     11880
     gtcatttgaa taatttattt caaaccgatc ggtccttgcc gacaatgaag atgtcgtgtt     11940
     ccgacgagga acaagaagtc gttgaaatcg gagccaaaac ttcattacag tccgatacac     12000
     tgtcttgtaa cgtaagcaat aactccgacg tactaaaact catcgacgac gacggtttcg     12060
     caatcggaac ttccggcaca tcagcttcac caacaagaat ctgaaccaca cttctcatag     12120
     tgggcctggt gaccggatcg ggttgtgaac aagcaaggcc caccatcata acccgactca     12180
     tctcctccgg gttaaactca ctcaaccgct cgtccacggc ggtcaataac ttcccttctc     12240
     tatacaaacc ccaaacccaa tctaccaaac tcgacctcaa accgggtctt aaaccgggtt     12300
     ccggttcggg tcgggttatg ggtcttctac cagtgcatac ttctaaaaca acggctccgt     12360
     agctaaaaac gtcggttttc tccgtcgctc gaccggttaa caaatactcc ggcgctaaat     12420
     accccattgt tccagcggcg gcggttgcgt ccggcgattt atcgtgctcc gtttgcctcg     12480
     cgagtccaaa atcacctaac ttcggattaa aattcgcgtc gagcataatg ttacttgttt     12540
     taacatcacg gtgaatgatc tgattctcgc actcttgatg caaataagcc aaagcagaag     12600
     cgactccaag aagtattttt ctccggtgag gccagggtaa tgtagtcgga gactcgtaga     12660
     gtgctttatc aagtgatcca ttaggcatta gatcataaat taacagaatt tcgccttttt     12720
     ctctgcaata gccttgaaga cggagaagat tccggtgacg gagggttccg attagagata     12780
     attccgataa gaattctgtg tttccttgag aaatgtggct gcatcttttg attgcgataa     12840
     tttcgccgga atcttgtaag attcctttgt agacggtgcc gaatgctccg tttccgatga     12900
     ctctcgatga gctgaaacag tcggtggcta atttcagctc cttgtaagtg aactctctcg     12960
     gcgatttcat tatttccgat gctaaagatt cagactttcg agtgtatttg atctttttag     13020
     agtaaaccca gattatcact ccggcgaata atgctaagaa aaatgctccg gcggttacta     13080
     ctccggcgac ggcggctggt gattttttac agagtttgtt acggcaagag gacgatggat     13140
     cggcggtttt tctccggacg gtggataggg atggtgtgat tgatgaagac ggtgacgacg     13200
     gaggaggaga attaggcatc ggcggtggtg attccgatga ttcttcgaaa gatgaactaa     13260
     agctccacca atcgacactg tgaatctcag tgcttccttg tgttgatcca gagaatccaa     13320
     caaacattga atcgcttacg taacgatcaa gatcgagagg aaccgacaaa atcggcgatt     13380
     taggtttcaa gtttgagtaa gagacgtaaa ctgttaaaac ccgacccgac ccgtcataag     13440
     tgatccatga attcacggcg tttccgctct tgagatcgat gtcgacgttt cccaaatcgg     13500
     ctaccgcggc tgaaacgacg gcgtttagat ccaatcccac gtggttcccg ttaacgtctt     13560
     tgaattgcac atccattaac gtatcgaatt caaccgccac aaaacccgac ccggatccgg     13620
     tttcttcggt tagaccgaga aatccaccgg tggatcctaa gtaatcttca tcaggggaga     13680
     ttacgaaagc taatccaccg ccaattgagg aaggattgag attcgttacc gagaaggaga     13740
     agtaagtagt gaaactcgcc ggagatttag tttccgggtg ccggaatttt accggtttcc     13800
     cataaagagc ttttccggcg gtggaagtgg gaacagagag ttcacgagtg agcttaatag     13860
     ttccgttgtt gagatgagca tcgccgagaa gtttgaggct tgagagagtc aacgttccga     13920
     gatcgaatct cgtcgccggg aaatcgcctc tgacgtcgga ggagcagagg aaggaggcaa     13980
     gaatgtggat gagagttgag taaacagaga agaatctcgg aggaagtttc aacattagtt     14040
     taagtttttc attggattcc tttggagatc tgaggaagaa tttggaggtt gttgggttct     14100
     ctcactgata caatcataca aaagagagac gatgacaaat ctctactgaa tcagacagag     14160
     gaagacgaaa gacgacagaa gagagtggga aataaaaagc agaagtgaag aagacaggtg     14220
     gatctgctga ttgacacgtg gaattatgaa ctgttttaaa aaaatggaat tttccagcga     14280
     tggagaaggt cctcacgtgc aagcgcgtgt tggcttctgt ttgagatctc gtcaaaaaag     14340
     tctttggaag tctttagtaa tgttattgac tttatggaac ttatgatcaa agtacttctc     14400
     gaattaaagc acttatttat ttcagcgtta tagaaaaaaa ttttttaaaa attcattagt     14460
     tgtcataata gttacagatt tttttattat ttattattct atgtaagaaa taaacttata     14520
     tcgttgtgaa agttttatgt catatgattc tttttatttg acttttatgt tgcatattgt     14580
     acccgttttc ttcaaagata cttcctttta taatttttcg aaaggaaagt tcgtatggat     14640
     catcatatca gcataaacaa ataatacttc aatgtcttaa tcattatctc taactaatcc     14700
     acaagttcac aacgcagcca ctcgttgtca ttaccagctc gtgtcgatat ttgtattcct     14760
     tgttgctttt gttttatgtg tatttcttta tctccaaatg tactaagaga ctgttaataa     14820
     atttacttgg ttggtagcaa aaaaaaaaca agggaaaata atcgccaatc tacgagacat     14880
     cgtgtcacag tttgaagtat ttatgtctat ctgacgtata tttattgtgg tcaatattag     14940
     atttaagaca tctctttttc ttttcatttc cttactcttt tgaatttata gtctaaattt     15000
     tggttggtga taagatttcc tcaagtccta ccaaaaaaaa aaagatttcc tcaaatggaa     15060
     acgtactagt acaaaactta aaaagcctca aacgtatctt atggacttgg gcctgatata     15120
     aacaaacttg ttattaactt gggcttcagc ccaaattggc acacaagcta acgttgtaca     15180
     agagtgttat ctcgcggagg tggggataat cctgatgaaa attaaagagc ctccatatta     15240
     gtatgtttat gtgggctttt aattgcgaag aaacaaaaca gatcaattac tatctgggtt     15300
     tctattgggc ctaaggattt gggcctatcc tctttatcta ctagcccata ttgtttttca     15360
     tacaaagcaa agtgaatatt agtctttcaa agcggggatg tttaattaaa atcatgtcgg     15420
     tccctgacct tgtgttctag ttgtaacttg tacttgtaac atactaacat tgaacccaca     15480
     acgtatctgt ctttcaaagt tccaactaaa ataaactaga aaactaatgc tgaaaaaaga     15540
     agaagaagaa aatgtcgata tttcatgctc aaaataatgc atcactatag ctttcaaaga     15600
     acagaataga ggaatgggac ctcatatccg aaaaacatac ctttatataa aattctgatg     15660
     taatgtcttt ggtttatcaa aatcatgttt ttctctttaa acgttgaaat gatagataat     15720
     gctttacaat gacgtcgaac taattttttt gaatattgac cggttgagtt taataagacc     15780
     ggcgtccata ttcaaataga attgtgacac agtaataatt aataaaatac aagttgagat     15840
     ataaaatgaa gtttgtaaca atattaatta gttgctgctc atttcataat tgtatgcata     15900
     tctattcaaa tttaactata catctaagca cttttatggt tgaagccaaa ataattaatt     15960
     aagtttgtat atttgtgtat atgcatataa ttaatgtgtg actatgataa taattataat     16020
     aatacgtttc ttaatcgtag acacaaactt tggataccaa gaggggaata tgatagcatc     16080
     caatggacca aaagaaggca aacacaaaag gccaaaagag aggttgagtt gcattattta     16140
     tggaattttt aatgtaatct aatctaatct ataatatatg ataattattg tactactagt     16200
     tcattttatt taatatctag acaatcgtct ttcataagaa aaaaaaacaa aaattaaaaa     16260
     ctacggtcgg tcttcatata tctgtatgtc tgcgttaata tttatacttt tttcaagaca     16320
     tcttttttct tctttttttt tgctatttag aaagttcaga cccattatct taatattgtg     16380
     atgcgtcaac tgtatttggt aactagcaag tggaactaga agcgtttaag aaacccatcg     16440
     ctattagact tgaatccaaa atcatattca tagtagactc acagtcacta ttatcaaaag     16500
     gatgataata gaagactgat atgctcatga gcttctatat gactgaagat gattgatgaa     16560
     taaaaaaaac tatgattcaa agggatgata atagaagacc aatgtgcatg agaatcatag     16620
     ctccaaaaag agggtcctac agacagagag acaggcgtca cggactgtcc tatcgtcttc     16680
     atcgggaaat gccaaaagat cctctctctc tctctcacat tacacaaata acatgcaaca     16740
     tgctatgttt ggtccaactt gtaattatgc cttaatcatt tcttttgatc tatttcctta     16800
     aaggcaattc ccttttcttg taacttcctc gattgcacaa accaaaagaa gaaaagcaaa     16860
     agatgatcac acttgaatga gtaagaaaat aatttgtagt ccattcaaga aatccaataa     16920
     ttttattttg tccaaagcac atgatcaatc gcatatttca gatctgtttg tactcttttt     16980
     ttgggtgctc gaattagaag aaaaaaacaa atcaatcgtc aatgaaccca tgcttgttct     17040
     acttctaaca aaactttcgt tatgattttg gctaactatg tacatgtttt tattttattt     17100
     tttgaacaaa gatgtacatg ttttactagg tgaagtttat tactagacta tcatttcatc     17160
     gcttctgaat ttatttatta gtgaaaatag aggttagatt tagtgccaat atattgttcg     17220
     atatcacatt ttgacttctc tcgggtgtac actaaattac gtttaattct tcgtattact     17280
     tttcttggct ttaattttgt ttacgagtaa tttgtacttc caagttttgt aaaatcttta     17340
     tataaaaagt agtggaaaaa taaatacaaa ttacaaaaag gcttttttga gttcctaaaa     17400
     ctttttggga gtcaaagatg gtgctctctt taaacaacgg gaactttttg catcgaccta     17460
     tatgctttgt tcttgggaca cagaacattt tcctttgcca aatacaattt cttgggtgga     17520
     taaaattttc cttttatatt aaaataggag ttgaaactat gtccaattaa attaatatgt     17580
     agatccgaaa catagctagt acatatcaac gtagattttt tataaaataa gtaataaata     17640
     aagagctact gtttcttagt ctcaaaatac cttataaaaa gatattgttt tgttttataa     17700
     agaataaaat gaaatttgtt aagaagatat atatatatat atatatctca attagtctat     17760
     atatagggag tatatatata tatagttatt gattactgct tctaaaatat gcaacaatta     17820
     tattggtacg tatataaatt gttttttttt aaaaaataaa taaattcaat ttgtagaaaa     17880
     aaaaaactta ttacaaataa cataaaacaa taaaatgccg aaactaagaa accctttaaa     17940
     gttatgaccg taatagttaa atgttgtatc tacaatcctt tgaaactata tctatgtgaa     18000
     tgaagatttt agttgaataa agaataaatc caaaaatatc atcaaattat gcatcaacat     18060
     taagggtgtc aaaatggatc aaaattcatg gatcaagtca actcaactca atccgtaaac     18120
     tctaatgagt tcaaaatttt gactcaaatg agttgatgag tcaaatgagt tgatgagtca     18180
     attggtttga tgagtaaaat gagttgatga gtcaattggt ttgatgagta aaatgagttg     18240
     atgagtcaat tggtttgatg agtaaaatga gttgggttgt aatggttaat ggtttcaatg     18300
     gtttacccaa ttaacccatc aagttttgta aaattgaatt aaaccaacta aaatctctaa     18360
     accaatgcca atttaagttt aaccaacaca actaaaccga tttaataaaa ttaatatttt     18420
     tctaaatttc ttaaatatac aagcgatgaa attgagaaaa aagtaaactc gtaattttcc     18480
     accaaaaaac ataaacccgt gattttcctg ccaaaaattt aaacccgtga tttttccccc     18540
     aaaaacgtaa cccgagattt ttctgccaaa aatataaacc cgtgattttt ctgtcaaaaa     18600
     cttaaacccg tgattttccc gccaaaaacg taaacccgag atttttccgc caaaaacgta     18660
     aatccataat ttttccgcca aaaacgtaaa ctcataattt tcccgccaaa aaacataaac     18720
     ccgtaatttt cccgccaaaa acgtaaaccc atgatttttc cgccaaaaac gtaaacccgt     18780
     gattttcccg ccaaaaacgt aaatccgtga ttttcccgcc aaaaacgtaa acctaagatt     18840
     ttcccgccaa aaacgtaaac tcgtaatttt cccgccaaaa acgtaaatct tttaaacacc     18900
     gtgattttcc cgccaaaaat gtaaatccgt gattttcccg ccaaaaacgt aaacccgaga     18960
     ttttcccgcc aaaaatgtaa acccgtaatt ttccgccaaa aacgtaaacc cgtgattttc     19020
     ccgccaaaaa cgtaaatccg taaaaagtgg aatccgtaaa tatcctaagt ttgatgataa     19080
     tgaattaata atgataatta tttattattg ttttataata gtaattaatt aaattattat     19140
     ttaaatgggt taatccattt aacaactcaa cccatcaaat taaatgagtt atgggttgac     19200
     ctaacccatt taacaaaatg agttgggtca acccataact catttaaccc taaactcatt     19260
     tgattatgag ttgagttgag ttgggttacc cattttaaca cccctaatta acatacacta     19320
     attgatgata tatatttttc aaataacaat atcatctaaa atataattta gattacatcc     19380
     cttaaatatt tataccttct cccaacttat aaacacacca tagatgtaca catgcacgtg     19440
     tgtctatcta aactgcaaga aaggaagaga ctggcctttt cgaagaaaat aattatttac     19500
     aaaaaatcac tttccctttt agaaaataat ttactagtcg actacaaaaa aaagggtaga     19560
     tctctatatg tacatctccc agatctctca acattattta tacaattttt tcttttattc     19620
     ctgcaagagt ttttttttgt ttataacaac aaatcctctt tcaatataat ctttatatat     19680
     acgtatactt tcgtgccttg aaattttctt cctcatcttc tttggtcttt tcttgtcatt     19740
     tggcataacc aaagagtcaa gcacattcaa acattctcaa gccctaaaac ccaaaaaaaa     19800
     cttatatgct cttgttcttg ttcttcttct cccctcagca tattaaaccc taattaacta     19860
     tctcttttgt ttgtatactg ttataaacct cctgatcatc ttcttgtttt cttgcaagat     19920
     tttataaaaa aaaaacaaaa cccagctgtt cttgttcttg ttctttagct ccgatccgtt     19980
     ttaaattaaa acacagatat gcagatgatt ccaggagatc cattttctat ttcatcctcc     20040
     atgggagggt ttgttcatca agaaacacac cttcatcatc ttcagcagca gatccctgac     20100
     cttaacccta attctaaccc taacccaaat gcgaaaccaa actcttcatc agccaagaag     20160
     aagagaaatc aacctggcac tccaggtata actcattcca caccataata tactcacatg     20220
     tatacccaaa tctatgtgca tgtgtgtgag tcatagatac ttgtatgtct atatttctac     20280
     atatacataa gacgtagaaa gcagctccat atatttgcag atctgttttc tgatgaaaat     20340
     aacatctcca tatatattat ttgctgaaat aatcacaaac tcagtattca catatgcata     20400
     tacatccctc tctatatttc ttatatgtat atttcctcct tttactgtat ccggatggtc     20460
     atgttacata tttgtttatt tataatctct acaacatatt tggagccatt agatcaaaat     20520
