(data stored in ACNUC8465 zone)

EMBL: AB005654

ID   AB005654; SV 1; linear; mRNA; STD; MUS; 1604 BP.
XX
AC   AB005654;
XX
DT   19-JAN-1998 (Rel. 54, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus mRNA for Mitogen-activated protein kinase kinase 7, complete
DE   cds.
XX
KW   Mitogen-activated protein kinase kinase 7.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1604
RA   Moriguchi T.;
RT   ;
RL   Submitted (10-JUL-1997) to the INSDC.
RL   Tetsuo Moriguchi, Kyoto University, Department of Biophysics, Graduate
RL   School of Science; Kitashirakawa-Oiwake-chou Sakyo-ku, Kyoto 606-01, Japan
RL   (E-mail:tekkun@virus.kyoto-u.ac.jp, Tel:+81-75-753-4230,
RL   Fax:+81-75-753-4235)
XX
RN   [2]
RX   DOI; 10.1093/emboj/16.23.7045.
RX   PUBMED; 9384583.
RA   Moriguchi T., Toyoshima F., Masuyama N., Hanafusa H., Gotoh Y., Nishida E.;
RT   "A novel SAPK/JNK kinase, MKK7, stimulated by TNFalpha and cellular
RT   stresses";
RL   EMBO J. 16(23):7045-7053(1997).
XX
DR   MD5; 6052c59a54ea63556523fce14ea377c8.
DR   Ensembl-Gn; ENSMUSG00000002948; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000109061; mus_musculus.
DR   Ensembl-Gn; MGP_AJ_G0033309; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0033240; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033023; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033821; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CBAJ_G0032996; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0033150; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0033097; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0033244; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033132; mus_musculus_nodshiltj.
DR   Ensembl-Tr; ENSMUST00000003027; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062686; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110994; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110995; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110996; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110998; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110999; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000145165; mus_musculus.
DR   Ensembl-Tr; MGP_AJ_T0088111; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0088043; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0087625; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0088571; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CBAJ_T0087572; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0087769; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0087605; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0087800; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0087645; mus_musculus_nodshiltj.
DR   EuropePMC; PMC3392838; 22353730.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1604
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        46..1452
FT                   /product="Mitogen-activated protein kinase kinase 7"
FT                   /db_xref="GOA:Q8CE90"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="MGI:MGI:1346871"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CE90"
FT                   /protein_id="BAA24383.1"
FT                   /translation="MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPIIVI
FT                   TLSPAPAPSQRAALQLPLANDGGSRSPSSESSPQHPTPPTRPRHMLGLPSTLFTPRSME
FT                   SIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHIIA
FT                   VKQMRRSGNKEENKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKL
FT                   KKRMQGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGIS
FT                   GRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKN
FT                   CKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKHY
FT                   EILEVDVASWFKDVMAKTESPRTSGVLSQHHLPFFSGSLEESPTSPPSPKSFPLSPAIP
FT                   QAQAEWVSGR"
XX
SQ   Sequence 1604 BP; 383 A; 467 C; 429 G; 325 T; 0 other;
     tgacgggtgg cctggcggtg agcggcggca gcggcggcgg ggaagatggc ggcgtcctcc        60
     ctggagcaga agctgtcccg cctggaagcc aagctgaagc aggagaaccg tgaggcccgc       120
     aggaggatcg acctcaactt ggatatcagc ccacagcggc ccaggcccat tattgtgatc       180
     actctaagcc ctgctcctgc cccgtcccag cgagcagccc tgcaactccc actggccaac       240
     gatgggggca gccgctcacc atcctcagag agctccccac agcaccctac accccccacc       300
     cggccccgcc acatgctggg gctcccatca accttgttca caccgcgcag tatggagagc       360
     atcgagattg accagaagct gcaggagatc atgaagcaga cagggtacct gactatcggg       420
     ggccagcgtt atcaggcaga aatcaatgac ttggagaact tgggtgagat gggcagtggt       480
     acctgtggtc aggtgtggaa gatgcggttc cggaagacag gccacatcat tgctgttaag       540
     caaatgcggc gctctgggaa caaggaagag aataagcgca ttttgatgga cctggatgta       600
     gtactcaaga gccatgactg cccttacatc gttcagtgct ttggcacctt catcaccaac       660
     acagacgtct ttattgccat ggagctcatg ggcacatgtg cagagaagct gaagaaacga       720
     atgcagggcc ccattccaga gcgaatcctg ggcaagatga ctgtggcgat tgtgaaagca       780
     ctgtactatc tgaaggagaa gcatggcgtc atccatcgcg atgtcaaacc ctccaacatc       840
     ctgctagatg agcggggcca gatcaagctc tgtgactttg gcatcagtgg ccgccttgtt       900
     gactccaaag ccaaaacacg gagtgctggc tgtgctgcct atatggctcc cgagcgcatc       960
     gaccctccag atcccaccaa gcctgactat gacatccgag ctgatgtgtg gagcctgggc      1020
     atctcactgg tggagctggc aacaggacag ttcccctata agaactgcaa gacggacttt      1080
     gaggtcctca ccaaagtcct acaggaagag cccccactcc tgcctggtca catgggcttc      1140
     tcaggggact tccagtcatt tgtcaaagac tgccttacta aagatcacag gaagagacca      1200
     aagtataata agctacttga acacagcttc atcaagcact atgagatact cgaggtggat      1260
     gtcgcgtcct ggtttaagga tgtcatggcg aagaccgagt ccccaaggac tagtggagtc      1320
     ctgagtcagc accatctgcc cttcttcagt gggagtctgg aggagtctcc cacttcccca      1380
     ccttctccca agtccttccc tctgtcacca gccatccctc aggcccaggc agagtgggtc      1440
     tcgggcaggt agggacctgg agtggcctgg tcccaccctc tgacctcctc ctcaggccac      1500
     cagtgttgcc ctcttccctt tttaaaacaa aatacccttg tttgtaaatc cttagacgct      1560
     tgagaataaa acccttccct tttcttccga aaaaaggggg gcca                       1604
//

If you have problems or comments...

PBIL Back to PBIL home page