(data stored in SCRATCH zone)

EMBL: AB006424

ID   AB006424; SV 1; linear; genomic DNA; STD; PRO; 69650 BP.
XX
AC   AB006424;
XX
DT   23-SEP-1998 (Rel. 57, Created)
DT   14-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Bacillus subtilis genomic DNA, 70 kb region between 17 and 23 degree.
XX
KW   .
XX
OS   Bacillus subtilis
OC   Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
XX
RN   [1]
RP   1-69650
RA   Yoshikawa H.;
RT   ;
RL   Submitted (28-JUL-1997) to the INSDC.
RL   Hirofumi Yoshikawa, The University of Tokyo, Institute of Molecular &
RL   Cellular Biosciences; Yayoi 1-1-1, Bunkyo-ku, Tokyo 113, Japan
RL   (E-mail:hiyoshik@imcbns.iam.u-tokyo.ac.jp, Tel:81-3-3812-2111,
RL   Fax:81-3-3813-0539)
XX
RN   [2]
RA   Haga K., Liu H., Yasumoto K., Takahashi H., Yoshikawa H.;
RT   "Sequence analysis of the 70kb region between 17 and 23 degree of the
RT   Bacillus subtilis chromosome.";
RL   Unpublished.
XX
DR   MD5; 3bed9fa889c31fc9adc02ebb6dca099b.
DR   RFAM; RF00234; glmS.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..69650
FT                   /organism="Bacillus subtilis"
FT                   /strain="168"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:1423"
FT   CDS_pept        1..705
FT                   /transl_table=11
FT                   /gene="ybbR"
FT                   /db_xref="GOA:O34659"
FT                   /db_xref="InterPro:IPR012505"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34659"
FT                   /protein_id="BAA33068.1"
FT                   /translation="MDKFLNNRWAVKIIALLFALLLYVAVNSNQAPTPKKPGESFFPTS
FT                   TTDEATLTDIPVKAYYDDENYVVTGVPQTVNVTIKGSTSAVKKARQTKNFEIYADMEHL
FT                   KTGTHKVELKAKNVSDGLTISINPSVTTVTIQERTTKSFPVEVEYYNKSKMKKGYSPEQ
FT                   PIVSPKNVQITGSKNVIDNISLHKASVNLENADETIEKEAKVTVYDKDGNALPVDVEPS
FT                   VIKITVPVTSPE"
FT   CDS_pept        1158..1313
FT                   /transl_table=11
FT                   /gene="ybzC"
FT                   /db_xref="UniProtKB/TrEMBL:O87089"
FT                   /protein_id="BAA33069.1"
FT                   /translation="MKLEVNGPQNVTWSLGRKNAKIKLTSKKSNTSTNDNSSNTSGNQD
FT                   TDKQTN"
FT   CDS_pept        1469..2815
FT                   /transl_table=11
FT                   /gene="ybbT"
FT                   /db_xref="GOA:O34824"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34824"
FT                   /protein_id="BAA33070.1"
FT                   /translation="MGKYFGKDGVRGVANSELTPELAFKVGRFGGYVLTKDKQRPKVLI
FT                   GRDTRISGHMLEGALVAGLLSIGAEVMRLGVISTPGVSYLTKAMDAEAGVMISASHNPV
FT                   QDNGIKFFGGDGFKLSDEQEAEIERLMDEPEDKLPRPVGADLGLVNDYFEGGQKYLQFL
FT                   KQTADEDFTGIHVALDCANGATSSLATHLFADLDADVSTMGTSPNGLNINDGVGSTHPE
FT                   ALSAFVKEKNADLGLAFDGDGDRLIAVDEKGNIVDGDQIMYICSKHLKSEGRLKDDTVV
FT                   STVMSNLGFYKALEKEGIKSVQTAVGDRYVVEAMKKDGYNVGGEQSGHLIFLDYNTTGD
FT                   GLLSAIMLMNTLKATGKPLSELAAEMQKFPQLLVNVRVTDKYKVEENEKVKAVISEVEK
FT                   EMNGDGRILVRPSGTEPLVRVMAEAKTKELCDEYVNRIVEVVRSEMGLE"
FT   CDS_pept        3246..5048
FT                   /transl_table=11
FT                   /gene="gcaA"
FT                   /product="L-GLUTAMINE-D-FRUCTOSE-6-PHOSPHATE AMIDO
FT                   TRANSFERASE"
FT                   /db_xref="GOA:P0CI73"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CI73"
FT                   /protein_id="BAA33071.1"
FT                   /translation="MCGIVGYIGQLDAKEILLKGLEKLEYRGYDSAGIAVANEQGIHVF
FT                   KEKGRIADLREVVDANVEAKAGIGHTRWATHGEPSYLNAHPHQSALGRFTLVHNGVIEN
FT                   YVQLKQEYLQDVELKSDTDTEVVVQVIEQFVNGGLETEEAFRKTLTLLKGSYAIALFDN
FT                   DNRETIFVAKNKSPLLVGLGDTFNVVASDAMAMLQVTNEYVELMDKEMVIVTDDQVVIK
FT                   NLDGDVITRASYIAELDASDIEKGTYPHYMLKETDEQPVVMRKIIQTYQDENGKLSVPG
FT                   DIAAAVAEADRIYIIGCGTSYHAGLVGKQYIEMWANVPVEVHVASEFSYNMPLLSKKPL
FT                   FIFLSQSGETADSRAVLVQVKALGHKALTITNVPGSTLSREADYTLLLHAGPEIAVAST
FT                   KAYTAQIAVLAVLASVAADKNGINIGFDLVKELGIAANAMEALCDQKDEMEMIAREYLT
FT                   VSRNAFFIGRGLDYFVCVEGALKLKEISYIQAEGFAGGELKHGTIALIEQGTPVFALAT
FT                   QEHVNLSIRGNVKEVAARGANTCIISLKGLDDADDRFVLPEVNPALAPLVSVVPLQLIA
FT                   YYAALHRGCDVDKPRNLAKSVTVE"
FT   CDS_pept        5095..5235
FT                   /transl_table=11
FT                   /gene="ybzD"
FT                   /protein_id="BAA33072.1"
FT                   /translation="MSKSERTSTVEKWIKEVDGTGPDYRSTMAIDLRCFLIRSVNQVKR
FT                   H"
FT   CDS_pept        complement(5516..6427)
FT                   /transl_table=11
FT                   /gene="alkA"
FT                   /product="3-METHYLADENINE DNA GLYCOSYLASE"
FT                   /db_xref="GOA:P37878"
FT                   /db_xref="InterPro:IPR000035"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR012904"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37878"
FT                   /protein_id="BAA33073.1"
FT                   /translation="MTWHEVNDVIVITLPEIFDMNANLGYLTREKNECMYEIENNIITK
FT                   VIAIGEIRSLVQVSVINNKQMIVQFLNDSRPVEQWKREEIVKYIHEWFDLDNDLTPFYE
FT                   MAKADPLLKMPARKFYGLRVIGIPDLFEALCWGVLGQQINLAFAYSLKKQFVEAFGDSI
FT                   EWNGKKYWVFPPYERIARLTPTDLADIKMTVKKSEYIIGIARLMASGELSREKLMKMNF
FT                   KDAEKNLIKIRGIGPWTANYVLMRCLRFPTAFPIDDVGLIHSIKILRNMNRKPTKDEIL
FT                   EISVPWKEWQSYATFYLWRVLY"
FT   CDS_pept        6698..7333
FT                   /transl_table=11
FT                   /gene="adaA"
FT                   /product="METHYLPHOSPHOTRIESTER-DNA ALKYLTRANSFERASE"
FT                   /db_xref="GOA:P19219"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR016220"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="UniProtKB/Swiss-Prot:P19219"
FT                   /protein_id="BAA33074.1"
FT                   /translation="MPDSINNGHKESHDHRISNDAEMITDEKWQAIINNDAAYNNQFFY
FT                   AVKSTGIFCKPSCKSRVPKKENVCIFPNTEQALRANFRPCKRCKPTNEKMPDSEWVDLI
FT                   TEYIDKNFTEKLTLESLADICHGSPYHMHRTFKKIKGITLVEYIQQVRVHAAKKYLIQT
FT                   NKAIGDIAICVGIANAPYFITLFKKKTGQTPARFRQMSKMEETYNGNK"
FT   CDS_pept        7320..7859
FT                   /transl_table=11
FT                   /gene="adaB"
FT                   /product="O-6-METHYLGUANINE-DNA ALKYLTRANSFERASE"
FT                   /db_xref="GOA:P19220"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/Swiss-Prot:P19220"
FT                   /protein_id="BAA33075.1"
FT                   /translation="METNKPTLYWSLLMFKDWNFYIASTLKGLVFVGSQNKPIEELFEW
FT                   ARKRFPGSLLVEDDDKLEPYAVEITQYLEGKRKNFTVPVEYAGTQFQLAVWNALCEIPY
FT                   GQTKSYSDIANDINKPAAVRAVGAAIGANPVLITVPCHRVIGKNGSLTGYRGGFEMKTL
FT                   LLDLEKRASSEMDVPH"
FT   CDS_pept        8378..9895
FT                   /transl_table=11
FT                   /gene="ndhF"
FT                   /product="NADH DEHYDROGENASE SUBUNIT 5"
FT                   /db_xref="GOA:P39755"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39755"
FT                   /protein_id="BAA33076.1"
FT                   /translation="MLVSLSLSSLLTLFFIMLMASGISGLLFLHPRVPLSFVRIHIGIL
FT                   ALPLLVSLLILANSGVSGNVGPWHLDSLACLMTFFVLAIGFIIQRFSVRYLMGDRSYRK
FT                   YFTLFTFTTGAASMTWLSGDLRLMVLFWGATLVGLTLLIRLNSAWQVASEAAKISGRLF
FT                   LLSWFSLFFAMMWLFHATGQWQLSLVVTNESLAGLGEWERTGIQLLIVLAVIIPAAQWP
FT                   FQRWLVESIVAPTPVSAIMHAGLVNAGGIILTRFSPLFHGGIASIILLLLASISVLIGT
FT                   GISLVQVDYKRQLVGSTIGQMGFMLIQCALGAYIAAIIHLILHGLFKATLFLQAGSAVG
FT                   RHEVSTRTNERTSYLWVMAGRILSLVIGVAFWLTAPGDGYHLISALILGWSLSVSWDQL
FT                   VAFGEGRIGRIAGLTVLGGAALVYFIIHHLFYKWLHTTIFQSVQPPMSAVMIVVCLLLF
FT                   GSALGTWVARHRSSVFFAVLYLWLVRLGEAKPKSVESHPDYLKQYIS"
FT   CDS_pept        9910..10323
FT                   /transl_table=11
FT                   /gene="ybcC"
FT                   /db_xref="InterPro:IPR018752"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34688"
FT                   /protein_id="BAA33077.1"
FT                   /translation="MGITSVLTKDNVKKIDTDIDVQERDLNVFITSASRVIAPLWPIST
FT                   FAARNPWMGLENQPFDQVASWLKNTRDVDIYPSASMIRSAKNKGEIDEDFVEMGLQRWL
FT                   DSHSYHIPRDVAERFCHAALKLDPLAFRPFIIT"
FT   CDS_pept        10356..12416
FT                   /transl_table=11
FT                   /gene="ybcD"