     atgcgttgat atatcatatt taaacataaa tatggacaga tccagatgct gatgtcatcg     20580
     ctctatcgcc aacaacactc atggcaacaa acagattcgt gtgcgagatc tgcaacaaag     20640
     ggtttcaaag ggaccagaat ttacaactac atcgccgtgg ccacaacctt ccatggaagc     20700
     taaagcaacg gtccaaacaa gaagtgataa agaagaaagt atacatatgt cctatcaaga     20760
     cttgtgtaca ccatgatgcc tccagggccc ttggagacct cactgggatc aagaaacact     20820
     acagccgcaa acacggtgaa aagaagtgga agtgtgaaaa gtgttctaag aaatacgctg     20880
     ttcagtctga ttggaaggca catgcgaaaa cttgtggtac tcgtgagtat aaatgtgact     20940
     gtggcacgtt gttctccagg taatatttac taacgagatt aacagttggt attggttaat     21000
     gtataagttg agtttttttc tacatgaagt attagaactc ggtattctat tcatatatag     21060
     caatatcgga tgaaagcaat gcaaaacaat tcatgtgaca gtgttagaac ctaaaagaat     21120
     tgtgtaaaaa actcaaacag atataggtgt atatatcaag tgtcggcatg catgaatgtg     21180
     tgtgcaatgt cttgtgattt gttatatctg ttgcgaaagt tggaatagag cagagcatta     21240
     attgaagaca ttctgactta tgggagcaat ttctatttat ttttgtttaa gattttgaaa     21300
     taatagctgc atactttatg agtatatgat attcgatgag attttgatgg catgagcatc     21360
     tattcatttt gtgtggttgt atgtgtacat gtctatttgg cttcattctt ttcttctatt     21420
     cacaccatat ggcaagaaac tagatatcat gcatatattt tgtcaacaaa cacatacaca     21480
     cacatgcata tatattatat atatatatat atatataagt tctatgtttt tgtatatagt     21540
     aacaattaag gtttttgtgc tttttttttt tctttttttt tctagtttta tgtttatttc     21600
     tgtcttcatg tcgcgagttt gcataggaga aataaatgct tactccggcc aagaatgttt     21660
     ttgttttgca aatgatttca aattcaatgc tctattgaat aataatcaat gcagttgtct     21720
     cactcttaaa ataattatgt ctttattttt attatttatt atctaataaa taatcgatct     21780
     ctgttttata ggaaagatag tttcatcaca catagagcgt tctgcgacgc attaactgag     21840
     gaaggagcga ggatgagttc acttagtaac aacaatccgg tgatctctac gacgaatctg     21900
     aattttggaa atgagtcaaa tgttatgaat aatccaaatc ttcctcatgg atttgtacac     21960
     cgaggagttc atcatcccga cattaatgct gctatctctc aattcggtct agggtttgga     22020
     catgacctaa gtgcaatgca tgcgcaaggt acatcacata ccaatcctct ttctaaatta     22080
     gttattcata tatatgaaat attttttttt tttgatgaat atgttataat actattatca     22140
     attcaattgc gttaatttag gtctatccga gatggttcaa atggcctcca ccggcaacca     22200
     ccacctcttc ccgtcgtcat catcatccct ccctgatttc tccggccacc accaattcca     22260
     aattccaatg acttccacaa accctagtct caccttatca tcatcctcaa catcacaaca     22320
     aacctcagct tcactacaac accaaaccct aaaagactca tctttctcac cactcttctc     22380
     ctcttcctcc gaaaacaaac aaaacaagcc tctctctcca atgtctgcca cagctctctt     22440
     acaaaaagct gcacaaatgg gctctactag aagcaattcc tccaccgctc cgtcattctt     22500
     cgccggccca acaatgacat cctcctcggc caccgcttct cctcctccta gatcgtcttc     22560
     tccaatgatg atccaacaac aactaaacaa cttcaacacc aatgtcttaa gagagaatca     22620
     taatcgtgct cctcctcctc ttagtggtgt ctccactagt agtgtggata ataatccctt     22680
     tcaatcgaac cgatcgggtc taaacccggc tcaacagatg ggtctaaccc gggattttct     22740
     tggagtgagc aacgagcatc accctcacca aacgggtcgt cgtccgtttt tgcctcaaga     22800
     actcgcaagg tttgctccat tgggttgatt atgtgtttaa ttaggtactg tgtggggggg     22860
     acaagatttt gggtttaatt aggattggaa gttcctttga ggagacaagt ctaattaaga     22920
     accgtacccc cttgtgaagc ggtcggaatg tggggacaaa ggttgacaag acatcatcat     22980
     atcaatttac attgaatgtt atgtactttt ttactatgtt tatgattatc gcaattcaca     23040
     taatatatac caccatgaca tgcatggata tgtatttccg acattgtcgt tttgtaaatg     23100
     ttgtttattt tttctcgttc ttgtaatgac attcaaaaaa ttggtaaatc ttcaggcttt     23160
     tccaagtttg ttaacgaaga cattgcttaa atcgaatatt gtgatatata tgttcaattc     23220
     tctaaaatcc atggttttct gttttagaca cttctttgat tctattgtga tgcgatcact     23280
     acacttatac agttatattc taaatttaga tatgttgaca ataaccctac aaaacgttcc     23340
     ccaagaacag ctcaaagcct caaagaaagt cgcttcaaaa gttttaaaac aaaagtaaac     23400
     tcattttata accaacatta tgcgttcata tataactgtt ttctttaata aaaatacaaa     23460
     attcttacat aaagtataat tgaaactgaa ccaccttgtt gaaacttcct ttcaagagaa     23520
     ctcaagttct cgaggtgtgt gtcaatgtaa ccttttggat tctgcgtaaa ttaaaatatt     23580
     tttaactgat actcttttca gtagactgat aggcttgtgc ttgtctttat tttgacttat     23640
     ctctaacccc acacatacaa tagtataact aaatagctag tattattttc ctagaaaata     23700
     tgaaatctgt cgtcttgtgg atccatgcgt tattcgtttt tcattgtcaa acactaaaag     23760
     atttagtatg tatttatgtt atttgcttcc ccccaccaat ggtaaatcct attataagtg     23820
     ccactaatag gattatttaa atttaaattt tgatgcatgt caaaatcaaa atcacaaaac     23880
     agagtaatat ttattttaca taacatatta ttctttccaa aatctgaagc aaaaaaaaaa     23940
     ttagatgcaa gttttgtgat actgatccgg ttaattacac ttccaacatt ttgggcccat     24000
     caagtattct gttaggccca tatttatctt tcagttataa ggttggcctt taaggcttca     24060
     attctaatag gcccaagaat cgcagttatc ttacgtggca gagtaagagc cagcgtggaa     24120
     tagttagtca tacgtgttta attatcattg gttactattt acgaaattga aatttactta     24180
     aaacaagttc cacgtgggtc ataacgattg gatagaacaa cgtgttgtta taactagtta     24240
     cacttaaaac atgcaaatca aaataaaaaa aaggcttcga attcgatcga agaacgataa     24300
     ttcgaaacac acaaatttgc ttgaatcaaa gactcttctt cttcgttcgt tcgtttcagt     24360
     gattccaaag attccaaatt tgtcggtgta atcttcgttg tattcagagg tgtatgtata     24420
     tgtattgaaa tcgagaatgg atctgttccg agtttggtca gggatggatt tcttagcttg     24480
     gagaggaatg gcttacacac ttcttcttct caacttcgtc tttgcttgcc aacttcttct     24540
     tctccaacct ctcgtttccg ctctaggtat attttattct ctttgatttt cctatcttcg     24600
     cttcgttttc ccctggtgag attgatgttt gttgtttagc tgatttggga atcttagggc     24660
     ttagaaattt gctctaaatg gcgaattgct tctgtacttt tcgaaagttt tctccttttc     24720
     gtgttgggct tgtcgcaaat tgaggttccc tgtgatggta ttgaaatcga atttaggact     24780
     ctgtttttgc tgctccacat tatgaattga tctaatttgg atactaggtt atgagagtaa     24840
     tgcatctttg tatactcgtt gagtgttagc gttgctgttt attttggtac agatggtcaa     24900
     tcggtagatg ctgctgagtt attcgagaga gcttcacaaa gtatcaaggt taagcgttat     24960
     agtgatgccc tcgatgatct gaatgcagcc attgaagcag accctgcgct ttcagaagct     25020
     tattttaagc gtgcctctgt gcttcgtcat ttttgcaggt ataggaatga gctaaaggtc     25080
     ctgtcggttt gcatttttat tcttataagg cgttaagcca gaagttgatt tctcttctat     25140
     ttctctgtgt tatatagata cgaagactct gagaatagtt accagaaata tctggaattc     25200
     aaatcaggag attcgaatgc tgagaaagaa ctctctcagc ttcatcaagc taagagtgct     25260
     ttggagactg cctcgactct gtatgaatca aaggatattg cgaaagctct tgaatttgtt     25320
     gataaagttg ttcttgtctt ctctccagct tgctctaagg ttctcttctt gattgctatt     25380
     tgcagtatat ctttggactc tctgatcatg cagtttctta ttatttacat tgttttttca     25440
     cttcaggcaa agcttctcaa agtgaagctc cttatggtgt ctaaagacta ctcaggtgca     25500
     atttctgaga ctggttatat tctcaaggaa gatgaaaata acctcgaggc gttgctcctt     25560
     cgtggccgtg cctactacta tttggcggat catgatatcg cccaaaggtt tggtctaact     25620
     tcaaccttat tttcaatcag agagagtttg gggtccaaaa cagatatact taagtaaact     25680
     ttctgtttca ggcattacca aaaagggctt cgtcttgatc cggaacacag tgaactgaag     25740
     aaagcatact tcggattgaa aaaactgctc aagaaaacaa aaagcgtgag ttctgcaaac     25800
     ctctttgtct tcttttaaca ctgagcttta gctgccaatt tcttgtgttg aaaacatgtg     25860
     ctctattgca ggcagaagat aatgcaaaca aaggaaagtt gcgagtttca gcagaggaat     25920
     ataaagaagc tattgctctg gaccctgaac acacggcaaa taacgttcat ctctatcttg     25980
     gactatgcaa ggtctcagtc aggctcggcc gtggaaaaga cggcttaaat agctgtaatg     26040
     aagcacttaa catcgatgca gaactgattg aagctttaca tcaggttcaa atcatcaagt     26100
     gttaaatcat aacattcata actattttaa ccaacagggt tctgattact acttcatcag     26160
     agaggagaag ctaaactgtt gcttgaagat tgggaaggag ctgtggagga tttaaagcaa     26220
     gctgctcaaa actctcaggt tggtgaaaga ttagtgttca gtgtttctga tatctaaaat     26280
     gtagcttaga tcttgactca actaaaacac acatctaatt gtaggacatg gaaattcatg     26340
     aatcacttgg taaagcagag aaagcactga agatgagcaa acgaaaagat tggtataaga     26400
     ttcttggaat ttccagaacc gcctctatct cagaaatcaa aaaagcttac aagaagcttg     26460
     ctcttcaatg gcatcccgat aaaaacgtag gcaatagaga agaagctgag aacaaattcc     26520
     gagaaatcgc tgcagcttat gaggttcaac aaaattccac atcactcttt catattcaca     26580
     cacatggtca tggtctctct cattctcttg acattttaac cttttaattt taccagattc     26640
     ttggagatga cgataagcgg gcgagatttg acagaggaga ggatcttgaa gatatgggtg     26700
     gaggcggcgg tggaggatat aatccgttcc atggtggtgg tggtggtgga caacaataca     26760
     ctttccattt cgagggtggt tttcctggtg gtggtggcgg ttttggtggt ttcggtttct     26820
     aacttgaaca acatgatgga atcatgtaac ttaagactaa tcttttcaaa ttatactcaa     26880
     tatcacattt tcctttcttt catcaaaaaa agttgtgtgc aatcttaatc aaaacaatca     26940
     cacgtaataa cacatctata aaacaatctc aaagtacaac aaaaacttaa agctctcgtt     27000
     attcttaaaa ttccaaatgt ggagactcaa gaaaagctct ctctcgagtt atatccacag     27060
     agaagaagaa gcagcaatgg ctgcaacggt agtgattctg atcccaaacc cgaatccagt     27120
     cctctctgca tcagatgaat cagtagaatc tcctccatca tcgccaccgg aagctgagcc     27180
     ttttgaaaca gagccgcctt tctcaggggc cggagcagga gccacgcttg atccaaacat     27240
     ggctaatggc agcaaaactt gatcaacctg ataaacggcc agctgcttat cgctgtagac     27300
     agagttagcc acggtggcgc tgacaactcc agtggtgatg ttaacttggt taccggagct     27360
     agtgatgtta agagggaatt taccgttttg gccatctcca gcttgcgtgc gtaaagggtt     27420
     actaacggtt tgaaactgag gcatggttat gagtgtaggt aagacatgga actgaacaag     27480
     ctgaactttt tgttggtcag acaatgagtt taaggttccg gatttgaggc tgttgaaggc     27540
     gttatcagtc ggggcaaaca cggttaagcc attactcgag gaagaattga gctgagtgtt     27600
     gatttggtct gaggcttgag tgcttttaag aagtcttatg aacaatgtga attgaccagc     27660
     cttttctagg attgcggtta tgttcgttgg acctgaaggg cctggagctg gagcctgacc     27720
     ataagtagtg gctataacga ggaagaagat gaagagatta gagaaaatga atgttcttga     27780
     agtagccatt gttgtagttg ttgtgtgtgt atgttgagat gttttggggt ttgttatata     27840
     gagagagatg tagtttggtg aagagtagga ttctcttact agtgtgaaga ttattactag     27900
     gtaactaaat gagattctat caactaagtc attagagatt ggaaatgttt cttttaggtt     27960
     taataaagtt tgtttgaatt gagaaagaga gaggagagac attgctttga agggagagtt     28020
     tgggtgggtg aggattgaaa atgaaaaatg aactgaaaaa ggtgttatag tgacctgtca     28080
     aaaaagctgt gaagaagtgt tatccaagaa atatggattg ctaatcatac tactgttcat     28140
     tatgatttta tgtgtcatgt gtgtgcctat catcattcct tatattttag ttggcaaaaa     28200
     aaaaaagact tggaagtatt gaaaaccaaa tctgatctca acctagacaa gtcgattaaa     28260
     gctaaaccga aaaccgaatc ccgaccggtt aattgaaaac cgatccaacc ctttagggac     28320
     tctagcttca ctcaaaagat ctacgctgct gtcaaaccac ctgagtactt gctggctctt     28380
     ctggcaggtg ggaattgctt ctcctccatt tcaaatactc gttaatagct gttgtgccgg     28440
     tcatggtgag tccaaatccg atcatagtgg ctaagacaat gcacattacc ggctgcttca     28500
     cctacacaca agttaatgag agagagtgtg aggaatcaaa aactcttcaa caaagtaagg     28560
     tttctctgtg acaacaaagt aaggtttctc tgtgacatta catcaaatct tacaactctg     28620
     tagaaaagct gagcgaaaag gaccacaaaa ccgaactgaa cggtggcgta gatccataca     28680
     tagttcttct tcactgcaac aaaccaaacc acttaagact gatgatcaat atagaatacg     28740
     aaaaaatata taatttcgaa gtagcttctt tattacccat tgttgttgat atcattgatg     28800
     caagaagacc gataatgcaa gagaacggta aagctattgc aacggcgcta gatttcatat     28860
     ctataatcag aagctgttca aggaaacaga agtatgcaag catgcttaca atgacaagaa     28920
     ttggaatatc ttgccataca ttattgaacc gtgaaatctc gatatccctg gctgctctag     28980
     aacggttttg agaatcctgc acacgtagaa gggtaaccgg gagatttctc acctcttgct     29040
     tacacacatc acatgttatg ttccctttaa ttgtaaacca tttgatagtg cacgttttgt     29100
     gggcaagagc tagttcccct ttgcacatac attccatctt aaaagcttct tcatcttctt     29160
     ccatttcaac catacagatt ctacacacag cttcttcttc aggaacatct tctccaccat     29220
     catcattttc atctgaacac atatcacata gtttgttaca tagagtcaaa atatggcatc     29280
     acaaagatat gtctgggaag gtgatttgta accgtggagt ttactcaatt tcgatgcctg     29340
     cgtcatctct agtctcttct catccccacg agacggagta ggaatcacgc ggaaaacact     29400
     tgacggcttt acacttccat ctttgttgaa gaatgtgggg acagagcgtg tacgacgaat     29460
     aggcagtaaa cgctcccctt tctagtaaaa agaacagtaa aatcaagtaa agcagaagat     29520
     aaacagcttc tctaaagcta agacaaatgg aaaatgaatc aattcatcaa ctgaaatact     29580
     caacaagata atctccctta ttaatggtat aaccaagttt tgtaagatag aatactgacc     29640
     atggatgtaa ccggatcaac ctcaacggca tacctcccgt tcatggactc agggtttgag     29700
     tgagttataa aagactctgt cttcttagat tttctaggag ctaagagatt agtgagagac     29760
     catgttcttg gaatataaga cttatcacta ccatctccta aaggggacac aacaccttcc     29820
     tcaatatctg cactgtggtt cctgtttttg aaattcttct gattcgttct gtttcttgac     29880
     gaggaaggac tcattgatcc aacacgtctc ccagttctag ggctggacat tggagaaaac     29940
     ttgaaccttt tggaaacggg gctatgaatt aaggaaccat ttgctctcaa gaaatcgcca     30000
     tgagcttctc tcgattgtat atctaacaca aggcctcgcc atcgttgatg ttggctcggt     30060
     gatagcattt ctgttatctc agtagaatct ccaacctgga aaactcaaaa gaagactttt     30120
     gtatcagttc ctcacaaagt tggatccttg aaaactcatg ttcctcaatg agcaattaca     30180
     atccctagat tttcacaaaa atgtgtgcct taaacctgga atctccggaa aacataattg     30240
     aagcagttcc atgatttaca agtgacaatt caacaagtac taatgatcaa aacaatccct     30300
     taaaccctga tcttataacc ctaaactctc aagagctaag ctaaatcaga aagaaagaaa     30360
     aagaagatca attttgagat acccatgaac taaaaaccac tgaaattagc ttaaagcatg     30420
     aatctttcag gaaaaattca aaattttggg aattgagtta agacttaaga gtgagaaaac     30480
     tcaccattag agctggagaa gtaccttcgc aagaccaatg ttctactact tcgcgatatt     30540
     tatctttatc atccatcacc atcaaattac aaaacccaga aacagtgaag taaaagaaga     30600
     atctcaggaa aacaaagtat caatctttgg gattaatttg cttaaaagga ctaattttta     30660
     ggagaaatga taatctgaga aagaagcttt tgatcaagaa cactcatata ggttgcttca     30720
     attttgtgtg cttactcagt gcctgccccg tttctctcaa ctaaagaagt aaattggatt     30780
     cggcggtttt tatttttatt gttttgtctc tattacttac ttaagtaata acctcttttt     30840
     tttttctaat tttggtatat atctttaacc agtggtgcat ataattttga atcaaaattt     30900
     ccagcttaca tgtcaaataa aaattgtctt caacattctt gtgaaagaag aaaaagaaaa     30960
     tcatgtttct attcaaaaat ttgaatgcat caaatgtgta aagcaatagt aagaaggtaa     31020
     tcaagtatgg cagcccactc aaatgtatgt acagattaca gatattcata acattttaaa     31080
     aaatgattca aaaatggttt atggatatta tctgaacttc tgctgaatgt tttagaacat     31140
     ttcacaaata ggttatgtgt atttctgatc atatttggaa caaaatctga ttaaacaaaa     31200
     aaaagaaaca atgaattttt taaaaacaaa atctgaacat atttataaca gaaaaagaga     31260
     ttaggaaaaa aatattatgt atgaaaattt tgttggaaga aaaatacaga ttgtctttac     31320
     ttatttagat gtgcaatgct gagtttatct tatactgctt ttgaaagata aaacaacaaa     31380
     aaaaatactt ttgtaattta tttattaatt gggaaaaagg agaaaaagta taacatttcg     31440
     agagaaagaa gtaaataaca ttgagagtga taaacctttg gacaacaatt taaaattctg     31500
     tcgagataag aacgactcat aacgcaaaat atggtagtta cgctgacaca aacaaagaaa     31560
     taatggataa ggcaaaatgt aacacgcatc acacctaagt aggatcgatg tctcaacaaa     31620
     cacatgtaca agtgtacatc aaaccgacta aatgtataga ttatgtttat gatatgaatg     31680
     actataagat ggttaacaat gtgaattttt tttcacgaaa ctatatcaac gacgtgtcga     31740
     aagagcatgt aatcttacaa atctgatagc atttttagtg ctatactctg aaggctgaag     31800
     cacatgaaag atgaaatgaa atcatgcttg acagaaaatg ggacggtgac gatatcaaaa     31860
     gcaaaaaaat aattgtggaa ggcccaactc ggcccaactt agccaaaact gtgtggccac     31920
     cactcgactc gtgttcgatc caaaacataa taggtttaca ttttacaaat tttcagagtt     31980
     tttttttgct aacttaaaaa aaaaaaaaaa agagagttta tctatgctag gttggatgat     32040
     taatatgatt agcgtacaat attatttctt ttttacaacc attcaaaaaa attagtttcc     32100
     taaaaacttt ttaagaaaat taaaacagaa actacttggg atcaacacgt atgtgttcac     32160
     cacccacacg gatatggaca ctgtgtaggg acaacagcca aattcaacat caaataatta     32220
     tttcgaaggc acagacaata agtgggagcc actcgttttt gtcaaaaata ttgaataaca     32280
     aattagcgat ataaacaatt ctcacttatt ctgtttaaaa aaacgattat tggtagtttg     32340
     gtactactac tcaataatca tagaagacca tgaaaacgaa atccacgtag tatgtgtata     32400
     atcacaaacg gtcaaacatt taacattagc ataaattctt gtcacgtggc aatattgtgg     32460
     cggtagaatt ttaacattgt ggttagcttc accattaaat ctgttaaaag cgcttcctca     32520
     ctcactcttc ttccccaaaa aaaaaacaag acagaggaag agaatcacga aaccatagtc     32580
     ccaaaccctt cgaatctata agcatttctc aaacacaatc aagaaactgt gtttagcttt     32640
     tagatttcta caagcatgta agacgagatt ttgtttcttt tttttctgca tggtggatcg     32700
     aacggtgaga atggggacgg aggtgaagtc gattagggtt ccaagaaggg tctggtttgg     32760
     atcacaaata tctatagttc tcctcgtggg tggaaaccat acctcctcca ggttttgtac     32820
     tcgctagatt cttcgatttt ctctttgcga ttcttctttg ttcttaagat ctgtttagca     32880
     aatcgtacta gacattaatc atattttaag attccatcgg agctgaagta tttgaagaaa     32940
     tcaatgggta taaagatctt gaagcttaat atcttccgtg gatctacgaa taggcatgct     33000
     ctgtttcgtg ctctcatcat cgcctctgct ctatctgttg tccctttgtt ggagttaacc     33060
     gctaaaaatc acgtctttgg tgatcatgga gcagtggatt tggtcgatct cggccgattt     33120
     gttattccag gaccgaaatt gttcttccat aagctcgttc aaccattctg gggtaaaatt     33180
     gagacagaga agtatccaca agtggtaatt gctgatctcg ttgatgagct catggggtta     33240
     aagctattgc attatgatgc taagattctc tgcattggtc agggatcgga ttctgctgtt     33300
     tcagggttca aagagatggg tttctcagtt gttcaagggg ttcctaagca tccattgttt     33360
     tcctttttca gtaggaagca tgtcaacgag cttgagctta gtggtgacaa gtcttttgat     33420
     ttcgtgctct gtggggatgt tgatcatgtt gcttcccctg ctcttcttgt gcttgagatg     33480
     gagcgggttc tgaagcctgg tggaaccgga gcagtccttg tgagtactaa tgccaatcgt     33540
     cttgtcaaat ccgtgacttc ggggcttaag cagtctgaga tagtgcgtgt gaacaacttg     33600
     gataagttca ccgtcattgt attcaagagg aatgtaacgg agactgctta ttgtattgga     33660
     aagtctcagc taccaagaga ttgcaaatct gttgacacca atagacctta cacagagttc     33720
     atggaacctc tactggagca aaagcctgct gatttcccaa aatcagtagc ttacttacct     33780
     aaattccttg atctctctct gaaaaagagc cttgtctaca ttgacattgg agcagccgag     33840
     cacatggatg ctaatttaac tccaaactgg ttctttccgt tatacccact cgacagcaaa     33900
     gcattcaatg tctactttgt cgaccacaac acttcagtaa tgctatccta tgtcaagaaa     33960
     cccggcgtca cctttgttta ccatccggat ttggctgaga acaactcgac agggaaaaag     34020
     ataactccgc ttgaacagct agaaccattt ccagaagatg agagattcga tttccttgct     34080
     tggtttgagg aaactgcgaa atacgcagac tttgtagtcc ttaagatgaa cacaaaccaa     34140
     gtggaaatga agttcctaac tgttttactg gaaacaggag tcatatgcta cgtggatgag     34200
     cttttcctcc gctgttccaa ccacaagtca gactgcatca acatgcttca aactctgaga     34260
     gccagaggtg tgtttgttca tcaatggtgg gaagactaaa ccaatgtaaa actcaatctc     34320
     gcttcgcctt agtcttatct acgtcgattc gtgtctgtct ttgtctcagt tgtaatgcca     34380
     tcaccttctg tgtttgccat agttggtcct cggccaccac agctcctggc caagcaccta     34440
     taactaaata agaagctgcc tatctgttta tcattgctat ttaagaactc agtttccact     34500
     tataatatat tgaaccataa cgttttacgt cttaattaag catggcatat attacacaag     34560
     tcgattgctt aactaaattt gttcattctc catctccatt tcatccgttc ttgttaatct     34620
     ccaaaagcat ctcaacaggt tgtctgcaaa ctgggcacag atttgtctga aaccttaacg     34680
     cctttgcgca cccgctacac atacactgcc aaacagaaat acacaaacca tttcaaaaga     34740
     agttcaattt tttttttata tgagctaatt ttaagtatga tgaacactat accatgtgtc     34800
     tgcaaggaag aacagttgta tcgcgtggtt cagacaagca tacaacacat tcctttccct     34860
     catcggaacc atcaaccgtg ttctcaatcc cataaatctc aagcagctca tacctcctct     34920
     tattcaccca tagtatctgc ttcaccactt ctattttaat ctctcctttc tccttggtat     34980
     acaccacttg agtaatctgc acattggtgg aaccagactt tccttcttcc gctggagttg     35040
     cctccgcctt aaccgccaac gggaagacat ctgtatccac ctccttgaat agctcggaat     35100
     ctttaaacgc cgtcaagtct atacccgttc cagatgattg tatgaacttc tgaccaagtc     35160
     cttctccgaa atcaaaagtg attggaggca aagtatcttc ctttgtagct ctaagattac     35220
     attctgcatc ttctgtagca aagaaaacaa ctgtgatcct gttctcgcca accaaaacaa     35280
     caaaagctaa gtcatttata ttactccatt gattgattca aacaagattc aaacttttaa     35340
     ctaaatttga tcatttcata gtttgaaagt aaaaccttcc gggcatggat gcatcaaatg     35400
     tgaaggagac aagaagtcga ttcggattct ccgggtcggg tatgagcgtt aaagtcttct     35460
     tcttcagatt aacatcgtta cgaatcgtga cggctttctg gtggacgtac gtaggaggcg     35520
     gcagtatagg gtatctaccg ccgtgaaaca aaggatgagg tagttggtaa ctgttgggag     35580
     gatagtgatg caaatggttg aaattgtacg gtagcatcgg cggctcagtt actggcggag     35640
     gaaggcagtt acctggatac tggtcaacgt agttagggtt agggttcaga tatggtggca     35700
     cggcggcgaa tacaaatctg ttcggtggga gttcaagagg agccgtttcc atcgccggag     35760
     gaatattgct cctctgcctt ctcccgcagc agaagatcaa actgatcaga ttccccatga     35820
     tcggaaaaag aaaaaaggtg aggtttttcg gtgattcagt tgataaggag tagaatcgaa     35880
     gtaggtttta tgatcattga gaaaggggag taatgagatt ggagatagcg acgtcgacga     35940
     agaaacacca aaacgtttat ttgtatatat tataaattag tattaaactt gattaattac     36000
     catgggaaat tgattattac ttttaatcac ataaaacaaa gaaatcatta tcagtagcac     36060
     taggcaggca ataggcccaa ggcctcacaa caatatcacg gttacaaaat aagaagaaac     36120
     gaaatgacaa aaccggagac acgagattgg ttttggaggt tgatcggaaa acaaagaaac     36180
     acatccatta ataccggcga ttacaagaag cactgctcgt cattaagaaa catcttgcac     36240
     tgatcgtcat taagaaacat cttctcttat gtctgattat ataggagatc ataataacgt     36300
     cgataaaaaa gagtttaaag tggaaatcaa ccaagaaata gaaagcacta tcaagatata     36360
     tttcaaaatg aatatttcat taaaatggat taaaaaataa ttaaacactc gagttttgat     36420
     cttgtcttgt taaaatttta ctcatcgtgt tcctcataaa ttgtccccag cgaaggcgaa     36480
     gctgaaaccc tcatcggata aacaagaatc gccggtacag tttcgaatgg tccgatcatc     36540
     ctagccatga tttgtaaata tactctttct tcgatttaga cttcggcagc tttcgactgt     36600
     gttgagaaga tctatgtgga aattattgtt attgctgata tttatagaga tagagaggaa     36660
     tagtagtagt gtaattaact aatcatcaag tgatctttat atatttgtat acttttttat     36720
     aggacgcagc ttaatactta tcgcacgtga tatttatgtt tcatatttag gtgatgctcg     36780
     aaagttgaaa cataagtatg cgtacactgc tttagtttgc agataaatca tacatgtctt     36840
     tattaaaaat taatgtaaat tagattcttt tggttgagaa aatgatcgca ccaaacagaa     36900
     atagcggtga gactggtttc aggtttaagt ttggtttgat atttgaagat actgattttt     36960
     tgtcgtggac cggttatcgt cccggttcgg ttagaaagta tattaagatt tgtctttaat     37020
     taccaactcg tgagcatata acaacagatc accgagcgta caagatgtga aagttgaatg     37080
     aaaatttcac aaagaactga gatttgattg tacaaaagat acaatacaaa atctcatctt     37140
     atacagttat agaaaaaaca acaacaacaa caagagtcta tcttaaaccc aagaccgagt     37200
     aacaaaatga tcattacaat ttacacgtcc tcgttttctt gttcttgatt gtcttcttcg     37260
     gtctctccgc cttctaaaat cgtctcaaga atcggagaaa ccgatggctt cgccggagaa     37320
     atgatttgtg gaggaacagc ctccatccac cacgccacat ccaccaccac cgtcagattc     37380
     tgatcgcacc gattatcaaa gaaacacata ttcgcttcac tagatattat tttagatttg     37440
     cggaagtaat tcaaattgtt actttttgag ttgaattgat acgtgttcat ttgttcgtat     37500
     ttatagagag attgacgcgt ggagatatgt ggaacaatga tgggtttgac gtaagagtcg     37560
     gacaagtgga cgatccacaa tgtttaagtt agtttgttga cttggtctta tttgctaata     37620
     ataatgaaac caacacgaat attctagaac ctcttgttgt cgtcattatc aacaagtctc     37680
     gaatgtgcaa cacgtgtgag ctcttgtctc acacgtctat atctccgcta agattttttt     37740