FT                   /db_xref="InterPro:IPR018752"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34688"
FT                   /protein_id="BAA33078.1"
FT                   /translation="MDHIENVFMQPLSSYIENQDGERLVNILDHHVIKWSKLYLDDSQA
FT                   GWTMPNREEGFYRAWQHLIQYDPALSKKQRERVKGWPKEAHLALQEALFALEIPESEIQ
FT                   TYLEGHLLSLPGWAGMMLWRSQQSSHEHALLTEYLAVRISMEWALIKPYLPLTNERSKK
FT                   TISIAPLIAAWIHWGGLTLEEWSQMTASEQNEYLSFAYSFDEKLRKKLWLEAWEQTYTD
FT                   RLSQKIISKQRETGREKSALAQLAFCIDVRSEPFRRQLEKEGPFETIGIAGFFGVPIAT
FT                   CELGSKHSHASLPIIQKPQNKIKEFADEDVFKKYNQRKQAIHSLSHTFKTMKQNALSSL
FT                   LLPELSGPWLTLQMAARSFVPRKAGRFIRNLREAWLRKPDTKLSLHHDATEAEIPVGFT
FT                   DEEKVNYARQALKMMGLTENIAPLVVICGHGSQSTNNPYSAALDCGACGGAAGGFNARV
FT                   LAALCNLSEVREALLADGIKIPEDTVFAAAEHNTTVDELHWLYVPELSEAAQEAFEQIE
FT                   AVMPKVRHHVNAERLAQLPNFQSKLKNPKAEANRFAEDWSEIRPEWGLARNAAFIIGKR
FT                   ELTQDCGLEGRAFFHNYDWKQDESGELLANIIVGPGTVAQWINLQYYASTVAPHYYGSG
FT                   NKATQTVTAGLGVMQGECKRFVSRTALAIRHGIRSRGLSFSSSFIDTHPST"
FT   CDS_pept        12610..12834
FT                   /transl_table=11
FT                   /gene="ybcF"
FT                   /db_xref="GOA:O34823"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34823"
FT                   /protein_id="BAA33079.1"
FT                   /translation="MNVNQIKKVLFLTDIENGLEPILQEATNTSAENMLTIPSYGASIS
FT                   HPYGEIMRSVIFAIYQEDVEEIFVVGTKD"
FT   CDS_pept        13201..13491
FT                   /transl_table=11
FT                   /gene="ybcH"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34795"
FT                   /protein_id="BAA33080.1"
FT                   /translation="MSANLTDFVTKTIEEMNSFDRENMECIKKLIRKAIDFYHLKSYEE
FT                   VEETHSGNVRFLHVHSMMEENMLSKMIVVTRNGKTDLDIEGVYEGYVVREY"
FT   CDS_pept        13549..13923
FT                   /transl_table=11
FT                   /gene="ybcI"
FT                   /db_xref="InterPro:IPR018745"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34380"
FT                   /protein_id="BAA33081.1"
FT                   /translation="MKKSKGSIESEISKSITQWEKDYLGRGSVSVKTDILRDMIIVNLK
FT                   GILTPAEYVVCGSKEGMLSIKQTRSELVESGIEGLKDIILKITGEKVKSFHTDLSSRTG
FT                   ERVMVFKLCNDLEKNLEKIL"
FT   CDS_pept        14517..14657
FT                   /transl_table=11
FT                   /gene="ybcK"
FT                   /db_xref="GOA:O87094"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:O87094"
FT                   /protein_id="BAA33082.1"
FT                   /translation="MNTIGVCVSQITDKLKMTQSTASQYLTILLRAGLIKAERSRKVHV
FT                   L"
FT   CDS_pept        14675..14785
FT                   /transl_table=11
FT                   /gene="ybzF"
FT                   /db_xref="UniProtKB/TrEMBL:O87095"
FT                   /protein_id="BAA33083.1"
FT                   /translation="MGNLLTFLKQRYKNKHQKMFIFTPYISTYYDVFIFL"
FT   CDS_pept        14840..16012
FT                   /transl_table=11
FT                   /gene="ybcL"
FT                   /db_xref="GOA:O34663"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:O34663"
FT                   /protein_id="BAA33084.1"
FT                   /translation="MSNTWKIYILAIVSFLVGTSEYIISGILDQIAHTLGITLAAAGQL
FT                   ITIFSLVYALSTPVLMALTASMDRRKLMMYALGLFVFGNVLAFVLPGYGWFIAARIIMA
FT                   MGAGVVVVTALTIAAKIASEGKQGSAIATVVMGFTASLIIGVPLGRMIAVALGWKSVFG
FT                   AIALLGLIAMVVIFFTLPYTEGDKPVPLLQQLALFKKRKVAMGLSITFFWLGGYSVAYT
FT                   YLSPYLLNISGINGKLLSGVLLIFGIASLVGSKFGGYSTDKWGVPFTLVGGMTLHIVTL
FT                   ILLSLVTHSYIGVLVILILWSFAAWSTGPTQQFHLATIEPEMSGVLLSMNQSMMQFAMA
FT                   VGAGIGGVFVENVSLASITWVGALGVMIAIIASLLIFNSQPKQALKDINQ"
FT   CDS_pept        16136..16450
FT                   /transl_table=11
FT                   /gene="ybcM"
FT                   /db_xref="GOA:O31421"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31421"
FT                   /protein_id="BAA33085.1"
FT                   /translation="MRFLKALPRRAEVQYDCLDRTLETQENVNLNIRVNVKEVATWGVN
FT                   TCIISLKGLDNADDRFVLPEVNTALALFPLSIAADCLLMLPCISVVMSISSVMKSVTVE
FT                   "
FT   CDS_pept        16922..17089
FT                   /transl_table=11
FT                   /gene="ybcO"
FT                   /db_xref="GOA:O31422"
FT                   /db_xref="InterPro:IPR030919"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31422"
FT                   /protein_id="BAA33086.1"
FT                   /translation="MKRNQKEWESVSKKGLMKPGGTSIVKAAGCMGCWASKSIAMTRVC
FT                   ALPHPAMRAI"
FT   CDS_pept        17156..17545
FT                   /transl_table=11
FT                   /gene="ybcP"
FT                   /db_xref="GOA:O31423"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR030915"
FT                   /db_xref="PDB:6EFN"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31423"
FT                   /protein_id="BAA33087.1"
FT                   /translation="MSYDRVKDFDLPELAVHLQPHGAVMIDRKSMFYFRLSGRGAQLAF
FT                   LLSKNKNLHKTARIWEIMKKEEMSADQLKEELSAHPFTEAWTEGLLDQPLHVSGSLDSY
FT                   LPISCTLQLTNACNLSCSLLLCQLR"
FT   CDS_pept        17589..18029
FT                   /transl_table=11
FT                   /gene="ybcQ"
FT                   /db_xref="GOA:O31423"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR030915"
FT                   /db_xref="PDB:6EFN"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31423"
FT                   /protein_id="BAA33088.1"
FT                   /translation="MQKLAAHGVADITLTGGEAKLIKGFKELVVVASSLFTNVNVFSNG
FT                   LNWRDEEVELLSHLGNVSVQISIDGMDNTHDQLRGRKGGFKESMNTIKKLSEANIPVIV
FT                   AMTINESNADEVSRCGGAMCQCGCFYLSCRKNVICWTCDRRL"
FT   CDS_pept        18034..18390
FT                   /transl_table=11
FT                   /gene="ybcR"
FT                   /db_xref="GOA:O31423"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR030915"
FT                   /db_xref="PDB:6EFN"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31423"
FT                   /protein_id="BAA33089.1"
FT                   /translation="MDIDFEEMVQIQLREARHKWGDRLNIIDWEHEESSFTTDFCTPGY
FT                   LAWYIRADGYVTPCQLEDLPLGHILEDSMADIGSPARLLQLKCEAKNCKCIGKIELSEP
FT                   DLPFQKEVKAGIQE"
FT   CDS_pept        18387..18944
FT                   /transl_table=11
FT                   /gene="ybcS"
FT                   /db_xref="GOA:O31425"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31425"
FT                   /protein_id="BAA33090.1"
FT                   /translation="MNSLSLVFWSILAVVGLLLFIKFKPPTIASLLLSKDEAKEISIQF
FT                   IKEFVGIDVENWDFYSVYWYDHDTVNKLHHLGILKKNRKVLYDVGLVESWRVRFVHQNQ
FT                   SFVVGVNANREITFFYADVPKKTLSGKFEQVSPETLKQRLMASPDGLWSRANMTGTGKK
FT                   EEDFREVSTYWYIAEAEIFGSK"
FT   CDS_pept        18941..19876
FT                   /transl_table=11
FT                   /gene="ybcT"
FT                   /db_xref="GOA:O31425"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31425"
FT                   /protein_id="BAA33091.1"
FT                   /translation="MTVELQGGRISYIGTEQEILTDQMSKVIRDEQVESTFGVSGMLGS
FT                   ALAMILAILILVFMDVQTSIIFSLVLGLLIIICQSLTLKEDIQLTIVNAYDARMSVKTV
FT                   SLLGILSTLLTGLLTGFVVFICSLAGNALAGDFGWKTFEQPIVQIFYGIGAGLISLGVT
FT                   SLLFNLLEKKQYLRISPELSNRTVFLSGFTFRQGLNMSIQSSIGEEVIYRLLMIPVIWW
FT                   MSGNILISIIVSSFLWAVMHQVTGYDPRWIRWLHLFIFGCFLGVLFIKFGFICVLVAHF
FT                   IHNLVLVCMPLWQFKLQKHMHHDQPKHTSL"
FT   CDS_pept        19895..20614
FT                   /transl_table=11
FT                   /gene="ybdA"
FT                   /db_xref="GOA:O31427"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31427"
FT                   /protein_id="BAA33092.1"
FT                   /translation="MQLMQVQNLSKCYRNGDGVEHLSFSIQRGEIVALLGPNGAGKTTT
FT                   IRCLTGLYKPDKGDILIEGSPPGDINVQKKVALIPDQPYLYPALTAAEHIQFRARGYHP
FT                   GKKDVKERVYHALKEVHLEEKANQLCGQLSRGQKQRVVLAGAIVQDALLYILDEPTVGL
FT                   DIPSKQWLSNWLKTKTDQGCSAFVSTHSLEFVIETADRVILIRDGKLMQDLYVPQFEEQ
FT                   AEWRKEVIRLLGEWSDE"
FT   CDS_pept        20679..22025
FT                   /transl_table=11
FT                   /gene="ybdB"
FT                   /db_xref="GOA:O31428"
FT                   /db_xref="InterPro:IPR030920"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31428"