     ttgttgttgt caatgttagg atatttcttt atgcgtcgta tattgcaaaa tactagacac     37800
     acacttaggg tttgaagttt ctcagcaatt gtgtgggtac gctttggaca aatacactac     37860
     tctacaaatt agtttagacc gcgtttgact cggtaacgtt agaagcagat tagacactaa     37920
     ttaggcccaa gttaaactat catgggctca ttcgtaaact tagttctaat gggctctcaa     37980
     catcagatct taatatttat agagagcatg aggtcaaatg cgtagttccg tatatgagaa     38040
     ttatgaaact gaacccataa gcattttaat cacgctgagg aaagtagcca cttctcgttt     38100
     aactaatacg gtaatacctc attctgcctg ttttattgat ttgtttggat attttggtgc     38160
     aattcgatta aaaatgtacc tagaaaacaa aattaaaatt gagaaaataa aaaacgtacc     38220
     aattgataga aaaaaagatt attgtacgct gaaaaagtag aaagaactag ataattttta     38280
     gtgatgacaa aaacgaaaat cttctttgtg aacttaaatc gctggaaaac atgccatatg     38340
     cagagttaat caaaacatta ttagcaatca attgatatat gtatatataa atataagatg     38400
     ccttagcttt ttcttatata tataattagg ttaattagaa aataagtcaa tggcctgaaa     38460
     aggattggat aagataagga tatttgaaag gttgctttca ttcttcttgc aatttccccc     38520
     ttattttagt tttcttagct tatagaattc atccctcatt ttccgtcatt tgatattata     38580
     acataagatg catgaggacg acaaaaatag aaataataag tgaataggta ggtataccat     38640
     gtacttgtca ctagacgatt cgatatttta catagagatt aatctatttc tagggaatta     38700
     ttggcacctt atgatcgaac atgtcaccta aaaaaagtga gcttatcaca tcgcataagt     38760
     tttgcaaaaa tattcttaaa ctaatttttt aatgtatgtc agaataatgt ttcatcaatc     38820
     gagaatatgg attagagata taattcacta gcaaaatttt acaaacggat tcttttttct     38880
     tttttttttg ataaccgaaa ttgatatatg cttgtatagg gtggtcgaag ctaaggtcta     38940
     ccatagttaa ttgctaattt aattattatt agttgtaaaa cacacaagat gacatcatta     39000
     tttgatctaa cacaataaaa atagaattag gcaaatgaaa atcggtttag taaacgacaa     39060
     atcaacaatg tcatgtgttt tgttttctga ttttggttca atttaattat ttcaaaataa     39120
     ttttcttgat atccaaagat ccatttttaa ttcttttatg agagaggtta gagcttttac     39180
     cctcaaaggc ctcgaagcta ttttttattt ttattttttt ttgtaatgtg tcatttttag     39240
     gagtccattt ttcgaacata acataagcat agatacaata cggagctgat catttgacat     39300
     aatatgaaat tttccaacag ttatttgttc ggtgataaaa caataattga aatcccaaca     39360
     agtagaagat atgcaactaa caagaaagat tacgatcata cggctgaaca atgagaattt     39420
     gatgtttctt aatcacgtag gattctatgc ataattagaa tatataggaa tattattaaa     39480
     gacaagagaa gatttaagaa gctcgattat tatcttacta catgcattat tattatttgt     39540
     tttttttctt ggtacttgtg ttttgttatg tatctcaaag ctccaattat gtagaggtca     39600
     tcgaccaata attaatcaat tgaccacact actctatatt ttaaatagta attggttcaa     39660
     caggcaaaga cgctctttta tttgacgatt attttctagt ataataaaat ctcacaaacg     39720
     tcataattta gttgtaagga aagcaatagt ataaaagaag tataggtagt gtgagtgcga     39780
     caaaggaaat aaaacacata caagacttga aactatttat gaattatgac ttctttgttt     39840
     tagtaagcta aagtgataca taaatataac atattatatg tggatatgta caacaacaaa     39900
     tctacaatga atgtctacgt gcatggtgga tacacatctt ctatacatgc acgcggcata     39960
     tatgataatt catgcaaaat taaaataaag tatcgttata ggagttatta ggccatctcc     40020
     attggtaaga tactttaaaa gtttctaaaa aaaaaaaata taataatatt ttattatgat     40080
     ttagtttctg tccaattata aacacacata tacacatagt ctctcaatca ttactcgaaa     40140
     gtttttctgc agagaaacta ttctcaatct ctcttctatc tctctcctac tctattatta     40200
     ttttatattt tttagttaat aagaaactat gtgacagact actaatggag atgctcttat     40260
     tatctagttg tgaattttgt agaattgaca tatgtattat acacaactag ttatgaatct     40320
     agatttttta aaagatttta taaggattaa atccacctat tttcattgct atatattaac     40380
     ctacaattat atctataatg cataatgcat tggttattta tgtttattgt ttacaataat     40440
     ggcaatgaac gtctatacaa aattacaaag aatatatcta aacaaaaagt gaatgtcctt     40500
     ttatatatga ccctagctat aaaatttatt cgagtccccc acatgttttg ttatgttcag     40560
     attattgtcc aacagattta ccaattataa tatgtttcct gtttctacaa taatatcatc     40620
     tacttgtaat ttgttggcta ttgcattttc attttgtcca tcatgcattt ggtaaaatat     40680
     tagtagtatt tcgcaagatg taccaagcgt cgttaatatc tggtctcttt tgtccatttt     40740
     cgtctttcag catcaagaga atgaaaaaat tggagagctg agtgacgtgt cgcgatactg     40800
     acgcctgaaa tatccgtaat tttcaaattg agatgaggtc cagtgggcca acttatgttg     40860
     acaagtgata tctcacctat tattggccca cgtaatcctt ttattatcag gtgtatttta     40920
     aattatatgt aattattttg tattattata atttaaagaa agtcatatca aacagctgaa     40980
     cactaaataa ataaattata attctttttt aaacactatg tttttgtttt atcttgatat     41040
     atggttgaca aaaatacaag attgataaag aaaatgagtc attgtggaaa caaaaaatga     41100
     ttccacaatt tgctatttat tttgatagaa actatttaag taagtgaaca aggcatgtcc     41160
     ctatttagtc cacgtgaagt aatcggacgt gtcaattttg tttactgaat agaggtgtaa     41220
     taatccgacg tgtcattcat ctttggacta tccaataatg tgtgcacaga gttgggccat     41280
     gttcctctgt ggacaatccc actagtaatc ctcatacaca atagagtcat attattgaaa     41340
     ttaactgcaa tgagttttta gattggataa aactaaaaga aatgaaactg gctaattgca     41400
     attggataaa ctgaacattt atttttaatt tgtatttcta tgagtttcta aaacatcggt     41460
     tcaggtgtca atcaactgct taaatcaaat tctttattcg agatattgac agatccattc     41520
     acatcaaatg tatgttcgat atatcatagt tccgtttcgg ttgtatcacc ggtttattct     41580
     ttctcttttc cttcaaaaga aaacccggtt aattatggtc taattaatac aatcctcata     41640
     ctattcagtc ttagttgatt gtcaaattaa ctttgtttta gtgttaacaa attataataa     41700
     gcttcgaagg tcaataacaa taacagacag attattaatt gctaatttac acacacaaaa     41760
     aaagactcta ttgaccatct aaagtgaggt aagcatcctt tagaagtcgc tgtgcttctt     41820
     ctcttcttct gcgcacaacc aaaaacatca aacggaccca taagaactac caacaaagtt     41880
     tctgaaaaat ctttgaacag atgatggatt gatataagca caccattaag tacagtatac     41940
     aaacaaaata tgcacacctt ttaatgtctt ccacagcttg tttcctctgt tgaatttgaa     42000
     gttccataat gtgaataagc gttgctctcg cctggacata agagaagatg atcaaaacag     42060
     tgaaaacaaa aactgatgaa atcatgttgt agttaagcga agatgagatc ttctttactt     42120
     ggtgaggcct caaggaattg agaaggtgat gcaaattctt gaagatagaa gaaatttcac     42180
     caatcctctt cgcatattga gaaggtctgt caacaagaac atcagcaagc tccaatatat     42240
     gtaactgtag ttctctattc agtgacctga gttcattctt gtaatctaca cacaaagata     42300
     tttgaaactt tcttcaacga aacaaagagg caaatgaact catgtaataa gtttgattcc     42360
     aattaaggga agaaccaaaa accgtactct agaaagcaaa taacaattgg gttttgagtt     42420
     tgattcacaa agctaaaaca atgacatacc aagattagaa tctttgggat aaagttgagg     42480
     cactccttgt tcttctaagc ttggaagaac atcttcagtc tacgaaccaa aaaaaatgaa     42540
     aactactaaa acacataaag atgaagattt taaagagggg gaaatgtgga ggagactcac     42600
     agtatagttg cctccaaaac agacgtaggt gccttcaatc ggaggaggag gttcaggagc     42660
     agaattaggg ttttctgagt aatccttgta gagtctgtaa tatggtggag gaggcggata     42720
     cgtagctgta gccattattc cctacagatc caaataaaaa actaagcaaa atcagtaaca     42780
     gattcctaaa attaaggttt ctaatcgatg caacaaacga ttcaatccaa aatctaagac     42840
     tttactccaa cgattctgga taaaatttgc aaccatggta caaagagaaa ttagggttaa     42900
     caaaaacacg aacctattgg gaatgcagaa tcggaaatta taaccagacg agaataagat     42960
     cgaagaagct tttgattttg ctttggagaa gacggcgtag agcaagaggt caataatgac     43020
     gaaacgagtt ttgattttct cgtaaatttt cggttacgtg ttcggacggt tcgtataagt     43080
     ctggtttctt ttggtttagt ttcggtttaa ttaaaacaat ggcttttcag tttaattcga     43140
     tttctgctgt ttggatgtga ttaatcaccc cactaatgat gttattctta cgtttttaca     43200
     tttaaaaaat agtaaatatt tttactttat aataaataaa tatatttttt gtgtattcta     43260
     gatttttttg tcaatttaaa tagaaattaa caaatatttt aataacaaaa aaaaattaaa     43320
     acagctaaaa aaatcatatc taacaacatt aaatcttaag ataacttaaa ttaaatcaaa     43380
     gacgaagata aaaattccat taacatcatc attttgatca taaactcata aagtttttac     43440
     tatttaagaa aaagaaaaac aaaggacgag tgaaacaaaa aaagagagct cacgataaga     43500
     acgtgagact tgccacacct tataaacttt tttttttatc ttcttttgta cttttgtcgt     43560
     ttactgtgta agtcataaac tcacataagt ttaacccaat gagagagctt atctctttac     43620
     tacatttctc tataaaaatg atcatctcaa cacatttctc cttcaatctc aaatttcaca     43680
     aaaaccctct cagatttttt ctacaagctg atcaaaaccc agaatccagt tttcataaaa     43740
     acatcatctt tcttttattc ttctttacac gctctgtttt tcatcaatgg cgtcaaggaa     43800
     gctttttttt gtcaaaccta aatatatcta tccagaacca aaaccagaga tgtccgatga     43860
     gaatgtcttt gaattcgacg aatctgatat tcataactta ggcgatcatc aattgccgaa     43920
     ttcattcgac gcgaaaagat cgatatcaat ctctcggtta cggagaaaac cgacgaaaac     43980
     cggagattca ggtaaccggg agattacaaa gaccggttcg cttccggtta atatccccga     44040
     ttggtctaag atcttgaaga gtgagtatag aggtcatgcg atacctgacg atgacagtga     44100
     cgacgatgac gaggatgatg acgatagcaa cgacggtggg agacggatga ttccgccgca     44160
     cgagtatttg gcaagacgga gaggatcgtc gttcacggtg cacgaaggaa tcggtgggac     44220
     ggcgaaagga agagatctaa ggcgattgag gaacgcgatt tgggagaaga ttgggtttca     44280
     ggattagtaa tataataagt atgtaattaa ttataactct ctataggtaa acttttaatt     44340
     acttagagat cttaagtaag gacttggtgt ttttttattg gaggggttta gaggatcgtt     44400
     atagtttcgg tccgaaggag aatttttccg atttcctttt ggcgttattt ttgttttttg     44460
     gagtttttga tcatcgtcta tttttctttt tcttttttgg atatgatcaa taatatttta     44520
     tatttttgtg tgtttcaaat atgttgaatt ttggttgttg tgtggttact tcaattttta     44580
     cagaaatcta cagagaaata ggcagtggcg gaactagaac ttgcagctct aggggtcaaa     44640
     atgtataaag gaatgatcat aggggtcaat ttatgtattt cattggtgtt aatttaaaaa     44700
     ctgtagcaaa aaaataacta aatttcataa ttccatgggg gtcatatgaa gaagataaac     44760
     gaatgctaag atctattgaa ctcggtagaa ctaaggaaat ttgaatataa caaagctgga     44820
     ttgagtttaa tttcaaatat gttaattttg gatcaataat aatccaaaaa ccaaccaact     44880
     aacgaaaacc ggactagtca ctacaacagt tcaaactaaa ttcttcacaa aacatctctt     44940
     caaagtttga aaaccttaat agtcacgtct tttgaaagtc gtaaattgaa ccatatattt     45000
     atatagtttg gctctaaacg ataggttaca aaagtcttca gcttagaaat gatgtgtttt     45060
     ctacactttt ctcttctttt ttttcttttc atctcacatg aatcaaaaag agaaagctta     45120
     attacattaa aggttgatgt gatatttact ttctaaatat ttgctagaag aaattataat     45180
     gataacatta aattaagtta tagtcatttc tatttcggtt gtctcccact ttctgctatg     45240
     cttttacaac aacagttcaa gatttggaat cgttttcttt ctccaccaat cgtagtaata     45300
     cttctttttg tgtttgttga aattttgcaa gattctctct tcctctggtt aatacacata     45360
     acttacttgg taagcttggc tgcattttct tttcaagctt ttaatcaaag actcactaga     45420
     aattgcaaag gcaaacataa aattatgtga tcaaactcct actgtgagtt tttggttaca     45480
     aacaaaagtt aaaaacaaaa gcttgatatt taaaagataa actcaacaca tatgcatttg     45540
     actggcgcac agaagacaat tcaagacttg ggaaaacagt gagccatcaa aatcgtcaga     45600
     taattcaggg aatatattga atgtggagat gtggtaatca cactattgca cacaaagagt     45660
     ggcaaacaag cggcgccctt ggtttggtat agtaagagac aattgttttg gactgtttgt     45720
     gttgccatat tcacaaaaat actattgagc tatgtatgtt aaacattatg gtcaatgagt     45780
     agtagtgaac attcaagttt tttttttttt ccacttcaag tttttcatct tattattatt     45840
     tttcgttgtg atgcagtagt acggcccatc ttcaccagta gtatatcaaa gccgaaacag     45900
     atgacaaatt gtttaacatg cacttggatt attattgaga gttgaaatac aaaggcccgt     45960
     tacaagccca aacgaaggta cataaaagaa aagcagaaaa tgaaaacgaa atcgataggg     46020
     ataagttttt ccaactgacg gaaacacaaa ctacaccagg tgaaatagat cacctcccaa     46080
     gtgcatgaga cacgaaccaa ccacttatca tcagatcaca aaaagcttag aagcttccac     46140
     cacgaagacg aagaaccaag tgaagagtcg actccttctg gatgttgtaa tctgcaagtg     46200
     tgcgaccatc ctcaagctgt tttccagcga agatgagtct ctgttggtct ggtgggatcc     46260
     cttccttgtc ctgaatctta gccttgacat tatcgatggt gtctgagctt tcaacctcca     46320
     gagtaatggt ctttccggta agggtcttca caaagatctg cataccacca cggagacgaa     46380
     gcacaagatg aagtgtcgac tccttttgga tgttgtaatc tgcaagggtg cgtccatctt     46440
     cgagctgctt accggcaaag ataagcctct gctgatccgg aggaattccc tctttatctt     46500
     ggatcttagc tttgacattg tcaatggtgt ctgaactctc aacctcaagg gtgattgttt     46560
     taccagtgag ggtcttgaca aagatttgca taccacctct gagacgaagc accaaatgaa     46620
     gggtcgactc cttttgaatg ttgtagtcag caagagttct tccgtcttca agctgcttac     46680
     cggcaaagat aagtctctgc tgatccggag ggattccttc cttgtcctgg atctttgctt     46740
     tgacgttgtc aatagtgtca gagctctcaa cctccaaagt aatggtcttg ccagtcagag     46800
     tcttgacaaa gatttgcata ccacctctta aacggagaac caaatgaagg gttgattctt     46860
     tctgaatgtt gtaatcggcc aaggtacggc catcttctag ctgtttaccg gcgaatatta     46920
     atctttgctg atccggagga atgccttcct tgtcctgaat ctttgcctta acattgtcga     46980
     tggtgtcaga gctctcaacc tcgagagtga tagtcttgcc agtgagtgtt ttcacgaaga     47040
     tttgcatctg aaataaaaca atagaacaag tagaaaccaa tcagcgaaca tataccaaat     47100
     caaaagccgt aagagaaatc aaaacaacac caaagagaaa cggatctaaa cataagaaac     47160
     ctaaaacaga gagaatcgaa caaagaaaac acaaaaattg aatagatcgt ccttgaaaat     47220
     cctaatttca caatcaagca agaaattaca cagatgtaaa cactacgaat cgatatctta     47280
     gtaatcagga caaaatttag aagctggatt gacgaaacga acaatattgt caaaagcaat     47340
     ttatacaaaa gattcaataa tccacataac aaaaattgga gatcagatac gaatcaaaaa     47400
     caaaaagaat cagaaaatat accttgaaag agagagtcgc gagagatttg cagagatcgc     47460
     tttaggcttt gggagagatt gaagagtcag aaaaagacga aaggatgaat tattatcttc     47520
     cacacgaagg tcttctttat atcgcaaacc aaaagcccaa aaccgtcttt tctattaatg     47580
     agaataaaat atctttagcc aaaacaaaaa aaggaagata tcagttgagg attattatca     47640
     cgaaactaaa ggaaggaatc atatgatacg tgtcatattt tccaccgtgc gtttttaaaa     47700
     gaccgactca agtagaaaca tcctatggtg gtggttggat taggtcatcc attacatctg     47760
     cttcactgac atttttctat ttttcttttt gtatatactt ttcctcaaat aatttctttc     47820
     ttttctatag aagaatttaa tcaataagga aaaagttcaa aaaagattct ttccattaag     47880
     actatgtctt ggttaaccca acccattaag aataagcaat cataatatat atagagaata     47940
     ctaatactat atatgagatt tttcttttaa tttcatgttg attatgatag tttatcttct     48000
     tgatttaatt tatcaatact tggcataaaa gattctaatc tactctaata aagaaaagaa     48060
     aaaaaagtat ctaccattga ctaattaaaa taaggaaact tatctaccaa atttgagtat     48120
     tttttagaac aatctttttg gtttaattcc aaaactctaa acctaattgt tgggaaaaag     48180
     gacctaattt ttaagaaaag ttaataatta gaagatctgt atgttttttt ttttgatcca     48240
     agtttttatt tcttttctct ttttttcatg ataaaatcta tgttttttta gtctacaatt     48300
     aaagtaattg ttattatttt ctttatcttt ttttgttgtt gttgttaatt cccttttttt     48360
     ttttttaaca gcaacttctt aaaaaaaaaa acagttgggc cttgaattta tttcaggcct     48420
     gcgttattaa gcccagataa taactcaaaa caaaaaaaat gttgaaccgg aataaacccg     48480
     cgagattaaa tgccggtttt caggtaacat agaagaagaa tatatgagga ttgaagaagt     48540
     attcaagagg cggaacaatt cacaagtcca agagcttaaa tttctcctca ctcttctgct     48600
     acagactcgg aactctttct ctttgctaaa ataagatgtt caggattttt gttgcccgac     48660
     aattcatgta tctcacactc tctctcttct ctgttcttac tactctgtta cattaccacc     48720
     aactcaagac tttcttccac aatggcgttt atgagacttg gctccaaatc cgaagctttc     48780
     catcgtgaag gccaaacctg gtattctttc ttctgcattg aattagacta atcgacttat     48840
     aagtctttgt ttccggtttc gagatcgaat tctcttcaat gtcgttaatt tctcttgatt     48900
     ttatatgtaa tcaagctctc atctttttgt tgaaatcgaa atgggctctt cctagaatcg     48960
     ttagttattg atgcaagttt caaagatcat attttttttg gaatttagct ctgattgatt     49020
     tgtgacatca ataatcaatt ttgtacggac aagtatattc tgttttgggt ggtggtttat     49080
     gtctctctct tgtcttacag gctttgcact acaggactcg tgagtgatgt taccattgaa     49140
     gttggagaca tgaagtttca tctccacaag gttaaatttt ctctatcttc tctgtttatt     49200
     tagtcctagt tttgatgtaa ttgcataaat gtgaaagctt gatgatctaa ctgtgtaatg     49260
     tgtgttcttg atttgtgtgt agtttccgtt actatctaga agtgggcttc ttgagaggtt     49320
     aatcgaagag tcttcaactg atgatggatc aggctgtgtg ttgagcttag atgagatacc     49380
     gggaggcggc aaaacgtttg agcttgttac caaattctgc tacggtgtga aaattgagct     49440
     tactgctttc aatgttgtta gccttagatg tgcagctgag taccttgaga tgactgataa     49500
     ctatggagaa gggaatcttg ttggtatgac tgagactttc ctcaacgagg tgtttgggaa     49560
     ctggactgac tcgatcaaag ctcttcagac atgtgaggaa gtgattgatt acgctgaaga     49620
     tcttcacatt atctccaggt gtgttgattc gttagctgtc aaagcgtgcg ctgatccaag     49680
     ccttttcaat tggcccgtgg gaggaggaaa gaacgcaacg agcgggcaga acactgaaga     49740
     tgaatcgcat ttgtggaatg gaatctctgc ctctggaaag atgctgcaac atactggtga     49800
     agattggtgg tttgatgacg cttcttttct tagcttgcct ctctttaaaa gactcattac     49860
     cgctattgaa gcacgtggca tgaagctcga gaatatagcg atggcggtta tgtactatac     49920
     aaggaaacat gttcctctga tgaatagaca agtaaacatg gatgagcaag tgattgagac     49980
     accaaatcct tctgaagaag accaaaaaac ttgtcttgaa gagattgtcg ggttgcttcc     50040
     aagcaagaaa ggtgtaaacc cgaccaagtt tcttctcagg ctgcttcaaa ctgcaatggt     50100
     gcttcacgca agccaatcct cgagggagaa tctggagaga cgaattggaa atcagttaga     50160
     ccaagctgct ctagttgatc ttcttatacc aaacatggga tactctgaaa cgctttacga     50220
     tgttgaatgc gtcttgagaa tgatcgaaca gtttgtttcg tcaacggaac aagcaggcat     50280
     tgtcccttct ccttgcatca tcgaagaagg acatttggtg aaggatggag ctgatttgct     50340
     aactccaaca acgttagtgg caactcttgt tgacggttat cttgctgagg tggcacccga     50400
     tgtgaacctg aagctggcga agttcgaagc cattgctgct gcaatccctg actatgcaag     50460
     gccactagat gatggagttt atcacgcaat tgacgtgtac ctgaaggtaa taaagatact     50520
     gtttctaatt ttaaccagtc catgtattaa gattttgatg ctggattgca aattttgcag     50580
     gcgcatccgt ggattactga ttcagagaga gagcacatat gcagactcat gaattgccag     50640
     aagctctcat tggaagctag cacgcacgcg gctcagaacg agaggctgcc tcttagggtg     50700
     attgttcagg ttctcttctt cgaacagctt aggctcagga catctgtatc aggctggttc     50760
     tttgtctctg agaatctaga taaccccgat aaccaacatg gcgctaatgg cggtttactt     50820
     aaacccagag gtgagaacgt aagagaacgg gtttctgagc tggaaaagga gtgtatgaac     50880
     atgaaacaag agctgcataa gctggtgagg acgaagagaa gctggaagaa tttcaccagg     50940
     aagcttaact tcaagaagaa atcagaatgc tgcaagccaa aggatcaagc aacaccagca     51000
     atttgagcaa aatcctctgt tttaaggcag agctactagt attatcttcc cgcttagatt     51060
     agctttgttt ttctggttct tgatgctact ttgttttcaa aagttttcat ctttctctta     51120
     gtatctcgct aagagttttg atgcttttaa gataaaaaca agagctcttt tcagagaaaa     51180
     ttaatttcat ttcttatgca atttcggggt gtattatgtt atgcagcccc ataggaaaca     51240
     atctcagaca caaatcaaca gaagggaaat acaatcaaca aagaatatca tcagcgaaac     51300
     ttaacaaata aagacgaaga atcagagtag tgttcccatc tcagattctt aacaggacgg     51360
     atagtcttta ggcggtggta gaacggaaag ctcaggtgtt tccccgttct cgacgacgaa     51420
     agccatcttc aaaccccaca ttgtatggac ttccaagtga cagtgcataa accaaacacc     51480
     tgcaacaaca catgcattga tcagttgatc tacttatcat atatggtcat catcataatc     51540
     atatatgtgc attgagagat tgatttatac ctggattatc agccctgaat ctgatggcag     51600
     cccaaccacc ggtaggtact ccaacggtgt ttctctcagg cgggtcaacg agattgaact     51660
     tagcaggatc tttcttggga tcaaagtttc caacaccggt tccaacgaca aagaagttgt     51720
     agccatgaag atggaaaggg tgtgactcaa cggttaggag attggtgtct tgcaagacga     51780
     gctcaattgt agtattgaac ttaactcggc taagtcttgt ccccgttgat gttccaaggt     51840
     tagccgtgag cggcacaccg gtgtagttaa acgctttggg tggtcggtct gggaaatcag     51900
     tcctgaaaac acctgagatg ttggagtaat gtgctttcaa gagtgcagtt ttgggcataa     51960
     tgaatgtgat attgtttata gaagctgcga gatttgtccc gttaacacaa gtcgggcacg     52020
     cgttaatgcc tagcccgatc gtgtagaaca atcgcctgtc gacttttaaa ggaacaagag     52080
     ccggaaaatt cggtgtgttg aggctcttga gctttccgtt atagtccaaa gcaaatgatg     52140
     tgtcgttagg caaaggaagc tttggtagga ttggtaagac cgtgtttggt acgcctttgt     52200
     attgaagaat agcggttact gttttgttgt ctacggatac aggagcgtcc ataaacggac     52260
     tagctgccat gaagtagcgg tttggtgacc ggtcggtttt gactaaaaca ttagtggttt     52320
     gacctggtcc gagtaaaatg gctttggttg tgaatggttt agtgtagacc gcatcgattt     52380
     ccaccacggt catgttgtgt cccgcaatcc cgaagaatag ctcgtcgttt aaagctgcgt     52440
     tgataatcct tagaagatat gttttacccg cttcggcctc tatgacgaac gtgtctgaaa     52500
     atatgcatgt acgaaaaaga tttaatgata tctgagatcc ggtccgatcc gataacttac     52560
     ggtttaaaaa ggtttagaac ttttacgttt ctcggaacat ggaaatagcg gtccaggttt     52620
     tccgttaatg gtatgagcat ccgacatcgg aggcggtgca cccaattggt tggcttggtt     52680
     aaccgcagtc tcaacgtctt tgttccacca ttctcctaca gtcaaataaa aaaccaaggc     52740
     aatgagaaaa agaaaaattt aaggatggga ctaaaccgac cggttttgtt ttattttcac     52800
     taaccgagga ttatgttaga ttcttggtat ggctgtggga acggatacgg ttttcccggt     52860
     gcaggcaaga taacaatagc tccgtagacg gtggctcgta gccagaggat gtgtgcgtgc     52920
     caccagaggg tcccgcgttg tccggtcaca ttgaaatcat aaaggtaact ctgtcctgtt     52980
     tggatcggac actgagttat gtatgctgga ccatctgccc aaccgttccg gtactgttta     53040
     agcccatgcc tgttaaacaa accgttatat tttggttcag aaagaatgat taaactggtt     53100
     gcgccggttt gagacttagg aaagagatgt tttaccaatg gatggacatg ttgtattgta     53160
     catggttggt tacgttgatg atgactcgat caccttctct tgcgtaaacc gtcggtccag     53220
     ggaacattcc attaaccgtg acaatcggtt tagcattgca tatccggctt atgttcttca     53280
     cttgaacctg ttccaaattt caaacgttaa tacaacaaac ctacatatct tgggtttaca     53340
     ataaaccggt ttagttaaac cagtataatt tgtattccga attatcgaac acctacatcg     53400
     aattggtact tcttcaccgc cgcatccacc ggagaatagc caagaaacgc aagaagataa     53460
     cagaatagaa agagaaaacc catcttcatc tccggttcaa ttttccggtt tgatgcaatg     53520
     atgagatttt atttgtactt aatcttctac tgcttttggt tatacaaaat gttgtgaaga     53580
     aatagtcgct ggttacaaat gcttatatag agccatcatg aaaagaaaag gttggtgaat     53640
     cactctggat atgaaaataa taatgtgaaa acacacataa aataacatta ttaagaaaag     53700
     cttagagaaa tatagaatcg aagaagaagg cttgtaagca actttctgaa agacgttggc     53760
     gaatcagcgt aacgtttgtt aatattatgg agtaccttcg aagttgatat ctcagctttc     53820
     tatttatgtt tttgactttt cgttaacaat gaaaaataat aatttcggtg tatagttatg     53880
     ttatcatcac aaaagcccta taaatcaaag atgaaactat tcttataata tttcttttta     53940
     taccaaagac ccccaagttc gaatgaatca atctattttc atattttttt tctttcatat     54000
     aaccgatcga attatgtatt tcgagaactc aattagtatc agttaatatt tctattttat     54060
     tttttatttc tgaaaacttg ctttgcagta acatgttgct tagccattcg tttagtctgt     54120
     aaatttattt tctttttgag attatttggt tccaattata tagtgatgtt ttggcgtaac     54180
     ggaaaatgac tgctcttttt gaccattttg tttttgtttt cggccaacga gatcatatgt     54240
     ataattttct aaattaaatt ctcaacaaat gtattttaat ttacaggtac gaaaagtttg     54300
     gtcaaattat ttaaaattta cgctgttgat tagtcaaaat cataaacgtt ggatcatagg     54360
     atcaaacact ttgagtccaa aagcccataa cgaaaagccc atattgtatc atttacaatg     54420
     ttttgtcgcg tataatcata ttataatttt tataatattt tactttgtaa gatcatcgca     54480
     tttgttgtga atgagtggtt tagaatctac tagaaagaga aatgtcaaaa aaaaaaaaaa     54540
     aaaaaaatac cacaagtttt tggaactttt gattgtttgt tattgggtga tactattcta     54600
     tgtttcatct tggtttcaat agctaattta gatatgaatt aggggagaca acacattgct     54660
     ttggccaaag cgaaacgcgt cgtattaacg tgtcttagga cataagtaat atagtcaggt     54720
     ccaccaatga catagtgaca aattttctca cgctttaatt ctgccacgtt ataaattacc     54780
     atccgctatt atgctgaaat atgatatact attgtgctaa tgctacaaat taaccataat     54840
     ttcgctttgt cgtataatct gaaacataat atatctccac gttgtatcat taaaatttga     54900
     gtttttattg caaggagaaa atcaacacta aagcattttt tgtcgacacc caacatatat     54960
     acaccaatac atttgctacc ctaatcatat cattgattgg cacccaaacc aaagaaaaaa     55020