FT                   /protein_id="BAA33093.1"
FT                   /translation="MPFLIMLLFVGAIGFQVSFVSRSTTWDMSIAGWVLTGVFILYTAF
FT                   GLFSNRLPSQMADIIWLYGTATSFSKVVYSVLFFSVTWKALLWIISAIFGDVLIVLLSG
FT                   DHINLLGRSIIFVGLFFIAEVWLMSVSCARTVKKMKRVYVLVFLLMLGIYSICLYRFFF
FT                   LQHSSGIWESIARFISGVGLVFDTLSPLYVVVFIGIITVSFITIAFTSRQVEIKESLVK
FT                   EAEFWEEFQERQFGSGQIIQKPKTTWWGLQGLNGIWSFLWLELLLFKKYLFFHSIHTVM
FT                   LSGVFYVVIFMYPEWFYLLFFLIVSAVMLSSYYSGIVRHSQSGTLHLFPGALWKKIIIL
FT                   ELTNTVWLYILYCVSITFMAVGNLVYWYIYGLGIYIWFMTIRLFAFTHTNRNDIKLLSL
FT                   PQYYKSFFMALGLTGICLYVIHLLTADWYTLVVVVCIGSLSWCLFYRFK"
FT   CDS_pept        22072..22485
FT                   /transl_table=11
FT                   /gene="ybdD"
FT                   /db_xref="GOA:O31429"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31429"
FT                   /protein_id="BAA33094.1"
FT                   /translation="MNSNGDKLSLSVQNLANTNEITIVQAIGELKKSGKDAIPVLVEAL
FT                   KEEGSLCNIAAAVLGEFGEDASEAAEELSCLLKSHAEDTRMAAAISLMRIGKPSLPFVI
FT                   KIAHESEGQSSFGHLGVLHGLIRLALNLRCINV"
FT   CDS_pept        22591..23016
FT                   /transl_table=11
FT                   /gene="ybdE"
FT                   /db_xref="GOA:O31430"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31430"
FT                   /protein_id="BAA33095.1"
FT                   /translation="MKDGQMLTEWPSHLPWLNQSQNDFTFPSDTYLLLYFWSMSCPNCH
FT                   QFTDKVLQDIKDMNVKVIGVHVPYIEEEKSMEVVLTYALDRGLAIPIVLDQNYEIVTTC
FT                   HVQGIPSFCLLSQYGQIITKTMGDVSWDKMLKKIAGL"
FT   CDS_pept        23264..23731
FT                   /transl_table=11
FT                   /gene="ybdG"
FT                   /db_xref="GOA:O31431"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31431"
FT                   /protein_id="BAA33096.1"
FT                   /translation="MKTLWKVLKIVFVSLAALVLLVSVSVFIYHHFQLNKEAALLKGKG
FT                   TVVDVDGKKMNVYQEGSGKDTFVFMSGSGIAAPAYEMKGLYSKFSKENKIAVVDRAGYG
FT                   YSEVSHDDRDIDTVLEQTRKALMKSGNKPPYILMPHSISGIEAMYWAQKYP"
FT   CDS_pept        23755..24156
FT                   /transl_table=11
FT                   /gene="ybdH"
FT                   /db_xref="GOA:O31431"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31431"
FT                   /protein_id="BAA33097.1"
FT                   /translation="MDIGLPQQYVTYKLSGVDRLKVRGFHLLTSIGFHRFIPSAVYNPE
FT                   VIRQSFLTDEEKEIYKAINFKQFFNADMEHELLQSYQNGSKSVNLPAPKETPVLILDAV
FT                   SDQNRHSKYAIQNPEKTMNRLRLNSILPI"
FT   CDS_pept        24248..24919
FT                   /transl_table=11
FT                   /gene="ybdJ"
FT                   /db_xref="GOA:O31432"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31432"
FT                   /protein_id="BAA33098.1"
FT                   /translation="MKGYRILIVEDDVMIGDLLQKILQREGYRVIWKTDGADVLSVIQK
FT                   VDLVIMDVMLPGEDGYQMSAKIKKLGLGIPVIFLSARNDMDSKLQGLQIGEDYMVKPFD
FT                   PRELLLRMRNMLEHHYGTFTQIKHLYIDAVTKKVFNESLHDEVLFTAIERKIFFYLYEN
FT                   RDSILTKEHFFEYLWQLEDRNPNIVNVHIKKIRAKINDQAGEMIENIYGEGYRLNTVVK
FT                   K"
FT   CDS_pept        24940..25902
FT                   /transl_table=11
FT                   /gene="ybdK"
FT                   /db_xref="GOA:O31433"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31433"
FT                   /protein_id="BAA33099.1"
FT                   /translation="MLLFTAVISVPMLLLAVSVLMSVIYDSMFKPMNHGMPFHRSFAYP
FT                   AMIVVFLISLLLLAFLFSKSIHSLLHKINLLNQTIRHLASDQRVPDKIEVKRADEIGEL
FT                   IKSVNLLIERTTYRELELRQQEEIKKELLQKLRHDINTPLTALRLQLFYLEDQCHGQAV
FT                   FESLYQQIEYISELTNEFNLYSAETLESSYIVNEEVRLNELLETAVKKWDYLYSMSGIE
FT                   LHYKPADQDVIWMSNTLWMERLFDNIFQNTLRHSKAKKMEVTIEHGDVFIRDDGIGFDR
FT                   NESSEGLGLKIIEDTCRLLAITYELHTNDNGTGFLFSKE"
FT   CDS_pept        25972..26166
FT                   /transl_table=11
FT                   /gene="ybdL"
FT                   /db_xref="UniProtKB/TrEMBL:O31434"
FT                   /protein_id="BAA33100.1"
FT                   /translation="MFKKIIKTIKYLSSSSSDRYRRHRHYSSSRRRHYRSYSSSSGKRR
FT                   HYDRYGGSHRYKRRSYSSS"
FT   CDS_pept        complement(26209..26979)
FT                   /transl_table=11
FT                   /gene="ybdM"
FT                   /db_xref="GOA:O31435"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31435"
FT                   /protein_id="BAA33101.1"
FT                   /translation="MALKLLKKLLFDRPLKNGVILNHQYKIEECLGMGGYGLVYLCTDI
FT                   LAQTPYVLKQLRPTKAKKEKEKVRFQQEIKLLKNIHHPQIPGFIDEFIIDGQAYYVMQF
FT                   IEGENIEELLFFRKQPFTELMALQLISQLLEIIEYLHDRLIFHSDIRTPNIIINDGRLC
FT                   LIDFGLAKQLTPEEMEEIKVRKQDDFFDLGETLLFLLYSQYKGKKKKNGTWLEELTLTK
FT                   EVTLLLKRLLGIEEEYQHTASIREDLNRAIQSVT"
FT   CDS_pept        complement(27065..27922)
FT                   /transl_table=11
FT                   /gene="ybdN"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31436"
FT                   /protein_id="BAA33102.1"
FT                   /translation="MVKKWLIQFAVMLSVLSTFTYSASAVGVTAITGNNSFDTAMPIGY
FT                   WKYKNIDTTILEAGQDEAYFTFTANKGEKVYMRSTYQSAYTGMKIEIYDKNRIPVSQGT
FT                   EVINPNTFSSFIYANADAQNTTDTFYVKVSRGTYTGNMYFTLSIEDRIKSGSGTFQFSG
FT                   VAENKGNTSLSPSGSDSSVIKVDLTNQSGIPRDAIVTRVQTTATQTPSQGNTRHLIMTS
FT                   ENNEWSRALVNSSTSGSYDISLSDQLSVAKVWSFKYNTLATARSTMSNVKAKIDYEYDV
FT                   TKQF"
FT   CDS_pept        28054..29238
FT                   /transl_table=11
FT                   /gene="ybdO"
FT                   /db_xref="InterPro:IPR032617"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31437"
FT                   /protein_id="BAA33103.1"
FT                   /translation="MRLNRQFIRTQLIAQNILSKNAPAKRENATENPAAVLEKAYSRLK
FT                   SQSSTGGINQFNYSKTSVSGNSGTFSKVYQSANDRTVTDTGEETVIQSQNPYESESDIR
FT                   IKILDEKYSRMNAINKTKSDPLGYIKDKYQNSKSPYFRSDLSAAERQAAYDNETEWLFK
FT                   GKAQNYNLQDAVFRNVTFHGEVEAENEKVYQRGQVNQQLQVLLNRNHIHIPEGTELTFT
FT                   ITPIDYQVRVSGTDDQDLIKQIEQVLQSGDNSKELFLHIMKSQSSDSAQFSEEAYKKYQ
FT                   AAREMYEVTGYHLKDLEVIDGRYVTPEGRDLMDVYKEELEKDPVQKQTASYAISYYRSE
FT                   LSKIAEAGYNAIPDFILSIDYSNGSLRDVGQSKSYGTGDTGWLEALKRQTGVNY"
FT   CDS_pept        29556..30944
FT                   /transl_table=11
FT                   /gene="ybdP"
FT                   /db_xref="GOA:P54425"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54425"
FT                   /protein_id="BAA33104.1"
FT                   /translation="MANKELKRGLGARHIQMIALGGTIGVGLFMGSASTISWTGPSVLL
FT                   AYAICGIFIFFIMRAMGEMLYVEPSTGSFATFGHQYIHPMAGYITAWSNWFQWIIVGMS
FT                   EIIAVGSYTKYWFPDLPAWIPGIVAMVILGAANLISVKSFGEFEFWFAMIKIVTIILMI
FT                   IAGIGIIFFGFGNGGDAIGLSNLWSHGGFFAGGFSGFFFALSLVIAAYQGVELIGITAG
FT                   EAKDPQNTLRNAIQSIIWRILIFYIGAIFVIVTVYPWDELNSLGSPFVSTFSKIGITAA
FT                   AGIINFVVITAAMSGCNSGIFSAGRMLYTLGVNGQAPKFFKKISRNGVPLYGTIAVLIG
FT                   LAVGVVLNYIAPPKIFVYVYSASVLPGMIPWFIILISHIGFRKAKGAALDKHPFKMPFA
FT                   PFTNYLTIAFLLMVLVGMWFNDDTRISLIVGVIFLALVVISYYVFGIGKRTQANLTKSE
FT                   QAAE"
FT   CDS_pept        31056..31304
FT                   /transl_table=11
FT                   /gene="csgA"
FT                   /db_xref="GOA:P54379"
FT                   /db_xref="InterPro:IPR020255"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54379"
FT                   /protein_id="BAA33105.1"
FT                   /translation="MDVTLGYLRESLSNHLENEVCQRICKKMLAKRYANEEEFVKDLDD
FT                   NEMSFLNHVLEKEIKYAQNEQDQKRAKELNEVYELLL"
FT   CDS_pept        complement(31539..32342)
FT                   /transl_table=11
FT                   /gene="ybdS"
FT                   /db_xref="GOA:P54427"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR002137"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="PDB:5E2F"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54427"
FT                   /protein_id="BAA33106.1"
FT                   /translation="MKKWIYVVLVLSIAGIGGFSVHAASSAHEKHLNVSKMNVDDEFKD
FT                   TDGTFILHDLQKDQTFVYNRKRANQRQTPQSTFKVVNALIGLQVKAVRDEYDVKRWDGV
FT                   KREFESWNRDHTLGSAMRESAIWYYQALARDIGEERMKTWLHTLSYGNEDISGGIDQFW
FT                   LQSSLTISPLEQETFLEKLAKEELPFDKPVMKIVKRMMIQEEGDHYTLYGKTGTRLTDM
FT                   GLGWFVGFIKTEHGSYVFVTNVDDSGTKAKNITVDILKKYGLITS"
FT   CDS_pept        32515..33768
FT                   /transl_table=11
FT                   /gene="ybdT"
FT                   /db_xref="GOA:O31440"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="PDB:1IZO"
FT                   /db_xref="PDB:2ZQJ"
FT                   /db_xref="PDB:2ZQX"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31440"
FT                   /protein_id="BAA33107.1"
FT                   /translation="MNEQIPHDKSLDNSLTLLKEGYLFIKNRTERYNSDLFQARLLGKN
FT                   FICMTGAEAAKVFYDTDRFQRQNALPKRVQKSLFGVNAIQGMDGSAHIHRKMLFLSLMT
FT                   PPHQKRLAELMTEEWKAAVTRWEKADEVVLFEEAKEILCRVACYWAGVPLKETEVKERA
FT                   DDFIDMVDAFGAVGPRHWKGRRARPRAEEWIEVMIEDARAGLLKTTSGTALHEMAFHTQ
FT                   EDGSQLDSRMAAIELINVLRPIVAISYFLVFSALALHEHPKYKEWLRSGNSREREMFVQ
FT                   EVRRYYPFGPFLGALVKKDFVWNNCEFKKGTSVLLDLYGTNHDPRLWDHPDEFRPERFA
FT                   EREENLFDMIPQGGGHAEKGHRCPGEGITIEVMKASLDFLVHQIEYDVPEQSLHYSLAR
FT                   MPSLPESGFVMSGIRRKS"
FT   CDS_pept        33805..33969
FT                   /transl_table=11
FT                   /gene="ybeB"
FT                   /db_xref="UniProtKB/TrEMBL:O87098"
FT                   /protein_id="BAA33108.1"
FT                   /translation="MITSFFHRSIGRDTWSLLIPFCCPRYLTGPGGRLYQLGTFPCLAV
FT                   LLFSSSCCE"
FT   CDS_pept        34338..35957
FT                   /transl_table=11
FT                   /gene="ybeC"
FT                   /db_xref="GOA:Q45577"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q45577"
FT                   /protein_id="BAA33109.1"
FT                   /translation="MNQLHRRMGTFSLMMVGLGSMIGSGWLFGAWRAAQIAGPAAIISW
FT                   VIGMVVILFIALSYSELGSMFPEAGGMVKYTQYSHGSFIGFIAGWANWIAIVSVIPVEA
FT                   VASVQYMSSWPWEWAKWTSGLVKNGTLTGEGLAFASVLLLIYFLLNYWTVNLFSKANSL
FT                   ITIFKIIIPGLTIGALLFVGFHGENFTGGQSIAPNGWASVLTAVATSGIVFAFNGFQSP
FT                   INMAGEAKNPGKSIPIAVVGSLFVATVIYVLLQIAFIGAVNPSDIAHGWSHLNFNSPFA
FT                   DLAIALNINWLVIVLYADAFVSPSGTGITYTATTSRMVYGMEKNKYMPSIFGKLHPIYG
FT                   VPRQAMFFNLIVSFIFLFLFRGWGVLAEIISVATLISYITGPITVMTLRRTGKDLYRPL
FT                   RLKGLNVIAPLGFIFASLVLYWARWPLTGQVLFIILIGLPIYFYYQAKAKWKGFGRNFK
FT                   AGVWMVFYLLAMMVISYLGSDKFGGLNVIHYGWDMVLIAMVSLVFYVWALKSGYQTEYL
FT                   KDAKEINSQLLNGQSEAAAGKE"
FT   CDS_pept        complement(36004..36885)
FT                   /transl_table=11
FT                   /gene="ybeD"
FT                   /db_xref="GOA:P37965"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="PDB:5T91"
FT                   /db_xref="PDB:5T9B"
FT                   /db_xref="PDB:5T9C"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37965"
FT                   /protein_id="BAA33110.1"
FT                   /translation="MRKNRILALFVLSLGLLSFMVTPVSAASKGNLLSPDRILTVAHRG
FT                   ASGYVPEHTILSYETAQKMKADFIELDLQMTKDGKLIVMHDEKLDRTTNGMGWVKDHTL
FT                   ADIKKLDAGSWFNEAYPEKAKPQYVGLKVPTLEEVLDRFGKHANYYIETKSPDTYPGME
FT                   EKLIASLQKHKLLGKHSKPGQVIIQSFSKESLVKVHQLQPNLPTVQLLEAKQMASMTDA
FT                   ALEEIKTYAVGAGPDYKALNQENVRMIRSHGLLLHPYTVNNEADMHRLLDWGVTGVFTN
FT                   YPDLFHKVKKGY"
FT   CDS_pept        complement(36984..38318)
FT                   /transl_table=11
FT                   /gene="ybeE"
FT                   /db_xref="GOA:P37948"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR005267"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR021159"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37948"
FT                   /protein_id="BAA33111.1"
FT                   /translation="MLNIFKPAPHIERLDDSKMDAAYKRLRLQVFIGIFIGYAGYYLLR
FT                   KNFAFAIPYLQEQGFSKTELGLVLAAVSIAYGFSKFIMGMVSDRCNPRYFLATGLFLSA
FT                   IVNILFVSMPWVTSSVTIMFIFMFINGWFQGMGWPPCGRTMAHWFSISERGTKMSIWNV
FT                   AHNIGGGILAPLVTLGIAMFVTWKSVFFFPAIIAIIISFLIVLLVRDTPQSCGLPPIEE
FT                   YRNDYPKHAFKNQEKELTTKEILFQYVLNNKFLWYIAFANVFVYFVRYGVVDWAPTYLT
FT                   EAKGFSPEDSRWSYFLYEYAGIPGTILCGWISDRFFKSRRAPAGVLFMAGVFIAVLVYW
FT                   LNPAGNPLVDNIALISIGFLIYGPVMLIGLQAIDLAPKKAAGTAAGLTGFFGYIGGSAF
FT                   ANAIMGFVVDRFNWNGGFIMLISSCILAIVFLALTWNTGKRAEHV"
FT   CDS_pept        38615..38863
FT                   /transl_table=11
FT                   /gene="ybeF"
FT                   /db_xref="GOA:O31442"
FT                   /db_xref="InterPro:IPR020258"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31442"
FT                   /protein_id="BAA33112.1"
FT                   /translation="MDELDIAFFILPLGIMLLSIVGTCICKNPYLMPMLSLVISLVLTF
FT                   TIFNQSFLGWAVVYSLVSLALSYITLIVVRKRKESGN"
FT   CDS_pept        38955..39872
FT                   /transl_table=11
FT                   /gene="ybfA"
FT                   /db_xref="GOA:O31443"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31443"
FT                   /protein_id="BAA33113.1"
FT                   /translation="MKTRESSVGLKFRKFNRFYTNVLGFLNEHIYDSPFSLTETRILFE
FT                   IYNTPNCTAKALQDKLGLDRGYVSRIVKQFEKEDLIYKQRSKDDARHHYIFVTETGKTI
FT                   YKKLEEKANEQVELMLKVINQKEQHKLAEAMAEIEAILSQSLSARASEISIRDYFLSED
FT                   LQLLIEKQRQFYAEAHGWDDTFLAYLQETFDADIEKIWIAESGGKFAGSVGLVKHDEKT
FT                   VQLRWFLVDADFRGRGLGTQLLEHLVAYCQDMKFDRIFLWTVSTMAEARPLYKKFGFRI
FT                   SEVKQEAPLWGQQLTEERWDLELS"
FT   CDS_pept        39869..41119
FT                   /transl_table=11
FT                   /gene="ybfB"
FT                   /db_xref="GOA:O31444"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31444"
FT                   /protein_id="BAA33114.1"
FT                   /translation="MKRLHYAWIIVSVTFLILLAVQGVRLSFGAFVEPWERQFSIDRST
FT                   ISLISTVSFIVYGISQPVIGRLVDKWGARAVLAWSALLTGVSIFLTYLVTSPWQLFLLY
FT                   GLGVSLGVGGASNVAASVLVVNWFSKKRGLAFGIMEAGFGAGQMLLVPGSLMLIHWFSW
FT                   KLTVVVLGLLLIVIVFPAALLMLRNNPSEKNTEPIGGLAASEKETAPKTTALSVAGMFR
FT                   MRQFWFLIFPFLICGFTTVGLMDTHLIPFSHDHGFSTTVTSAAVSLLAGFNIAGILLSG
FT                   IVADRWSSRKILCILYAVRALSIVILIYSHEPYLLLAFAILFGLVDFATVAPTQMLATQ
FT                   YFQNYSIGLMIGWLSLAHQIGSALGAYVPGVIYTVTGEYTLAFYLSIGMLVLASVMNVM
FT                   LREPAAVTRDSAAVVDK"
FT   CDS_pept        complement(41154..41438)
FT                   /transl_table=11
FT                   /gene="ybfE"
FT                   /db_xref="GOA:O31445"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31445"
FT                   /protein_id="BAA33115.1"
FT                   /translation="MNHCLHSNTLAKIVCTVTLITLYFYFFSTRFNELIELAVQMFFAL
FT                   IGLFWVFIVSPFSRKVQISERFKQKSENARIVGMIDFVLEQKCKKSISE"
FT   CDS_pept        complement(41634..42545)
FT                   /transl_table=11
FT                   /gene="ybfF"
FT                   /db_xref="GOA:O31446"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31446"
FT                   /protein_id="BAA33116.1"
FT                   /translation="MKNDQIVFEKTKNIAHDINQMQNQQEIIDYLFRQDSLTLNQLKHY
FT                   YSEPSLPLQFLVKVAVLCMFISMTLASFLFIQAKEVFTNTILSDISPAVFSIFTVICIF
FT                   MTYTKIIKKGNKNKGKASLNQRSEFYEKNKLINTILYKKYKMDQQNIQANKHTASDNED
FT                   SMNFSAVLNHVLTISKNDKELLGYLDTRDNAMLSQLKAYFSTRPFSLPHYMSLMFCGSI
FT                   IVVYATSLFSGQINYIDIPHIFIFLLLIIFLKILIDLIKLLNISRKGQLHTVLHFAQRA
FT                   EYLRMRGVIDFILTERYNKKIM"
FT   CDS_pept        complement(42634..44832)
FT                   /transl_table=11
FT                   /gene="ybfG"
FT                   /db_xref="GOA:O31447"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR015020"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31447"
FT                   /protein_id="BAA33117.1"
FT                   /translation="MVDEMVLITQQWLNDTYSGKHGYNPVEESGKTGWDTIYGLTRALQ
FT                   IELGISEPADNFGPTTQRLFKPLKRQAPDSKPSNMNFILQGALWCKGFNPGGFTGVFYE
FT                   KTENAVKEFQKAAGLTTQDGIVTTLIMKALLDMSAFKLVSGGDSRIRQIQQNLNRDYND
FT                   YIGLMPCDGLYGRDTNKALIYALQKEEGMSTSVANGFFGNGTTSLCPTLTPGDSRTGFV
FT                   LIVQYALYCNGKSFDPGEFDGKYGVGVVSAVKAFQEFMCLPQTGYADMPTIKALLSSSG
FT                   DTTRTASACDTATIITAEKAQTLRNNGYKTVGRYLTGNVRTSSGLTSKALTSKELAVIL
FT                   DAGLKVFPIYQDGGYESSYFVKDQGTRDAYSAASAARRLGFPSGTTIYFAVDFDAYDYE