     aacaaaaaat tcatagcttt aaacaatcac gagaaataaa atccaatcaa atcatacgta     55080
     tcttattctt tagcgtcgaa catatatgaa atcattttat gctggcctat ccagaacagg     55140
     aactcctatt atcatcatga acagaaacaa tgtagattca agaaagacaa gattttcaca     55200
     gtataatatc aactttcctt tccgtggcca tgcatataat aataacttct taaattattg     55260
     cggatataga caaatatgca actttttata tctctagggg atagattgtg aggactagtc     55320
     tctaaacttt gacctaaaag gattttcagt tattaaagaa actaactttt aagtaccaaa     55380
     atttaaatat ttgaaattcg aaaatattag ctagcggaaa tgcggaaatt tagtataaat     55440
     agttttataa caatatgcaa ttggtgtttg gatgaccgat tcatcaaata gacaattcag     55500
     cgattcatag accccaacaa agtttggaag attgcaaata tgaagtatat gagaaaaaaa     55560
     tatatcaaaa taaaaaaata gaaagaaaaa aatagagaat gagtaaaaat aattcaccga     55620
     ttactagacc cccacaaaat ttggaagatt gtaaataata tatatgaaat atgaggaaaa     55680
     agagcgtgtg agcaccactt gcatgcgatt gtgctactta accgatgagt tagaatactg     55740
     ttgatagaaa gagctagcca gagagtggaa cactcgtgtg accacgtttc tcacgtgcct     55800
     agcagacttg agaaagacaa tccacactat aaaacataac aaagggttag agaagaagag     55860
     agttaattaa aacacacaaa aaaagagaga gagagagaga gttaactaat aatagacttg     55920
     tcttgtgtaa aaaaaattat tcatttgttt ttccataaga actagaaaca aacaaacgta     55980
     gagaaaaaaa agttgcgact ttgacaagtt agccgaaaca atggagaatg aagagggaaa     56040
     aagagagatg acgaagaaac aaagttcaag gtttaagagc atttgcgtct tttgtgggag     56100
     tagcaatggg aacaaagcta gttatcaaga tgcagccatt gatttggcca aggaactggt     56160
     atgcatatat acaacttgca agttctttat aaaaattctt aggtcttctt taacaatgat     56220
     aaaacgttct gtttttgcaa taacatcatg catgaggatt cttaagaaac cttgtattta     56280
     ttaatacagt ctctaattaa taaagagttt atatgtcaat ttttatttgt tttctttgac     56340
     acaaaccgaa gacaggataa ttaccaaatt cggttttcaa aatttgatga acaggtgatg     56400
     aggaagattg atcttgttta tggtggagga agcataggtt taatgggttt ggtgtctcaa     56460
     gctgttcatg atggtggtcg tcatgttatt gggtacttac tctatgttta ttctatagta     56520
     cttactgcat taaaattctc atcatttttt gttgagagtt atgaaaataa aggtagatag     56580
     gtatggtttt taattcttat tatgatgcag agtcatcccc aagctcctca tgttgcaaga     56640
     ggtattaatt gagttttcat tagaaatcaa tgttcagtgg atctgaataa agaataataa     56700
     caataatggt aatgatgatg ctcttttttg tcactctgtc aatgtctcgc aaacaaactc     56760
     aaagttaact ggagaaacag taggagaagt gaaggaagtt gcagacatgc atcagagaaa     56820
     agctgtgatg gctaagcatt ctgatgcttt cattactttg cctggtaatt tttactctct     56880
     atctctctct ccatcttcta tcttcattac aaataataaa gataaactta tgaaaaatta     56940
     aattattgat attcacttgt gaaaactttg ccactacatt tagagttccc caatgtatat     57000
     gatgctgaaa tattataaag ctagatgcat atatgtatgg tgatgtttta gtgtttgttt     57060
     tttcccctac ataatgtaat gttagtgctt ttttataaaa acctttttat tagtcattat     57120
     agagagcttt aaagagtgcg tttaataagt aataacatgt ggttaatatg atatgtggga     57180
     gattccagga gtcaaagaat ttaaaagaat cacgacaaat agttttgaaa taattaaagt     57240
     gaataatcag aaaaagtcct tgatccatca acatccaaaa gcagtgaaaa tagatgtcga     57300
     caaaggacat ctgtttctta tccaatttaa gaaaaaattt atgttcgcaa tttatatctg     57360
     taagatttat atttctgagc agacattaaa agatcgtaat atgagttgca aaatgttgtt     57420
     tttctttttt gggtagtgct ggtatattat aaagttgaat attctgagag aaacataatg     57480
     gtaactattg tgatgagtgc actaaccttt gacctttgac ttaaaaagta ccaaagagaa     57540
     gagaaggact acttttcata aatcagatgt tgacttttct taagaggtca aaaatgaaag     57600
     tgaaaaaaaa aaaaaatctt cttgagtttt actatacgtg ccacttgact aagtcaacga     57660
     gtcctcactg tcgaagtgtc aatcctcagg tggctatggt acactagagg agctacttga     57720
     agtgataact tgggcacaac ttggtatcca tgataaaccg gtatgtaaac cggtttggtc     57780
     tggtataaga taataaccga cattttgata gagttagcta ttgttttctt tttcttgcag     57840
     gtcggtttat taaacgttga tggatattac gatgcattgc tgttattcat cgacaaagcc     57900
     gtcgaagagg gatttattct tccaaccgct cgacatatta tcgtatctgc accaaccgca     57960
     agagagttgt ttataaaatt ggaggtatat cgatagatga tacggattta accctaaacc     58020
     gaaccataca gtatatccaa gtcatgatcc cgttatgatt tattattttc tagttgaata     58080
     tggtatcact agatcgaata tctaaacatg cattatcttt gtttcaagtt atgtctaaag     58140
     ctggttagac tagaccgagt ttttgtttaa taatcatgaa atttttgatt ggtgtgtatt     58200
     gcaggaatat gtgcctcaac acaagtaata atatgcatca aaactgagct ccaagacgat     58260
     tcataccaaa aaattgtgaa tcgggatgag taaatatttg attatttctt agtcaatcta     58320
     aaagtcggat ttgattaggg agtacaaaat gtaaatttgt tttgtgattt tataatatat     58380
     caactagtgc atttcattta cattttaagt taagttcata tacgtttacg ttagatactg     58440
     taaatttttg gtccgatggt tttggatata aggggctgtt ttgacatttc cgattataga     58500
     atagatcatt tgccttcaat ttttctaaaa atgttacgta gacccaagct aaatttatta     58560
     tttgttgggc caacctaaac actaatatcg attgcaacac ttggttgttg aaagacctag     58620
     ctaccactta tattactaat caatttttct tggtttgaat gtgtagatca aatcgattca     58680
     atttactacc aaaaacattt gtctgagcta caactttcga tctaaagtcc tgagccaagc     58740
     aatctttaat tatagaaaat cattacataa tctcgaattg tttaagttac ttaaaattca     58800
     tatgtctcct cctaaaacat ccccgattcg atcttattct tctggtctcc acgtaataac     58860
     tcacatacat taaaaaaaga acaaaaataa agaaaaccca cttgattaaa cgaaaacatt     58920
     tgttgaatcg aaccaattaa ttgaacaata aacgagttct gatttgtaac tgacgtctca     58980
     tgtttcgagg ttaattacta aaattttcaa atctccaatt cttatgaacc cacccaccat     59040
     gtgttttaag cccaagagag attcagtgaa ccaagaagga aaataattta aattgtccct     59100
     tacactaatg aaaggttatg ttaacaaaaa tccattttat taatagattg atagtactaa     59160
     taaataaata tttggacaca aagcccaaaa gatcacaatc tagttaaaaa aagatcgaca     59220
     agaaagattc tttaagctga tgaatgatct gtaccatgta gctttgttcc ctttttggtt     59280
     aactgcccaa acaacatcaa cgagacttta taaaaaaaaa acttccttat gaccaaacta     59340
     aataactgaa attgatttat tagtcaaaac atattaaaga acttatttgt atgatatcat     59400
     tatacattcc atatgtaact gaaatatgac tatcttgact ctttgaagaa ttctgacttt     59460
     ttttattcag tcaaactttt aaattgtgtt ggttactcat cggtacggat aaaaaaattc     59520
     gtatgtgtta tttcaaaagt acttgaagaa tattgtttct atatatattt atagtgttat     59580
     aaaaaaacaa gtgtggtctc tatgttatgg ttcattgaac atatacatca acataggact     59640
     gagaggagcc catgttcctt tcattgatgc aaaattttag tttcttgtgt tttaatttgc     59700
     ttcctatcca atgtacatgt atatatactt tcacaagaga atatggataa tgttgagtat     59760
     gttaaatata tagtgacaag ttacataaaa aaagcctaaa gaaatcaaat tggaaaaaat     59820
     agtaaggtac aatgtatggt tatcgaaagc ccaagctgta cttccattga tgtaggagat     59880
     gattaggaac acgtggatta tatttgacca aaaatagtag aaattctatt tatatttgtt     59940
     ttcttctttt ggttttgggt ttgattttgt gatttggata gttcggttaa ggatggtttg     60000
     atcaatcaat ataaccatac taaaatatga ttcagttaac taactatagt aactgtttct     60060
     tcgttagtaa aatgatacat ttattggaat ctattgacaa atcttaatga cttattataa     60120
     ctggtgataa caaaatctag ctattatttt gtatccaact acatattttg tataaaatgg     60180
     aaattcgtat atgatatttg tttagtttaa aagtagagtg tatttgtttt ttcaatgatg     60240
     atttaatgaa atcaagctct tagttgagat caaaagacaa ataaaacaaa atgttttttt     60300
     ttgttttgtt tcttttctat ttgagggaag gccatgaatt cttatttttg acaaatagtt     60360
     gttctatgca attaatattg atgtctaata catatacagc agaataaata aaaacttgct     60420
     atataaagac gtattattta tagcattctg tggagtataa tgtcgaatcc tgttctcatt     60480
     tccgatttta catatttatg gtactaacgc cttcatttat ttttccattt tcgttagtca     60540
     acaacttcag cttttgataa cgcctaattg tatcatcaac tttagttagt tttctcaaat     60600
     aacgtcattt tcaaataaag tttttgattt ctcttttatt atatttatgc aaaaggaaaa     60660
     ttataatttc agtattttgc agaacgctga aatgtataat agaacctatt catgtatttt     60720
     tgtaaaattt taaagattgt tttaatacta aaataagtaa atcattaaaa aaattcctag     60780
     acattggtct ctaatataag ataaatagat ctaaattatg tttggatttt aattctaata     60840
     aaaaggtagc caaaagttat atatacaata tttaaacaat tttatttgtt taagatttga     60900
     attttatagt atgcgagaat cgcgtaaact tttctcgaat gtaacaaaaa atttcaaatc     60960
     ttctcgacac atgtaatctt ttgcgagtta gaagatttga ttccttattt tttgttcgta     61020
     ttcttaaagt tagtcacgtt tatattattt ttcgctttgt aaccgtccct ttaaattttt     61080
     aataaaaatt aaaaaaattg ctagaaaaca acatttttgt attactcaaa tcaaaagtac     61140
     aaaaataaat ttagctagcg tttcacaaaa tcaagtaaaa taatctccat ttgaaactcc     61200
     ataatcaagc tgtttgatgt attattatta catgtaatga ggagaaagag gggtcgagaa     61260
     atttaaagta ataataattc tcttcttcgt ccatggaata aactacgatt agtttaaaaa     61320
     gattaataaa gatggattaa agaaactata tgttaaacct ggaaaattta tttaaaaaga     61380
     cgttttttta gctataagaa aaaaaagaat aataccttta tttttacatg ttatttacaa     61440
     gtaataattt tttttttctc tctctctctt tgaaggtggc acgagcaccc ataaccttca     61500
     gacctataga tacaaatatg tatgtatacg ttttttatat ataaatattt tatataattg     61560
     atttttcgat cttcttttat ctctctcttt cgatggaact gagctctttc tctctttcct     61620
     cttcttttct ctctctatct ctatctctcg tagcttgata agagtttctc tcttttgaag     61680
     atccgtttct ctctctctca ctgagactat tgttgttagg tcaacttgcg atcatggcga     61740
     tttcgaaggt gacttctttc aaaaacccta atcctctgtt ttttttttta ttttgctggg     61800
     gggctttgta cggactttca tgggtttttg tagcttttcc ctcggctttt gcgcaaatga     61860
     gactttctgg gttttttttc cagcttttta taatttcatc aggtggatcg aattcgtagt     61920
     ttcagcttag atctctctcc ctcttcatta tctggacttt ccagacttgg agttcttcgg     61980
     gattgttttc ggtttctggg ttttgtttta attgcgagat ttaagctttt ttctttttta     62040
     ctactgtact tggtttgtgg ttgacctttt ttttccttga agatctgaat gcgtagatca     62100
     tacgggatct ttgcattttt gttgcttttc gtcagcgtta cgattctttt agcttcagtt     62160
     tagttgaaat ttgtattttt tttgagctta tcttcttttt gttgctgctt catactaaga     62220
     tcaattattg atttgtaata ctactgtatc tgaagatttt caccataaaa aaaaaattca     62280
     ggtctgaagc tgatttcgaa tggtttggag atatccgtag tggttaagca tatggaagtc     62340
     tatgttctgc tcttggttgc tctgttaggg cttcctccat ttggaccaac ttagctgaat     62400
     gttgtatgat ctctctcctt gaagcagcaa ataagaagaa ggtctggtcc ttaacttaac     62460
     atctggttac tagaggaaac ttcagctatt attaggtaaa gaaagactgt acagagttgt     62520
     ataacaagta agcgttagag tggctttgtt tgcctcggtg atagaagaac cgactgattc     62580
     gttgttgtgt gttagctttg gagggaatca gatttcgcga gggaaggtgt tttagatcaa     62640
     atctgtgaat tttactcaac tgaggctttt agtgaaccac gactgtagag ttgaccttga     62700
     atcctactct gagtaattat attatcagat agatttagga tggaagctga aattgtgaat     62760
     gtgagacctc agctagggtt tatccagaga atggttcctg ctctacttcc tgtccttttg     62820
     gtttctgtcg gatatattga tcccgggaaa tgggttgcaa atatcgaagg aggtgctcgt     62880
     ttcgggtatg acttggtggc aattactctg cttttcaatt ttgccgccat cttatgccaa     62940
     tatgttgcag ctcgcataag cgttgtgact ggtaaacact tggctcaggt aaacattttt     63000
     ctgatctcta aagaacaaac tttttaaaat aacaaactgg gctctgtggt tgtcttgtca     63060
     ctttctcaaa gtggaattct actaaccacc ttctctattt ttctaacatt ttaatgttct     63120
     ttactgggac agatctgcaa tgaagaatat gacaagtgga cgtgcatgtt cttgggcatt     63180
     caggcggagt tctcagcaat tctgctcgac cttaccatgg tagttactta caatctttgc     63240
     tgttcttaat ttttttatta tgtgataaaa ttttgattcc tctgacttga gcttctctat     63300
     tataaacagg ttgtgggagt tgcgcatgca cttaaccttt tgtttggggt ggagttatcc     63360
     actggagtgt ttttggccgc catggatgcg tttttatttc ctgttttcgc ctctttcctt     63420
     gtatgactgg tcttcctgtc ttgttttttt tctccacgtt cttgaaatag cattattgga     63480
     aattagctga catgcataca atttctgaca ggaaaatggt atggcaaata cagtatccat     63540
     ttactctgca ggcctggtat tacttctcta tgtatctggc gtcttgctga gtcagtctga     63600