FT                   VTDKIIPYFQEIKSAFTKMQTFSTAPKYEIGVYGPRNICIRTSEAGLTKYSFVANMSTG
FT                   FSGNLGYPMPNNWAFDQFYEGTIGSGSGSIGIDKDGYSGRDSGASNVNPPSDPVYDARL
FT                   RTLTDILSTIPALENLTSLANAMFEFDTTETIFTSPELDIILSTSLLATIPSEGSPNTI
FT                   TITNGKPGAYITGLLGDTQTSLTASQIDSYQNLLNSLSLSVRNGYLEVYVNPTAESLNI
FT                   QIKIYTPDIPVGDNVTTGLTTTITFKIKTYKGVPVTSPESELALDWPSYDQYLFPVVGV
FT                   AALLLIGNMGSDLTNNKGVKVATALSAMLLAIFAYYTS"
FT   CDS_pept        complement(44907..45827)
FT                   /transl_table=11
FT                   /gene="ybfH"
FT                   /db_xref="GOA:O31448"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31448"
FT                   /protein_id="BAA33118.1"
FT                   /translation="MNIQRETSGHIAAIVTILIWGTTFISTKVLLADFSPMEILFYRFL
FT                   MGFIALILVRPNMIPFRNWRQELLFAGAGLFGVTLYFLLENIALTYTYASNVGMIVSII
FT                   PMITAVLAHFLLEGEKLRLTFLIGFISALIGLLLITFNGNVVLRLNPLGDIMAAGAALV
FT                   FGGYSIFMKKLSAYEYHIIELTQRVFLYGLLFMVPALFLFDFHFDLSRFSSASNILNML
FT                   FLGIGASALCFATWNYSVGVLGAVKSSAYIYMVPVITIAASVLILHENMTWIALLGGAL
FT                   TLLGLYISELKPKAKLLENGCKMDA"
FT   CDS_pept        complement(45824..46651)
FT                   /transl_table=11
FT                   /gene="ybfI"
FT                   /db_xref="GOA:O31449"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31449"
FT                   /protein_id="BAA33119.1"
FT                   /translation="MQNETRTLQLDPHLHIEAYRFKGIMQKFPNHFHDYYVIGFIEKGQ
FT                   RYLACQDQEYIINPGDLLLFNPRDTHSCEQIDGRTLDYRCINVMPDIMEKAVKEITGSG
FT                   HLPYFSQHVLFRHELTASLQELHILISEEKQALRKEELFLHLLEELIRHYSDVTFLSSV
FT                   PEPSDEVKMVCEFLEEHYAENVTLNDLSELTGWSKYHLLRSFTKQKGITPNSYMETIRI
FT                   NQAKKLLEQGVRPIDAAFQTGFSDQSHMTKFFKRQVGLTPKQYMKIFEKELHR"
FT   CDS_pept        46882..48036
FT                   /transl_table=11
FT                   /gene="purT"
FT                   /product="PHOSPHORIBOSYLGLYCINAMIDE FORMYLTRANSFERASE 2"
FT                   /db_xref="GOA:P39771"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005862"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39771"
FT                   /protein_id="BAA33120.1"
FT                   /translation="MYQSKKVLLLGSGELGKEVVIEAQRLGVQTVAVDSYEHAPAMQVA
FT                   HNSYVVDMLDPEQIRTIIEKENPDLIVPEVEAIATDELLKLEEEGFHVIPNARAAKLTM
FT                   DREGIRRLAAETLGLATAGYEFANTYDEFIQAAAQIGFPCVVKPLMSSSGKGQSVCRSE
FT                   ADLESCWETAMEGGRVKNGRVIVEEFIPFESEITLLTVRAVNGTAFCEPIGHVQKDGDY
FT                   IESWQPHDMTEQQIEEAKHIAKTITDELGGYGLFGVELFLAKDRVYFSEVSPRPHDTGL
FT                   VTLVTQNLSEFALHVRAILGFPITEITQLSPGASRPLKAPEELADYTVEGLENALAVPK
FT                   TQVRVFGKPITKAGRRMAVALSAADSVETARENAKKALDQLILK"
FT   CDS_pept        48180..49121
FT                   /transl_table=11
FT                   /gene="mpr"
FT                   /product="EXTRACELLULAR METALLOPROTEASE PRECURSOR"
FT                   /db_xref="GOA:P39790"
FT                   /db_xref="InterPro:IPR000126"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR008256"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="InterPro:IPR028301"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39790"
FT                   /protein_id="BAA33121.1"
FT                   /translation="MKLVPRFRKQWFAYLTVLCLALAAAVSFGVPAKAAENPQTSVSNT
FT                   GKEADATKNQTSKADQVSAPYEGTGKTSKSLYGGQTELEKNIQTLQPSSIIGTDERTRI
FT                   SSTTSFPYRATVQLSIKYPNTSSTYGCTGFLVNPNTVVTAGHCVYSQDHGWASTITAAP
FT                   GRNGSSYPYGTYSGTMFYSVKGWTESKDTNYDYGAIKLNGSPGNTVGWYGYRTTNSSSP
FT                   VGLSSSVTGFPCDKTFGTMWSDTKPIRSAETYKLTYTTDTYGCQSGSPVYRNYSDTGQT
FT                   AIAIHTNGGSSYNLGTRVTNDVFNNIQYWANQ"
FT   CDS_pept        49084..49482
FT                   /transl_table=11
FT                   /gene="ybfJ"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR019730"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31451"
FT                   /protein_id="BAA33122.1"
FT                   /translation="MYSTIFNIGQINKYSKLAIFMSILFLCGCSSQTHSSQKETTIPVT
FT                   LHVEDAKGLPVEGVQVTIVKAPSSDEEPSTEIGEILGKTDKNGDIKWDTGRKGDYSVAL
FT                   TKGETSVTHHISLTEDKKDHAIPLVFKE"
FT   CDS_pept        49648..50538
FT                   /transl_table=11
FT                   /gene="ybfK"
FT                   /db_xref="GOA:O31452"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="PDB:4CCY"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31452"
FT                   /protein_id="BAA33123.1"
FT                   /translation="MIQDSMQFAAVESGLRFYQAYDQSLSLWPIESEAFYVSTRFGKTH
FT                   IIASGPKDAPSLILLHGGLFSSAMWYPNIAAWSSQFRTYAVDIIGDKNKSIPSAAMETR
FT                   ADFAEWMKDVFDSLGLETAHLAGLSLGGSHIVNFLLRAPERVERAVVISPAEAFISFHP
FT                   DVYKYAAELTGARGAESYIKWITGDSYDLHPLLQRQIVAGVEWQDEQRSLKPTENGFPY
FT                   VFTDQELKSIQVPVLLMFGEHEAMYHQQMAFERASVLVPGIQAEIVKNAGHLLSLEQPE
FT                   YVNQRVLSFLCGGIK"
FT   CDS_pept        50734..51267
FT                   /transl_table=11
FT                   /gene="pss"
FT                   /product="PHOSPHATIDYLSERINE SYNTHASE"
FT                   /EC_number="2.7.8.8"
FT                   /db_xref="GOA:P39823"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39823"
FT                   /protein_id="BAA33124.1"
FT                   /translation="MNYIPCMITIGNFICGLLAIHSLLYHNIHSAVLFIFTGMFLDFFD
FT                   GMAARKLNAVSDMGRELDSFADLVTFGVAPSMLAYSVALYTLPFIGILCALTYSICGML
FT                   RLSKFNIEQSKLPTFIGMPIPFAGMCLVILSFTYNPILLAIGTCGLSYLMVSKIKFPHF
FT                   KKHAAENLESGRWN"
FT   CDS_pept        51258..51746
FT                   /transl_table=11
FT                   /gene="ybfM"
FT                   /db_xref="GOA:O31453"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31453"
FT                   /protein_id="BAA33125.1"
FT                   /translation="MELVQQLIADYGYLAIFLMLVLGIVGLPIPDEVMMTVVGYFTHTD
FT                   VLNYELSILISFVGALLGMLISYMIGRKAGRPFIDKYGKWVGLKEKRMMKVEKWMKKYG
FT                   PYSLILGYFIPGVRHVTCYFSGIGKMDLKTYVAFAAIGAFLWCFVFITIGRVIGIIHV"
FT   CDS_pept        51739..52530
FT                   /transl_table=11
FT                   /gene="psd"
FT                   /product="PHOSPHATIDYLSERINE DECARBOXYLASE PROENZYME"
FT                   /EC_number="4.1.1.65"
FT                   /db_xref="GOA:P39822"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR033177"
FT                   /db_xref="InterPro:IPR033178"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39822"
FT                   /protein_id="BAA33126.1"
FT                   /translation="MFNTAVKILYRSLIELTNHRLSSYLIKGFCESKISKPVIPLFSKH
FT                   FRLNWDDVDGTAADYGSLSELFIRQINLERRPVSKEAHAVVSPVDGVVQTVGIINPNQT
FT                   FTVKGKDYSFAELTGCKSADHQYNGGYFVVLYLSPRHYHRFHSPISCRYQKLAELGNRS
FT                   YPVNQLGLKYGKDVLSKNYRFVYELNSGSRNVLMIPVGAMNINSIVQTNTRTELEIGEE
FT                   LGYFSFGSTVILVFEKDAFQPSAHLAEGQEVQVGELIGYEE"
FT   CDS_pept        52585..52863
FT                   /transl_table=11
FT                   /gene="ybfN"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31454"
FT                   /protein_id="BAA33127.1"
FT                   /translation="MEKQIISWITDYQNTGDEAVLRQVREVCWPIVEAVLQEKVMDDEQ
FT                   ANNLREKGIERFPFIISKYQADVQLPVETFLQNTYRFYFHQVMRESS"
FT   CDS_pept        52969..54309
FT                   /transl_table=11
FT                   /gene="ybfO"
FT                   /db_xref="GOA:O31455"
FT                   /db_xref="InterPro:IPR007815"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31455"
FT                   /protein_id="BAA33128.1"
FT                   /translation="MKRMIVRMTLPLLIVCLAFSSFSASARAASEEKYWDHWIERHAQP
FT                   LDASNASNKDLRFLKKVLKGKRIVQLGETTHGAGEINATKVRMIKYLHEELGYDVLAFE
FT                   SGFPDTNASYLNMDQLTPKSTMKNSIYAVWHTEDVVELFDYMKEQKEKGDPLILTGFDI
FT                   QSMKNSFNVAATQWVKAVDPEKAELLSQSENDFSTLVTDSNTFDEFSQKKEKLVKNYQK
FT                   LIKFTKTHASELKENLPKEPKAYEMFMHSLQLRIDVMETYMLEEMKEKLEEYPENIEDF
FT                   SFFMRDRMMAEQFQWVADTLYPKKKIIVWGHNYHLRKQNTKMIKDWVQLNGPNMGDYLP
FT                   ERLKKQTYTIGIYAYSGASLDSSDNKTVKPVTSPPPSGSLEALLKAADRPAVFVDFLHT
FT                   KNKKGTSWMYTPRTALYWGYMEEQMILKEQYDGVIWLEHITPSVIIK"
FT   CDS_pept        54417..55304
FT                   /transl_table=11
FT                   /gene="ybfP"
FT                   /db_xref="GOA:O31456"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31456"
FT                   /protein_id="BAA33129.1"
FT                   /translation="MYYEKAVQKTINWIESHLHEQISNEDIVNVSSFSKFHFHRIFQKE
FT                   VGMSVASYIRLRRLANAAAALLYTDHRIIDIALYYQFESQEAFTRTFKKMYHMPPGAYR
FT                   TFMKRFTSKKEESYMEKKMKGWVLSGSHPFQFEMGIDRENVHQGKASGYLKSTMVQDIG
FT                   EFATMMQQFKADRYLGKRLRLSSFIKTKGVQHFASLWMRVDSAADDVLQFDNMSNRPIT
FT                   GTTNWNHYAIVLDVPENSAVISFGVQLSGPGQVWMDHVVFEEVDESVPSTNLEMPGELL
FT                   DEPVNLSFEEELQK"
FT   CDS_pept        55504..56472
FT                   /transl_table=11
FT                   /gene="ybfQ"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR020936"
FT                   /db_xref="InterPro:IPR022111"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR040503"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31457"
FT                   /protein_id="BAA33130.1"
FT                   /translation="MEKQYRVLLYYKYVPIEDPEAFREQHLAFCKELGLLGRILVSSEG
FT                   INGTVSGTVEQTEKYMETMKADPRFADMVFKIDEAEGHAFKKIFVRHKKELVTLRLEDD
FT                   VDPNETTGQHLKPAEFYEKMQDPNTIVIDARNDYEYDLGHFRGAVRPDIEAFRELPEWI
FT                   EEHKDMLEGKKILTYCTGGVRCEKFSGWLVKQGFEDVAQLDGGIVTYGKDPEVQGKLWD
FT                   GQCYVFDERISVPVNRVEHVIVGKDYFTGEPCERYVNCANPSCNKKMICTPENEYKYMR
FT                   SCSHECRTNPRNLYVKEHNMTEEEVNARLAAIETEDHAAAE"
FT   CDS_pept        complement(56508..57752)
FT                   /transl_table=11
FT                   /gene="gltP"
FT                   /product="PROTON GLUTAMATE SYMPORT PROTEIN"
FT                   /db_xref="GOA:P39817"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39817"
FT                   /protein_id="BAA33131.1"
FT                   /translation="MKKLIAFQILIALAVGAVIGHFFPDFGMALRPVGDGFIRLIKMIV
FT                   VPIVFSTIVIGAAGSGSMKKMGSLGIKTIIWFEVITTLVLGLGLLLANVLKPGVGLDLS
FT                   HLAKKDIHELSGYTDKVVDFKQMILDIIPTNIIDVMARNDLLAVIFFAILFGVAAAGIG
FT                   KASEPVMKFFESTAQIMFKLTQIVMVTAPIGVLALMAASVGQYGIELLLPMFKLVGTVF
FT                   LGLFLILFVLFPLVGLIFQIKYFEVLKMIWDLFLIAFSTTSTETILPQLMDRMEKYGCP
FT                   KRVVSFVVPSGLSLNCDGSSLYLSVSCIFLAQAFQVDMTLSQQLLMMLVLVMTSKGIAA
FT                   VPSGSLVVLLATANAVGLPAEGVAIIAGVDRVMDMARTGVNVPGHAIACIVVSKWEKAF
FT                   RQKEWVSANSQTESI"
FT   CDS_pept        complement(57897..59792)
FT                   /transl_table=11
FT                   /gene="ybfS"
FT                   /db_xref="GOA:P39816"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR011299"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/Swiss-Prot:P39816"
FT                   /protein_id="BAA33132.1"
FT                   /translation="MFKKAFQILQQLGRALMTPVAVLPAAGLLLRFGDKDLLNIPIIKD
FT                   AGGVVFDNLPLIFAVGVAIGLAGGEGVAGLAAVIGYLILTVTLDNMGKLLGLQPPYEGA
FT                   EHLIDMGVFGGIIIGLLAAYLYKRFSSIELHPVLGFFSGKRFVPIITSVSSLVIGVIFS
FT                   FVWPLIQNGINAASSLIADSTVGLFFYATIYRLLIPFGLHHIFYTPFYFMMGEYTDPST
FT                   GNTVTGDLTRFFAGDPTAGRFMMGDFPYMIFCLPAVALAIIHTARPEKKKMISGVMISA
FT                   ALTSMLTGITEPVEFSFLFVAPVLYLINSILAGVIFVVCDLFHVRHGYTFSGGGIDYVL
FT                   NYGLSTNGWVVIPVGIVFAFIYYYLFRFAILKWNLKTPGRETDEDGQNEEKAPVAKDQL
FT                   AFHVLQALGGQQNIANLDACITRLRVTVHQPSQVCKDELKRLGAVGVLEVNNNFQAIFG
FT                   TKSDALKDDIKTIMAGGVPATAAALDTVTDKPLKPDSDETFIYPIKGETVSLGDVPDQV
FT                   FSEKMMGEGFAIIPSEGKVVAPADGEIVSIFPTKHAIGFMSAGGTEILIHVGIDTVKLN
FT                   GEGFEAHVTSGQAVKQGELLLTFDLNYIKQHAASAITPVIFTNTSEEDLKHIQMK"
FT   CDS_pept        complement(59813..60562)
FT                   /transl_table=11
FT                   /gene="ybfT"
FT                   /db_xref="GOA:O31458"
FT                   /db_xref="InterPro:IPR004547"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR018321"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31458"
FT                   /protein_id="BAA33133.1"
FT                   /translation="MKILIAEHYEELCKLSAAIIKEQIQAKKDAVLGLATGSTPVGLYK
FT                   QLISDYQAGEIDFSKVTTFNLDEYAGLSPSHPQSYNHFMHEHLFQHINMQPDHIHIPQG
FT                   DNPQLEAACKVYEDLIRQAGGIDVQILGIGANGHIGFNEPGSDFEDRTRVVKLSESTIQ
FT                   ANARFFGGDPVLVPRLAISMGIKTIMEFSKHIVLLASGEEKADAIQKMAEGPVTTDVPA
FT                   SILQKHNHVTVIADYKAAQKLKSASFS"
FT   CDS_pept        60781..61488
FT                   /transl_table=11
FT                   /gene="ybgA"
FT                   /db_xref="GOA:O31459"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31459"
FT                   /protein_id="BAA33134.1"
FT                   /translation="MTALYSVIKFKIIELIKSGKYQANDQLPTESEFCEQYDVSRTTVR
FT                   LALQQLELEGYIKRIQGKGTFVSAAKIQTPIPHKITSFAEQMRGLRSESKVLELVVIPA
FT                   DHSIAELLKMKENEPVNKLVRVRYAEGEPLQYHTSYIPWKAAPGLAQEECTGSLFELLR
FT                   TKYNIEISRGTESIEPILTDETISGHLLTNVGAPAFLSESLTYDKNEEVVEYAQIITRG
FT                   DRTKFTVEQSYHS"
FT   CDS_pept        61522..61653
FT                   /transl_table=11
FT                   /gene="ybgB"
FT                   /db_xref="GOA:O31460"
FT                   /db_xref="InterPro:IPR012867"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31460"
FT                   /protein_id="BAA33135.1"
FT                   /translation="MFLFTNGKVLWGAVIAAFILSIVFYPFLPTQMPIHYDVATVRI"
FT   CDS_pept        61709..61849
FT                   /transl_table=11
FT                   /gene="ybgD"
FT                   /db_xref="UniProtKB/TrEMBL:O87100"
FT                   /protein_id="BAA33136.1"
FT                   /translation="MGAEDQLAICIRSVYFADLPHCRPLFSALNQTARIKLAVFFNFSF
FT                   I"
FT   CDS_pept        62005..63075
FT                   /transl_table=11
FT                   /gene="ybgE"
FT                   /db_xref="GOA:O31461"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31461"
FT                   /protein_id="BAA33137.1"
FT                   /translation="MNKLIEREKTVYYKEKPDPSSLGFGQYFTDYMFVMDYEEGIGWHH
FT                   PRIAPYAPLTLDPSSSVFHYGQAVFEGLKAYRTDDGRVLLFRPDQNIKRLNRSCERMSM
FT                   PPLDEELVLEALTQLVELEKDWVPKEKGTSLYIRPFVIATEPSLGVKASRSYTFMIVLS
FT                   PVGSYYGDDQLKPVRIYVEDEYVRAVNGGVGFAKTAGNYAASLQAQRKANELGYDQVLW
FT                   LDAIEKKYVEEVGSMNIFFVINGEAVTPALSGSILSGVTRASAIELIRSWGIPVREERI
FT                   SIDEVYAASARGELTEVFGTGTAAVVTPVGELNIHGKTVIVGDGQIGDLSKKLYETITD
FT                   IQLGKVKGPFNWTVEV"
FT   CDS_pept        complement(63112..64524)
FT                   /transl_table=11
FT                   /gene="ybgF"
FT                   /db_xref="GOA:O31462"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31462"
FT                   /protein_id="BAA33138.1"
FT                   /translation="MNSAHNKNETTFQRSMKSRHLFMLSLGGVIGTGLFLSSGYTIQQA
FT                   GPAGTILAYLVGAGIVYLVMLCLGELSVAMPVTGAFHTYAAKYIGPGTGFTVAWLYWLT
FT                   WTVALGSEFTAAGLLMQRWFPHTSVWMWSAVFALFIFLLNAFSVKFFAESEFWFSSIKV
FT                   LAIVLFILLGGSAMFGIIPIKGGEAAPMLSNFTAEGGLFPNGFVPILMTMLSVNFAFSG
FT                   TELIGIAAGESVDPDKTIPKAIKTTVWRLSLFFVGTIFVLSGLIPIQDAGVIKSPFVAV
FT                   FDRVGVPYAADIMNFVILTAILSAANSGLYASSRMLWSLSKEKTLHPTFAKLTSKGTPF
FT                   NALVFSMIGGILSLLSSVFAPDTVYVVLVSISGFAVVVVWMGIAASQFMFRKRYIEAGN
FT                   KVTDLKYRTPLYPFVPIAAFLLCLASVVGIAFDPNQRIALYCGVPFMAICYAIYYVKNR
FT                   KSQPAADMTHSK"
FT   CDS_pept        complement(64645..65592)
FT                   /transl_table=11
FT                   /gene="ybgG"
FT                   /db_xref="GOA:O31463"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR017226"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31463"
FT                   /protein_id="BAA33139.1"
FT                   /translation="MNPIQHILDTYPLIVLDGAMATELERKGCNLNDSLWSAKILMEEP
FT                   ELIKQVHTDYFAAGADCAITASYQSTFEGFAARGLSEAEARRLIELSVSIAAEARDEFW
FT                   SLEENRLNRPKPIIAASIGPYGAYLADGSEYRGNYAISEDELIEFHRPRMKALIEAGAD
FT                   VLACETIPCLTEAKAIVRLLKEFPETYAWISFSAKDGLHISDGTPAADCASWLDEHRQI
FT                   AALGINCTPLQHIPSLIEELKKNTSKPIIVYPNSGEQYDPETKTWNGAACAESYGASAR
FT                   TWHEKGARLIGGCCRTKPENIQEIAAWARSLKTT"
FT   CDS_pept        complement(65721..67112)
FT                   /transl_table=11
FT                   /gene="ybgH"
FT                   /db_xref="GOA:O31464"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31464"