     gatcccactc tctatgaatg gagtgttaac tcggttaaat ggagagagcg cattcgcact     63660
     gatgggtctt cttggcgcaa gcatcgtccc tcacaatttt tatatccatt cttattttgc     63720
     tggggtacct tttttctctt tatatgtatc tctcttttct gttaagaagc aataattata     63780
     ctaagcagtg aacgctctat tacaggaaag tacatcttcg tctgatgtcg acaagagcag     63840
     cttgtgtcaa gaccatttgt tcgccatctt tggtgtcttc agcggactgt cacttgtaaa     63900
     ttatgtattg atgaatgcag cagctaatgt gtttcacagt actggccttg tggtactgac     63960
     ttttcacgat gccttgtcac taatggagca ggtttgttct gacggtttta tgttcgtatt     64020
     agtctataat tcatttttag ggaaaatgtt cagaaatctc tcgtgattat taattatctt     64080
     gttcttgatt gttgatcaca ggtatttatg agtccgctca ttccagtggt ctttttgatg     64140
     ctcttgttct tctctagtca aattaccgca ctagcttggg ctttcggtgg agaggtcgtc     64200
     ctgcatgact tcctgaagat agaaataccc gcttggcttc atcgtgctac aatcagaatt     64260
     cttgcagttg ctcctgcgct ttattgtgta tggacatctg gtgcagacgg aatataccag     64320
     ttacttatat tcacccaggt cttggtggca atgatgcttc cttgctcggt aataccgctt     64380
     ttccgcattg cttcgtcgag acaaatcatg ggtgtccata aaatccctca ggttggcgag     64440
     ttcctcgcac ttacaacgtt tttgggattt ctggggttga atgttgtttt tgttgttgag     64500
     atggtatttg ggagcagtga ctgggctggt ggtttgagat ggaataccgt gatgggcacc     64560
     tcgattcagt acaccactct gcttgtatcg tcatgtgcat ccttatgcct gatactctgg     64620
     ctggcagcca cgccgctgaa atctgcgagt aacagagcgg aagctcaaat atggaacatg     64680
     gatgctcaaa atgctttatc ttatccatct gttcaagaag aggaaattga aagaacagaa     64740
     acaaggagga acgaagacga atcaatagtg cggttggaaa gcagggtaaa ggatcagttg     64800
     gatactacgt ctgttactag ctcggtctat gatttgccag agaacattct aatgacggat     64860
     caagaaatcc gttcgagccc tccagaggaa agagagttgg atgtaaagta ctctacctct     64920
     caagttagta gtcttaagga agactctgat gtaaaggaac agtctgtatt gcagtcaaca     64980
     gtggttaatg aggtcagtga taaggatctg attgttgaaa caaagatggc gaaaattgaa     65040
     ccaatgagtc ctgtggagaa gattgttagc atggagaata acagcaagtt tattgaaaag     65100
     gatgttgaag gggtttcatg ggaaacagaa gaagctacca aagctgctcc tacaagcaac     65160
     tttactgtcg gatctgatgg tcctccttca ttccgcagct taagtgggga agggggaagt     65220
     gggactggaa gcctttcacg gttgcaaggt ttgggacgtg ctgcccggag acacttatct     65280
     gcgatccttg atgaattttg gggacattta tatgattttc atgggcaatt ggttgctgaa     65340
     gccagggcaa agaaactaga tcagctgttt ggcactgatc aaaagtcagc ctcttctatg     65400
     aaagcagatt cgtttggaaa agacattagc agtggatatt gcatgtcacc aactgcgaag     65460
     ggaatggatt cacagatgac ttcaagttta tatgattcac tgaagcagca gaggacaccg     65520
     ggaagtatcg attcgttgta tggattacaa agaggttcgt caccgtcacc gttggtcaac     65580
     cgtatgcaga tgttgggtgc atatggtaac accactaata ataataatgc ttacgaattg     65640
     agtgagagaa gatactctag cctgcgtgct ccatcatctt cagagggttg ggaacaccaa     65700
     caaccagcta cagttcacgg ataccagatg aagtcatatg tagacaattt ggcaaaagaa     65760
     aggcttgaag ccttacaatc ccgtggagag atcccgacat cgagatctat ggcgcttggt     65820
     acattgagct atacacagca acttgcttta gccttgaaac agaagtccca gaatggtcta     65880
     acccctggac cagctcctgg gtttgagaat tttgctgggt ctagaagcat atcgcgacaa     65940
     tctgaaagat cttattacgg tgttccatct tctggcaata ctgatactgt tggcgcagca     66000
     gtagccaatg agaaaaaata tagtagcatg ccagatatct caggattgtc tatgtccgca     66060
     aggaacatgc atttaccaaa caacaagagt ggatactggg atccgtcaag tggaggagga     66120
     gggtatggtg cgtcttatgg tcggttaagc aatgaatcat cgttatattc taatttgggg     66180
     tcacgggtgg gagtaccctc gacttatgat gacatttctc aatcaagagg aggctacaga     66240
     gatgcctaca gtttgccaca gagtgcaaca acagggaccg gatcgctttg gtccagacag     66300
     ccctttgagc agtttggtgt agcggagagg aatggtgctg ttggtgagga gctcaggaat     66360
     agatcgaatc cgatcaatat agacaacaac gcttcttcta atgttgatgc agaggctaag     66420
     cttcttcagt cgttcaggca ctgtattcta aagcttatta aacttgaagg atccgagtgg     66480
     ttgtttggac aaagcgatgg agttgatgaa gaactgattg accgggtagc tgcacgagag     66540
     aagtttatct atgaagctga agctcgagaa ataaaccagg tgggtcacat gggggagcca     66600
     ctaatttcat cggttcctaa ctgtggagat ggttgcgttt ggagagctga tttgattgtg     66660
     agctttggag tttggtgcat tcaccgtgtc cttgacttgt ctctcatgga gagtcggcct     66720
     gagctttggg gaaagtacac ttacgttctc aaccgcctac aggtaacaaa aaccgcagta     66780
     gttcattgaa aatcacagtt ttgcagtttg aaaatattga catgtatgga tttaaacagg     66840
     gagtgattga tccggcgttc tcaaagctgc ggacaccaat gacaccgtgc ttttgccttc     66900
     agattccagc gagccaccag agagcgagtc cgacttcagc taacggaatg ttacctccgg     66960
     ctgcaaaacc ggctaaaggc aaatgcacaa ccgcagtcac acttcttgat ctaatcaaag     67020
     acgttgaaat ggcaatctct tgtagaaaag gccgaaccgg tacagctgca ggtgatgtgg     67080
     ctttcccaaa ggggaaagag aatttggctt cggttttgaa gcggtataaa cgtcggttat     67140
     cgaataaacc agtaggtatg aatcaggatg gacccggttc aagaaaaaac gtgactgcgt     67200
     acggatcatt gggttgaaga agaagaacat tgtgagaaat ctcatgatca aagtgacgtc     67260
     gagagggaag ccgaagaatc aaaactctcg cttttgattg ctcctctgct tcgttaattg     67320
     tgtattaaga aaagaagaaa aaaaatggat ttttgttgct tcagaatttt tcgctctttt     67380
     tttcttaatt tggttgtaat gttatgttta tatacatata tcatcatcat aggaccatag     67440
     ctacaaaccg aatccggttt gtgtaattct atgcggaatc ataaagaaat cgtcggtttg     67500
     aaatgttaaa tctcctaaac cggatctctg cacgtagctg acacatcgac gctagattac     67560
     tgacacgtgt ccttatcaat atttcttctc gaaacgtctt actgtttcat aaagtccttc     67620
     aaatttctgg ggaactaaga aaatccagca gagtaactaa tccaatgggt tatgtaatct     67680
     acatatcgtt cccggcgatt cttctccttc tgatcgtcgc tatcgccttt tatctcatcg     67740
     gacgaaaaat cggccggaga gaagggattc aatcaacgtc gcagttacac tacggaccgc     67800
     cgttggctaa ttttccggca cctgcaccac cgcataaagc tatggagaag ccaccggagc     67860
     cggtttagtg tatgtatgat gacgtaataa tacttacgta ttacgtaaac gttctatata     67920
     tgtagtttgt gtgttaaata agatgtaatt gggccgatgc tgaaaccaat tttaaaacaa     67980
     ctctttattg ggcctggggt ttaaggaaac acttcgtgcc gtttaaattc cgtactcacc     68040
     taatgcaacc tagaaactac gcagcgtttt gacggaagaa gaaatattcg cttcttcttt     68100
     tacaactttt gtcccacaac gcagaaaagt cctctctttc tctctctcga ataataattt     68160
     ttcatttgct gcgtcctttt ggtgcttgaa gcgatgacca tggcagcaaa tctagcgcga     68220
     cggctgatcg gaaaccgatc gactcagatc cttggagccg tgaactctag ctcaggtgcg     68280
     gctagttctg tcgctagggc tttctgctcc tccaccactc cgatcaccgc aactctcttc     68340
     cctggcgatg ggatcggtcc cgagatcgcc gaatctgtca aaaaggtccc tcatcctaat     68400
     ctcttttctg cgcagaattt cgagttctgg aagtcatagt tacgagataa ttgtttgatt     68460
     gaattttgta cgataatttg tgggaattcg gcaattttgt tgatagtttt tgcgttttgt     68520
     actgatccag gtgtttacaa cagctggtgt accaattgag tgggaagaac actatgttgg     68580
     gactgagata gatccgagaa cacagagttt cttgacatgg gaaagtctcg aatctgtgcg     68640
     tagaaacaaa gttggtttga aaggtccaat ggctactcca attgggaaag gtcaccgttc     68700
     tttgaacctg actcttagga aagagcttaa tctatatgcc aatgttagac cttgttacag     68760
     tcttcctggt tacaaaactc gttacgatga tgttgatctc attaccatca gagaaaacac     68820
     ggaaggagaa tacagtggcc ttgaacatca ggtttagttt gttttaagtc tattgatcga     68880
     atatttcagg ttagttcttc taataaatga ttctaatgat ggttttgttt tctcctgacg     68940
     catataatag gttgttagag gtgtggtgga aagtcttaaa atcattaccc gtcaggcgag     69000
     tttgagagtt gcagagtatg cttttctcta tgccaagact catggaagag agagagtttc     69060
     tgctatccac aaagccaaca ttatgcagaa aactgacggt ctctttctca aggtctgccc     69120
     gttttataac tccaagcatt tcttatacgg agggatcaaa gcaatgattg ttatttctgc     69180
     tagttttttt ttttttacat tttgttctga gaccattttt attttgcttc cgtttttcag     69240
     tgttgtcgtg aggttgctga gaagtatcct gagatcactt acgaggaggt cgttattgac     69300
     aactgctgta tgatggtaag ctatgacacc gaatctacta ttttttcgtt aattaagtta     69360
     gtggtcggga ctcgggatca ccttgtagat ttagaagttt ggtttcttag caacttgtat     69420
     ttgagttctg cttttccact gtttttacat gtggaatatg cgactgataa tcttgagata     69480
     cctgcagctt gtgaaaaacc cagcactttt tgatgtcttg gtgatgccaa acctgtacgg     69540
     tgacattatt agcgatctgt gtgccggatt ggttggagga ctaggattga ctccaaggta     69600
     aaaacacttg ttccttcatc ttgtgtaata gtgatcttta gtatgattat gagctacatc     69660
     atcttaaggc cttattatct ttgacgcagt tgtaatattg gagaagatgg tgtagccctt     69720
     gctgaagcag ttcacggttc tgcacctgat atcgctggaa aggttggtcc ttcaaacaat     69780
     atatcattcc aatttcatca tttacgggct aaagagtatc atttatgcat ccaatgttga     69840
     aagattaata tgtgtgattt ttaaatttgt tgttgtcttt ctgttttggg tgatgtagaa     69900
     cttggcgaac ccaaccgcgt tgcttctgag tggagtgatg atgttgcgtc acctgaagtt     69960
     caacgaacaa gcagaacaaa tccacagtgc aatcatcaac accatagcag agggcaaata     70020
     cagaaccgcg gatcttggag gtagttcgac caccacggaa ttcacaaagg caatctgtga     70080
     tcatctctga acatcgtaaa atccaattct ttatcgaatc ttcttttggg agcctttttt     70140
     atagcctcga attcttcttg ttttcttgtt ttacgattag aataaaagaa aaagcaaaaa     70200
     aacggctctt catgagtttt gaagttattg tttctgcctt aaaatttctc tgccgtaagg     70260
     caagaagatt cataacactg gaaaaagtga tgttctttct gaatcgatca gaagaatttt     70320
     gttttgttgc ttgaattgtt tacatactct tataacttca atcagtttat caatttcata     70380
     catacatcca aacctttttt tttcttttca ctcgtagaat aaaatgagta aattactatg     70440
     attatgaatg aaatgacaaa atcatcaaat gaagaaaact catacatttg taaaccattt     70500
     caatacaaat tagtcggtcc acaaagaaaa gagtactaat ttagtttaaa aattatactt     70560
     aaaaaaaatc taaaaagaga ataataatgt gtcgttggtg caccaacttc ccctcgagct     70620
     aagattataa aggcaagacg cttcactcag cagcagtaac taaacttgcc tccaaaaacc     70680
     aatcccagat ctgaatctca acctaaacct cagattcatc atcatggctt cttcttctaa     70740
     ctacgatgga atccttctcg gtatgggtaa cccactcctc gatatctctg ccgtcgtcga     70800
     cgacgaattt ctcaccaagt aaataaactc tcagatccct ctttttctat ttgtttccaa     70860
     ttccttttgc tgtatccatt gtcgctatct ctctctggga ttttggtttg aatctagatt     70920
     tgatagtttg attcttcttc agtggcataa actctgtgat ttgtgtgcgt tttttttgtt     70980
     tatgttgttc tctaatcgtg ttgacagata cgacatcaag ttgaacaatg cgattctcgc     71040
     ggaagacaaa catttgccca tgtaagtatt gatttatgct ctgcttttgg tatttgatgg     71100
     gttaaaatta ggtgtggtaa tcaagagtgt tgatcatgtt atttaaactt tcaagtagag     71160
     attgattcaa tgcttcagaa gtctggattg tttcagctaa atatctcatc ctctctttat     71220
     aatatagact atatagttga tggtttgaga aacagaaatt cactttgaaa ctttttttgt     71280
     ttcttttttt aaaaggtatg atgagatgag tagcaagttc aatgttgaat acattgccgg     71340
     aggtaattaa tcttttgtcc tgtttgacga tcctgtaact cttttatcgt ttatacgttg     71400
     acaagattat gatatattgg ttattctatt ctttctcagg tgctactcag aactcaatca     71460
     aagtggctca ggtagattct tttgcatttt tcttgcactt tttatgggtt ataagtaacc     71520
     actgctaaaa atcaaggttt ttttttttta ctttctggtg gctgcagtgg atgcttcaaa     71580
     ttcctggggc aaccagttac atgggatcca ttggaaagga caaatatgga gaggccatga     71640
     agaaggatgc tacagcagct ggtgttaatg taagctgtgt ttcctggttc ttctttggtt     71700
     ttcttgtttt ctgtttgagt caatgcgcag ctgctgttcc gtttgtcttt tgaggatagt     71760
     atgaagttat tgttgaaact gaattcggat tttgtaatca aagtgcatta aaatgacact     71820
     atgcttttgt atcaggttca ctattatgaa gatgagtcgg cacctactgg aacttgtggt     71880
     gtctgtgttg ttggtggaga aaggtctctt attgcgaatc tttcagctgc aaactgctac     71940
     aaggttgatc accttaagaa gcctgaaaac tgggcattgg gtaaaattct tttcccatcg     72000
     ttgcatcctt ttaacacttc tgtattatct cttcgtgatc tgactgatca aatgtgtatt     72060
     gggtagttga gaaggccaag ttctactaca ttgctggatt cttcctcaca gtatcgcctg     72120
     aatccattca gttggtatct gagcacgctg ctgcaaacaa caaggtaatt aagacatggt     72180
     cctccatttc atgagactct gtttcagcag aatcttttat ttgtttacaa ctgcttcttt     72240