FT                   /protein_id="BAA33140.1"
FT                   /translation="MVKAINCFAPFFWNLFLRFRLKFLQVRMLKEMVRVLREGAASRSK
FT                   NSISPFQAFCISMAARVGTGNITGIAIAIALGGPGAIFWMWIIAIIGSASSFVESTLAQ
FT                   IYKVKDVNGFRGGPAYYMEKGLNKRWMGALFAVLITLSFGIVFNSVQSNTVSLAFENAF
FT                   GTNRLTLGLILIAVFGTIIFGGVKRIAKLAESIVVVLAVLYIGVAFFVIFSNITQLPGV
FT                   LALIVKNAFGFDQAAGGALGAALMQGVRRGIFSNEAGMGSAPNAAATATTSHPVKQGLI
FT                   QAFGVLTDTLVICTSTAFIILFSDAYHTPGLSGIALTQASLSSHVGSWASGFLAILILL
FT                   FGFCALIGNYYYGETNIGFLNKSKKLIFVYRIGVLAMIVFGCVAKVQLVWDLADLFMGL
FT                   MVIVNLIAIFLLSKVVFTALKDYTRQKKAGKDPVFYKDVLKNHNGIECWPVSDTKTDTH
FT                   NKQIS"
FT   CDS_pept        complement(67182..68165)
FT                   /transl_table=11
FT                   /gene="ybgJ"
FT                   /db_xref="GOA:O31465"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="PDB:1MKI"
FT                   /db_xref="PDB:2OSU"
FT                   /db_xref="PDB:3AGF"
FT                   /db_xref="PDB:3BRM"
FT                   /db_xref="UniProtKB/Swiss-Prot:O31465"
FT                   /protein_id="BAA33141.1"
FT                   /translation="MKELIKEHQKDINPALQLHDWVEYYRPFAANGQSANYIPALGKVN
FT                   DSQLGICVLEPDGTMIHAGDWNVSFTMQSISKVISFIAACMSRGIPYVLDRVDVEPTGD
FT                   AFNSIIRLEINKPGKPFNPMINAGALTIASILPGESAYEKLEFLYSVMETLIGKRPRIH
FT                   EEVFRSEWETAHRNRALAYYLKETNFLEAEVEETLEVYLKQCAMESTTEDIALIGLILA
FT                   HDGYHPIRHEQVIPKDVAKLAKALMLTCGMYNASGKYAAFVGVPAKSGVSGGIMALVPP
FT                   SARREQPFQSGCGIGIYGPAIDEYGNSLTGGMLLKHMAQEWELSIF"
FT   CDS_pept        68516..>69650
FT                   /transl_table=11
FT                   /gene="ybgK"
FT                   /db_xref="GOA:P40758"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:P40758"
FT                   /protein_id="BAA33142.1"
FT                   /translation="MKNSGSALGHRFFSSFYHCCGMCSAVLPGFLTGAAVFIFRVFLEL
FT                   WGGGHNGLTPILYDQASGFFFYMTYACLFSILKANRFRERPIMLGFIGFMIEVVSDCVE
FT                   LTVQFLIFHTVVTPEKITDIAVIAISHTFIVMSFYSVLKLYETQSREKQTRQQHEHMLM
FT                   IVSNLYEETVHLKKTLKTTEKVTNDSYQLYREMKGKDVQLSGRILRLAGEIHEVKKDNQ
FT                   RIFAGLSKLISNESLRDYMRASDLLQLVIRMNEKYAEALGKQIDFYCSIEGEHDEYHVF
FT                   IVLSIINNLTANAVEAMDEEGMVSLRLRKPNESMVEFQVEDNGPGISEKIGDIVFDPGF
FT                   TSKYDEFGTPSTGIGLSYVKEIVTELEGDITFDNQQRG"
XX
SQ   Sequence 69650 BP; 20090 A; 13413 C; 16164 G; 19983 T; 0 other;
     atggataaat tcttaaacaa ccgctgggct gtgaaaatta ttgctctgct tttcgcgctc        60
     ttgctttatg tggcggttaa cagcaaccaa gcaccgactc caaaaaaacc gggtgaatct       120
     ttctttccga catcaacaac tgatgaagca actctgactg atattccggt taaagcgtat       180
     tatgatgatg aaaattacgt cgtgacgggt gttccgcaaa cggttaatgt cacgataaaa       240
     ggctcgacaa gcgccgtgaa aaaggctcgg cagaccaaaa actttgaaat atatgccgat       300
     atggaacatt tgaaaaccgg cacacataag gttgagctta aggccaaaaa cgtgtcggat       360
     gggctgacaa tctcaattaa tccgtctgtt acgacagtga ccattcagga acggacgacc       420
     aaaagttttc ccgtagaagt ggagtactac aacaaaagca agatgaaaaa aggctattct       480
     ccggagcagc cgattgtcag tccgaaaaat gtgcagatta ccggatcgaa aaatgtgatc       540
     gataatattt ctcttcataa agcttcagtg aatttggaaa acgcagatga aacgattgaa       600
     aaggaagcga aagtgactgt ctatgataaa gacggaaacg cgcttcctgt cgacgtggag       660
     ccctcggtca tcaagattac cgttccggtg acaagccccg agtaaaaaag tgccctttaa       720
     aattgaacgg acaggaagcc ttcctgacgg tgtcagcata gcgaatattg aatccagccc       780
     cagtgaggta acggtttacg gctcacagga tgtgttggat tctcttgaat ttattgacgg       840
     cgtcagctag atttaagtaa aattaacaag gattccgata tcgaggcaga tattccgctt       900
     cctgacggtg tcaaaaaaat ctcaccgtca aaggtgactt tgcatataga agtcgatagt       960
     gaagcggatc agaagttcga gaatgtccct atcaagactg tagggctgag cagctcacaa      1020
     aacattgaat ttcttgatcc tgaatcacaa gcgatagatg taacggctaa aggctctccc      1080
     acgaatataa ataaactgaa aaatcagata ttgaattgta tgtgaatgtt tcagatttag      1140
     aggacgggga gcatagcgtg aagcttgaag tgaacgggcc acagaatgta acttggtcct      1200
     tggggcggaa aaacgccaaa atcaagctga cgtctaagaa aagcaataca tcaacgaatg      1260
     ataacagcag caatacatca gggaaccagg acacagataa acaaacaaat tgatcaaaag      1320
     aacaatcagc aagaagatac aaagaacact gataaaacac cacggttcaa aacccaggcg      1380
     gggaattaag gtcaaaccca ggtcaggttg aggttgatcc actgcgaatt cacaatcctc      1440
     atcggaataa aaaaggagcg attataaaat gggcaagtat tttggaaagg acggtgtaag      1500
     aggtgtcgcc aatagtgagc ttacacctga gctggccttt aaagtcggac gtttcggcgg      1560
     ttatgtgctg acaaaagaca aacaacgtcc aaaagtgctg ataggccgcg atacacgcat      1620
     ctccggccat atgctggagg gagcccttgt cgccggactt ttatccattg gcgcagaagt      1680
     catgcgcctg ggtgtcattt ctacaccagg tgtatcttat ttgacaaaag cgatggatgc      1740
     agaggcgggc gtcatgattt ccgcttctca taacccagtg caggataacg gcatcaaatt      1800
     ctttggggga gatggattta agctttctga tgaacaggag gctgaaattg agcgcctgat      1860
     ggacgaacct gaggataagc tgccaagacc tgtcggagca gaccttggac ttgtaaacga      1920
     ttattttgaa ggcggacaaa aatatctgca attcttaaaa cagacagctg atgaagattt      1980
     cacaggcatt catgtggcat tggactgtgc caatggcgca acgtcatcct tggcgacgca      2040
     cctgtttgct gatttagatg cagatgtttc tacaatgggg acttccccga acggattaaa      2100
     cattaatgac ggcgtcggtt cgactcatcc cgaagcgctc agcgcgtttg tcaaagagaa      2160
     aaacgcggat ctcggtcttg cgttcgacgg tgacggcgac cgcctgattg ctgtcgatga      2220
     aaaaggaaat attgtagacg gcgaccaaat catgtacata tgctcaaaac atctgaaatc      2280
     agagggccgt ttaaaggatg atacagtggt ttcaaccgtg atgagcaacc tcggcttcta      2340
     taaggcgctc gaaaaagaag gcatcaaaag cgtgcagaca gctgtcggcg accgctacgt      2400
     agtagaagca atgaaaaaag acggctacaa cgtcggcgga gagcagtcag gacatcttat      2460
     tttccttgat tacaacacga caggggacgg attattgtct gctattatgc tgatgaacac      2520
     tttaaaagca acaggcaagc cgctgtcaga gcttgcagct gaaatgcaga agttcccgca      2580
     gctgttagtc aatgtgagag tgactgataa atataaagtt gaagaaaatg aaaaagtaaa      2640
     agcagttatt tctgaagttg aaaaagaaat gaacggcgac ggccggattt tggtgcgccc      2700
     ttcaggaact gaaccgctcg tccgtgtcat ggctgaagcg aagacgaaag agctgtgcga      2760
     tgagtatgtc aatcgcattg ttgaagtcgt ccggtcagaa atgggattag agtaacgaag      2820
     tctattatca gagagtgaac aagacaagcg aggtttacat aagataattg tgagacatac      2880
     ggcaaagttg cttaaaaaac aattgaccgt ttatgccaca tgttgtaaaa tcaagcttgt      2940
     cttgttctta ttttctcaat aggaaaagaa gacgggatta ttgctttacc tataattata      3000
     gcgcccgaac taagcgcccg gaaaaaggct tagttgacga ggatggaggt tatcgaattt      3060
     cgcggatcct cccggctgag tgtgcagatc acagccgtaa gaatttcttc aaaccaaggg      3120
     ggtgactcct tgaacaaaga gaaatcacat gatcttccaa aaaacatgta ggaggggacg      3180
     attgaaagtc cccttgaaat ttgactttct tcgtctcctt ttacaatctt aggaggaaga      3240
     aaaatatgtg tggaatcgta ggttatatcg gtcagcttga tgcgaaggaa attttattaa      3300
     aagggttaga gaagcttgag tatcgcggtt atgactctgc tggtattgct gttgccaacg      3360
     aacagggaat ccatgtgttc aaagaaaaag gacgcattgc agatcttcgt gaagttgtgg      3420
     atgccaatgt agaagcgaaa gccggaattg ggcatactcg ctgggcgaca cacggcgaac      3480
     caagctatct gaacgctcac ccgcatcaaa gcgcactggg ccgctttaca cttgttcaca      3540
     acggcgtgat cgagaactat gttcagctga agcaagagta tttgcaagat gtagagctca      3600
     aaagtgacac cgatacagaa gtagtcgttc aagtaatcga gcaattcgtc aatggaggac      3660
     ttgagacaga agaagcgttc cgcaaaacac ttacactgtt aaaaggctct tatgcaattg      3720
     ctttattcga taacgacaac agagaaacga tttttgtagc gaaaaacaaa agccctctat      3780
     tagtaggtct tggagataca ttcaacgtcg tagcatctga tgcgatggcg atgcttcaag      3840
     taaccaacga atacgtagag ctgatggata aagaaatggt tatcgtcact gatgaccaag      3900
     ttgtcatcaa aaaccttgat ggtgacgtga ttacacgtgc gtcttatatt gctgagcttg      3960
     atgccagtga tatcgaaaaa ggcacgtacc ctcactacat gttgaaagaa acggatgagc      4020
     agcctgttgt tatgcgcaaa atcatccaaa cgtatcaaga tgaaaacggc aagctgtctg      4080
     tgcctggcga tatcgctgcc gctgtagcgg aagcggaccg catctatatc attggctgcg      4140
     gaacaagcta ccatgcagga cttgtcggta aacaatatat tgaaatgtgg gcaaacgtgc      4200
     cggttgaagt gcatgtagcg agtgaattct cctacaacat gccgcttctg tctaagaaac      4260
     cgctcttcat tttcctttct caaagcggag aaacagcaga cagccgcgcg gtactcgttc      4320
     aagtcaaagc gctcggacac aaagccctga caatcacaaa cgtacctgga tcaacgcttt      4380