     tattgacatc ctctacatat tcacctatcc ttcaggtgtt cacaatgaac ctttctgctc     72300
     cattcatctg tgaattcttc aaagatgtgc aggagaagtt cttgccgtaa gctctcccta     72360
     attttatttt atccattaca gatgttctga ttgcgtaaat gtactgaata acactctaca     72420
     ttgatcttac agatacatgg acttcgtttt cggcaatgag acagaggcaa gaaccttctc     72480
     tagggttcat ggctgggagg taagaagttt ctctagcacg actaaatttc agcaggctgt     72540
     tctgttttgt atagctgaga taagaattaa ccatttatat gtttatatat gtatagactg     72600
     aagatgtcga acaaatagcc atcaagattt cacagcttcc caaggccaca ggaacataca     72660
     agaggaccac tgtgattaca cagggcgctg atccagtggt tgttgctgaa gatggaaagg     72720
     tgaagaaata tccagtcatc cctctcccaa aggagaagct ggttgacacc aacggtgcag     72780
     gtactaattt tgataatcga aagaccgagt tgtaaccaaa cctacattca actttatgct     72840
     tattattatt atactagata gaaactgaca tgatcataga ataagctgat cctttagcat     72900
     ttcaaaattc aaacgaactt tctccttgaa actgatacaa aacatgttct tctctgtgtc     72960
     atagacagaa ccaataccga ctatttttgt tgatctctct tacaggtgat gcatttgtgg     73020
     gaggatttat gtcacagttg gtgaaagaga aatcgattga ggaatgcgtg aaggctggat     73080
     gctatgcgtc gaacgtggtg atccaaagat ctggctgcac ttaccctgag aagcccgact     73140
     ttaactaaac aattgggtta ccctcagttt tgtgatatct tccaaataaa acaacctttg     73200
     aattattatt gcttgagtgt actttttacc acttttattc tcattattat tccctaatta     73260
     atattaccac cataggttta gacaagacaa gtcatgttta atcaatgaag gcttcgatga     73320
     gaagattata tgatatctac catcagctaa tacctaaaaa tggctcattt cacaaactcc     73380
     ttaaatggat cctctaacat tattaaaaaa acctaaacgt tagtagtaga accatcttct     73440
     tgaatcaaag actcataacg aataacgagg agaagcgcaa cggaggacct cgagaaagag     73500
     agtttcgtca caagcaatac aaagcttgga atctccggaa gtgaaatcgt cgtaagcttc     73560
     atcttttgat tgatcaagca aagctctgaa gatgggatcg tgaagcaacg tgatctttat     73620
     aacgaacctc ttataagttt cctcatcttt accaacgtac accacaaggt gtccctttgg     73680
     tacgtcatgt ggtatatgat attgatcctt aggatttccg gtggcgacgc ggtgtttggc     73740
     aactctgctt gacatttgct tccatgcctt tgcgatcagc ttgctcttct tcatcatgtt     73800
     tatgagagag atgagaaaga gaaagagaga gacgtttttg gggtttagta ctagtgccgt     73860
     acatgggtat ttatacacaa agtcactaac ataggtctac tatatatata ttcaatgtat     73920
     gtattatatg gatgaatagg tatgggtaat gattattttt ggaccatgtc gtctttacaa     73980
     ataatacatg atctacatta gttatcatga aaaacaatac attccattca atacatatat     74040
     attaccaaga aatatgtata aatatttgga acgtcattat caatttagtt ttgaaaataa     74100
     gatgtctttg ttcatcatct tattttattt gttttttggg gtcaactacg gccaagctgt     74160
     acttacgaca tacgaaatcg tacgaacatg catcttccct caaacaatgg ccaatgggct     74220
     ttcgctttaa tcattgcttc gttttgatta tttggtttct ttaaattttc atgaatacaa     74280
     aacaaatctt tatcggcatg gcatgcacat tggcactcaa ctatttggca tagagataat     74340
     gtatgagtgt cgtcacagta gtagaatcac ttaaagtgat ttgcataact ttaacaatta     74400
     gtagaatcac tttaacgatg ttatttaacg aaagcagaaa ttctttagag aagagctaaa     74460
     atttgaaaga tttgtttttc ttataaaaag gagacgcatt ttattcaagt tgtgaaattg     74520
     tgggtcccag ggttcgatca aatgctggag aaagataaga tttaaaagat ataagaaaag     74580
     ggataagatt cttggacaaa gtgcaattcc acttacgtac catacatcgg gatatgtaac     74640
     tcacatatta cacaaattat ctaatcctaa ctgatttgtt atgctggata tatccattgt     74700
     gatctgtcac tggtgattta ccaaaatcac aatacttttt aaataatatc atcaataatt     74760
     agactgagta gttcagctgt atatcatcta atacaaacga tgttaatgct ggatctcatc     74820
     atcattttga tgtatcacag gtgattacca aaatcttaac gtacatatca tgccatcata     74880
     cgtaagcatg ttcgaaattg gccattataa attctttata attcattagg gattcatgat     74940
     gtcttggtgg tcgaccatat gtttactttt caagaaatca ataaacgaat atagctagtg     75000
     gatatctaac acttgcgcat aaacatgaaa tgttttacag acaaatacgt tatacatatt     75060
     taagattgta tacacctata taatacatgt acgtgtatat atatgtaatg attgtatata     75120
     catgtacgta tatatgtata tcattacaaa tcaggccggt tggagattct gagacgaccg     75180
     attcatcccc cccatagaga cagcccggtg cttcatccca ttgcttcagt gtctctcttt     75240
     aaggaaacga gagattatta gccttcggat cagaaaatta gatttattcc tagccgtttg     75300
     atgtacatga cctccagcta ttgcacgtga aatttaatgg taagttttaa ccagaaacct     75360
     acaaaattgt gtgggtgata tttaattgta agttataaca aaaaaaaaaa aaaaattgtc     75420
     ctcgtcagca tggtctagtt gtagtgatca gataagagat gttgtaataa ggtatccaag     75480
     gtttgataca ccctaaaaac tactccacaa acgtgtgggt gtcaggaatt ttcacatagc     75540
     tcatactaat cccaagatca gtcggatttc atggcccgtt gacccgagaa ctaactaggg     75600
     aaaaaagacc tcgcgacctg gctcagagct cagtaaaaag gaacatgttc gattaaaaag     75660
     cttcatcgcc tcggagctca gggagaacca tcattcttat aggcatccct tgttcttctc     75720
     taattcagca gaaacatgtt cgatttgtga tgaatcagga aaagaaacgt taacatgtga     75780
     tgaatgcgaa tttttcttgt gtctttccat ataaggtgag atacaagaat gatgagcatt     75840
     ttactcaact ttacatatga agaagacaca aatggagact actcgtgcga agcgatcatt     75900
     gtgaggaatc aaccatattc tatggatgca aagaatgtga agtggcactc catattaaga     75960
     aatatgttaa gattcaatct aaaaaaaata acatagccgt agggcaaaca gattatttca     76020
     tatcaataaa aagagatttt acggttttta gtttgccaat ctttgctttc aattattatt     76080
     cattgaccaa attgtcttcg tttttttctt tttgttggtg tcgcactata catatattct     76140
     atcaatataa atattttaat ctaaacgtcg tctcaacaaa cctttgactt caaatttgtt     76200
     cttcctctta ttagtcttcg tcatattttc ttccttcttc catcttttag ttctgataag     76260
     ttaacatttt cataagacct caaaaatagc tcctacattt gttatcttcc ttttcaagtc     76320
     aacaatattt ttttttgttc tgttatcaaa gactccttct tttggtgatt aaactctgtt     76380
     caacttctga aaaaaagttt tgatttttct tttgtctgta gtacacaaag atctcaaagg     76440
     tgagtttgta atttcctcga aagttacttt acctttcttc tatcacgaag ttcatacttc     76500
     tttagattct tgtttaggga agacccaaag gtttaatctt tagtataaat cttgcaagtt     76560
     aggccaagaa acattctttc cctaactttt caaaattagg gttcgttaca gaatttgggg     76620
     ttttcttgaa tctctaattt gattcgacaa ttcatcaggt tccttgatgt tacagaattt     76680
     gatcctttgt ttttgattag ttggattcaa agatcaaatt ttagaatgaa gtgaacaaat     76740
     gaatagtgca tttgattctc agtcttctag tgtagtcaag tggtttagac ttagaatcat     76800
     tgtgatgatt gttttgatgt aaatgctcca atgaactaaa cttgctcact gtacttcgtt     76860
     tgtgtgtata tcagtggagg aacctcggtg ttttaacatc tttacgaaga tgaaatgctt     76920
     cttattccct cttggggaca agaaagatga acagagaagc cctaaaccgg tttcaccaac     76980
     gtctaacttc agtgacgtaa acaaaagcgg ttcagatttc agtccccggg atgtttctgg     77040
     aacgagcaca gtatcatcca ctggtaggaa ctcgaacact agcatgtcag ctagagaaaa     77100
     caaccttaga gagttcacta ttggtgatct taaatctgcc acaaggaact tcagcaggtc     77160
     aggtatgatc ggggaaggcg gttttggttg tgtcttctgg ggaacaatca agaacttaga     77220
     agacccatcg aagaaaatcg aagtcgcggt taaacagctc ggcaaaagag ggttgcaggt     77280
     aaaggtttct tcatcttttg ttcacagaat ttgttagtgt tggttcatca atgttttggg     77340
     ttttgcaggg tcataaagaa tgggtgactg aagtgaactt tctcggtgta gtcgagcatt     77400
     caaacttggt gaagttgctg ggacattgtg cagaagacga tgaacgtgga atccaaaggc     77460
     ttttggttta tgaatatatg ccaaaccaaa gtgtcgagtt ccatttatct ccgcggtcac     77520
     cgacagtact tacttgggac ctcagattga gaatagcaca agacgcagct cgaggtttaa     77580
     cataccttca tgaagaaatg gactttcagg taaaaatgaa catgaaatcc tctgtttctt     77640
     cacttcatca gttaactaaa atgtgttttc tttttgtaga taatattccg tgatttcaag     77700
     tcatccaaca ttctactaga cgagaattgg acagcgaagc tttcggattt cggtttggct     77760
     cgcttaggtc cttcaccagg atccagccat gtttctactg atgtaagttt tgtacatttt     77820
     cacttgactg gttataagaa atcgttacaa gatcaagaaa gttgtaattt ttggggctta     77880
     caggtagtag gaacaatggg atacgcagct ccagagtata tccaaacggg tcgcctcacg     77940
     tcgaaaagcg atgtgtgggg atacggagtt ttcatctatg agctcattac aggaagaagg     78000
     ccactagacc ggaacaagcc taaaggagag cagaagcttt tagaatgggt gagaccttac     78060
     ttatccgaca caaggaggtt ccggctaata gtagacccga ggctcgaggg aaagtacatg     78120
     atcaagtcag tgcagaaact cgcggttgta gccaaccttt gccttactag aaacgcaaag     78180
     gcgcgtccaa agatgagcga ggtgttagag atggtgacaa agattgtgga agcttcatcg     78240
     cctgggaatg gtggcaagaa gccgcagctg gttccactaa agagtcaaga aacttctaga     78300
     gtcgaggaag ggaagaataa gaaggttctt gatggtgctg aaggaggttg gttagaaaag     78360
     ttgtggaacc caaagaatgt gagagcttgt tgattcgggg tctacgtcag aaacaaatta     78420
     gtgaatttca atgcctttgt ttaaatactg taatttaaca aacttatgag ttttcttaca     78480
     ttccattttt tggtgtgatt attaaacgat ttatttgata ttcgagtgat ttcgaagatt     78540
     tttgcagaac ctaatggcta tttgggcctt tggtcacaat cttaataatc ttatgataag     78600
     cccattataa aggtcataac ggtctaaatc ggtttaaact aggtaatctc ttgcccacct     78660
     tttggaattt cccaataata agtggaataa ttttgataag attgcattca actcatgtgt     78720
     actaacaatg gcaaacaatt tgacttttga agcattgatt ttggctgaaa acaggggaag     78780
     ccattaaatt tagagatcaa aaagaagaat ttcataaaaa agtaacgtga aaagcgaata     78840
     gtaggcaaat aaaattgtaa atagcttaat tggtgtaaga aaaaaaaaga atcctgattg     78900
     cttttagtgt aaacgaacag aggaaaacaa aactcaattg agagttaatg atatcatatc     78960
     agtgtcaact aatatagtaa gttaagaaaa aaattcatat aaaatctagt tatagcatta     79020
     tcaaaacata aaatatttag taagcatttt atgtcaaaaa taatatatac tcctgagtcc     79080
     ttgcgtaatc gaactctgaa aaaacccttg atgcattcga aagcatgtgt cattttgtta     79140
     catctcttgg attatacgaa ccactaaata ctcttatgca gtcacattaa tcagtaatca     79200
     cgtattactt tattttatca agtagtatta acatagaatt cttatatagt tatatggcat     79260
     gattgttttg aacatagaat tcttagtaaa ccacgcgcta atatatttgg ttctcaacta     79320
     tgattgctaa aagaatgcat gttgtttggt agatttgctc aatgaactac cacaatagta     79380
     acatttattc atattctaac tatataaact aatggattga cccttttgaa atggactatt     79440
     ttagttataa tattcgatta attgacatgt aacatataat atgcagagag gataattgaa     79500
     aactaattaa aaaaaaaaga gtgttgctac ttgttaatga cttcagcata atcttcacaa     79560
     ctactaacgt tgataaaaaa caccccataa ttacgtatgc gtttgattaa tttttgctac     79620
     ctaacaaaat tattttttcc taattaaatt acacaaaaac tggcttttgg gtttctcaaa     79680
     tcattcatga cccatgccat aaaattaaaa tatactgtat tatcataggc tgattcaaca     79740
     taaattgact acttttctca tcttttttat ttgcgaacaa tttaacttat tttatttgga     79800
     ctaacccatt tatattattc tattgtgtaa ctattactca ttagatctca tacttaatga     79860
     atttgtcaat ctaggtttat actctatact aatattttaa ctaaaataaa ttgaagcatt     79920
     cgcaaagcat ccatatgatt cattcaccgc cagaacatag aacctagttc atttattata     79980
     acctaaagaa actttaattg tttttatgtg ttcccaagaa tattaaaata cagtacacaa     80040
     gtttgtcgac gagtctttgc gtgagtttta actaatcaaa caaagggggc tgcctgaaag     80100
     aattgaattc gatagttttg gaattcaata aattgagtat gagccacgtg gaattcttac     80160
     actgacacaa caaaaactaa aataaaaaat atttattggc gccggatatg attgggaaac     80220
     ttcaaactat gcaaccatgt gttattggac ccatttgcct ctttaagaaa attttcaaca     80280
     tttaagccta acactagtta gattttttaa ttttaactaa ttacatttgc atgttaatcc     80340
     ttccttaaat gctcatttac tataaattta tttttgggga tttggtacag agcagaaaat     80400
     attaacaatg aaaagaaatc atgattcatt tttgattata tcaattaaaa ataagttgaa     80460
     ataacaattt taaatgtaaa aataaaaatt aaaatctccc aacctttttt tcatctcaaa     80520
     tatttaaatc tatcttttac agtattgtcc tagtaaatct gaaaagtcag aaagtcagaa     80580
     tattcaatct aatcacataa ttataaagtt tttcatgcca ttcgattttg tttcttctat     80640
     tgcacaaatt agtaaaacag aataaaaaat atctattaaa cttaaaattt tggaaataaa     80700
     tacacatcaa tctatatatt ccacttcaat tctatttaac atgaaaccaa aaccccaaaa     80760
     aaacttgatc                                                            80770
//

If you have problems or comments...

PBIL Back to PBIL home page