     ctcgtgaagc tgactataca ttgctgcttc atgcaggccc tgagatcgct gttgcgtcaa      4440
     cgaaagcata cactgcacaa atcgcagttc tggcggttct tgcttctgtg gctgctgaca      4500
     aaaatggcat caatatcgga tttgacctcg tcaaagaact cggtatcgct gcaaacgcaa      4560
     tggaagctct atgcgaccag aaagacgaaa tggaaatgat cgctcgtgaa tacctgactg      4620
     tatccagaaa tgctttcttc atcggacgcg gccttgacta cttcgtatgt gtcgaaggcg      4680
     cactgaagct gaaagagatt tcttacatcc aggcagaagg ttttgccggc ggtgagctaa      4740
     agcacggaac gattgccttg atcgaacaag gaacaccagt attcgcactg gcaactcaag      4800
     agcatgtaaa cctaagcatc cgcggaaacg tcaaagaagt tgctgctcgc ggagcaaaca      4860
     catgcatcat ctcactgaaa ggcctagacg atgcggatga cagattcgta ttgccggaag      4920
     taaacccagc gcttgctccg ttggtatctg ttgttccatt gcagctgatc gcttactatg      4980
     ctgcactgca tcgcggctgt gatgtggata aacctcgtaa ccttgcgaag agtgttactg      5040
     tggagtaata aatgtttaac ccctttggat aagattatct aaaggggtgt ttttatgtcc      5100
     aaaagcgaaa gaacgtctac agtggaaaaa tggattaaag aagttgatgg tacaggaccc      5160
     gactatcgat cgaccatggc tatagattta agatgtttcc tcattagatc ggtcaatcag      5220
     gttaaaaggc attaaaactt ggagagaaac tgcttttgcc taactgagtt ttctaatgtt      5280
     aatacagata taagagagca gttcctcatt aagatacgct tttgatagca gttggaattt      5340
     agcatgctag aaatccgaaa accggagagc ctattggaat gataacgtgt ttttttattg      5400
     acaattaata aagggcaaag aattctagaa gtcgcactta caatgtactt gtgggattag      5460
     gttttaaagt tcattctttt tttattgagt acattccggt taaagttgaa atgattcagt      5520
     aaaggacacg ccataaataa aaggtagcgt atgattgcca ttctttccat ggaaccgata      5580
     tttctaagat ttcatctttc gtaggctttc ggttcatatt acgtaatatt tttatcgaat      5640
     gaataagacc cacatcatcg attggaaaag ctgtcgggaa cctaaggcag cgcattagaa      5700
     cataattggc tgtccaagga ccgattcctc gtattttaat taagtttttt tcagcatctt      5760
     taaagttcat tttcattaat ttttccctcg ataattctcc acttgccatt aatctggcta      5820
     ttccaatgat atattcactt tttttcaccg tcattttaat atctgccagg tcggtagggg      5880
     ttaaccgtgc aattcgctcg tacggtggga acacccaata ctttttacca ttccattcaa      5940
     tagaatcgcc aaatgcttct acaaattgct tctttaagga gtacgcgaag gctaagttaa      6000
     tttgttgccc taaaactccc caacataaag cttcaaataa atcgggaatg ccgatcactc      6060
     gcaacccata aaattttcgg gcaggcattt taagtaatgg atctgctttt gccatttcat      6120
     aaaatggagt taaatcgtta tcaagatcaa accattcatg aatatatttt acaatctctt      6180
     cccgtttcca ctgctcaaca ggtctagaat cgtttaggaa ttgaacaatc atttgtttat      6240
     tattgattac gcttacctgc actaaggacc gaatttcccc aatggctata acttttgtaa      6300
     tgatattgtt ctctatttca tacatgcatt catttttttc cctggttagg tagccaaggt      6360
     tcgcattcat gtcgaaaatt tcaggtaatg taatgacaat aacatcattg acttcatgcc      6420
     atgtcacttt ttcattctcc ttatcttaaa taattataag aaaactcacg ctggttgaaa      6480
     ttagtttatc acataatcat ctttactcat tttgttatct tgctattaca ttctaaccac      6540
     cttatttttt tctatttatg aggttatagt gtagttatca agaatgctaa acgggagtag      6600
     ataaaaatgg cccaagatat aaaaaacgcg tgtcgaaaat ttaaattggg attcaattca      6660
     aagaattaga tgagcattgt aaggagaggt gagataaatg ccggatagta tcaataacgg      6720
     acataaagag agccatgatc atagaatttc gaatgatgca gaaatgataa cagatgaaaa      6780
     gtggcaagca attataaata atgatgcagc gtacaataat caatttttct acgctgttaa      6840
     atcgacaggg atattctgta aaccatcctg taaatctcgc gttccgaaaa aagaaaatgt      6900
     atgtatcttt ccaaacacag aacaagctct ccgcgcaaat tttcgccctt gtaaacgttg      6960
     caagcccact aatgaaaaaa tgcctgatag cgagtgggtt gatttaatta ctgaatacat      7020
     tgataaaaat ttcacagaaa aattaacgct agaatcgtta gcagatattt gtcatgggag      7080
     tccgtatcat atgcatcgaa catttaaaaa aattaaaggc attacgctgg ttgagtatat      7140
     acaacaagtt agagtacacg cggctaaaaa gtatttgatt cagacaaata aagcgattgg      7200
     agatatcgct atatgtgtgg gtatagctaa cgcgccttat tttattactt tatttaaaaa      7260
     gaaaactgga cagacaccag cacgatttcg tcaaatgagt aaaatggagg aaacgtacaa      7320
     tggaaacaaa taaaccaacc ctttattggt ctttactaat gttcaaggat tggaattttt      7380
     atattgcttc aactttaaag gggcttgtgt ttgtaggttc acagaacaaa ccaatcgagg      7440
     aattgttcga atgggctagg aaacgctttc cgggaagtct tcttgttgaa gatgatgata      7500
     agcttgaacc ctatgccgtt gaaatcactc aatatctaga aggaaagcgg aaaaacttta      7560
     ctgttccagt tgagtacgcc ggtacgcaat ttcagctagc cgtctggaat gcactttgtg      7620
     aaattcctta tggacagacg aaatcctatt ccgacattgc aaatgatata aataaaccag      7680
     cagctgttcg tgctgtaggt gcggctattg gggctaatcc ggtattaatt actgtaccgt      7740
     gccatcgtgt aataggaaag aatggctcat taactggcta tcggggcgga tttgaaatga      7800
     agacactgct cctcgatctg gaaaagcgag cttcatctga aatggatgtt cctcattgaa      7860
     agtgaatcat ctataatggg ttggattctt ttagaggaaa gtaaagacca gtttactgat      7920
     aaacttgaca acttttaaaa tttagcatat cttatacgta acttaataat cgatgcagat      7980
     gtttattttt ccttttaaaa tatgtaggcc tttagcattc ttttcatatt tcattttaaa      8040
     tattgatagg atgaaaaagt atcctaataa aaaaggaaga gaacatgagt cgatttattt      8100
     gataatcagg actatattaa aggaaatgaa aacatagcat aaagtaaaga ccaataataa      8160
     ggtagctctt caaaaaactt cgctgaagtt agttgaagtg aagccgacaa ttttcaggat      8220
     tcaatgatct aacataatca ttgaaatttt gaagttgtcg gcttttttgt tggaaaaaaa      8280
     tagagataaa taaaaattga aataaataat agacaaatat gatctgattg aaaggtcttt      8340
     tgaccaataa tgagttttaa aaaagggaga atttagaatg ttagtttcgc tgagtttgtc      8400
     atcattatta acattatttt ttattatgct tatggcttct gggattagtg gactattgtt      8460
     tttacatccg cgtgtaccct tgagttttgt tcgcattcat attgggatct tggctttacc      8520
     acttttggtt tccttactga ttcttgccaa tagtggtgtg agtggaaatg ttggcccttg      8580
     gcacttagat tccttagctt gtttaatgac tttctttgtt cttgcaattg gattcatcat      8640
     tcagcgtttt tctgtacgtt acttaatggg ggatcgatct tatcgaaaat attttacgct      8700
     ttttactttc acaacaggag ctgcttcaat gacatggtta agtggtgatc tccgcttgat      8760
     ggttctattt tggggagcaa ctcttgttgg tttaacctta cttataaggt taaacagtgc      8820
     ttggcaagtg gctagtgaag cagccaaaat ttctggacgg ttatttttgt taagttggtt      8880
     ttctttgttt tttgcgatga tgtggctttt tcatgccaca ggtcaatggc agctatcatt      8940
     ggttgtaaca aatgaaagtt tagctgggct gggagaatgg gagagaacag ggattcagct      9000
     attgattgta ctggcggtga tcattcctgc agctcaatgg ccgttccaaa gatggttggt      9060
     tgagtctatt gttgctccca ccccagtttc tgcaattatg catgcaggtt tagtaaatgc      9120
     tggaggaata atactaactc gattttcacc tctatttcat ggtggtatcg cttcgattat      9180
     cttacttctg cttgctagca tttctgtatt gattggaact ggaattagtt tagttcaggt      9240
     tgattataaa cgccagttag taggctccac gattggacaa atggggttta tgctcattca      9300
     gtgtgcatta ggcgcctata tagcagccat tattcacctt attttacatg gtttattcaa      9360
     ggctacgttg tttctacagg ctggttcagc agtagggcgt catgaagtat cgactcgcac      9420
     taatgaaaga acatcctatt tatgggtcat ggctggtcgg attttatcct tagttatagg      9480
     tgttgctttt tggctcactg ctcctggaga cgggtatcac ttaatcagtg cgctgatctt      9540
     agggtggtca ttgtccgttt cttgggatca gcttgtcgct tttggagagg gccgaattgg      9600
     ccggattgcc ggtttaactg ttttaggagg agcagccctc gtatatttta tcattcatca      9660
     ccttttctat aagtggctgc atacaaccat ttttcaaagt gttcaacctc caatgtcagc      9720
     tgtcatgatt gtcgtatgtc tcttactctt tggcagtgct ttaggtacgt gggttgctcg      9780
     tcatcgttct tccgtttttt tcgcggtact ctatctttgg ttagtccgat taggtgaagc      9840
     aaaaccaaag tcagtagaga gtcacccaga ctaccttaaa caatatattt cataaggagc      9900
     taatctgaga tgggcattac atccgtatta acgaaagata atgtaaaaaa gatagataca      9960
     gatattgatg ttcaagaaag ggatcttaac gttttcatta catctgccag ccgagtgatt     10020
     gcgccacttt ggcctatttc tacatttgct gcacgtaatc cgtggatggg acttgaaaac     10080
     caaccttttg atcaggttgc aagttggttg aaaaacactc gcgatgttga tatataccct     10140
     agtgcgtcta tgatccgttc agcaaagaat aaaggtgaga ttgatgaaga ttttgtggaa     10200
     atggggctgc agcgttggct tgattcacat tcctatcaca tcccacggga cgtagcagag     10260
     cgattttgtc atgctgcatt aaagttagat cccctggcct tccgaccttt tatcatcaca     10320
     tgagctggga gaaattagta agtgaatgta gtggattgga tcatatcgag aatgtgttta     10380
     tgcagccact aagttcgtat atagagaatc aagatggtga aaggctagtc aatatactag     10440
     atcatcatgt cattaaatgg agtaaattat atcttgatga ctctcaagcg ggttggacaa     10500
     tgcctaatcg tgaggaaggt ttctatcgtg cttggcagca tcttattcaa tatgatccag     10560
     cacttagcaa aaagcagcga gaaagggtaa aaggttggcc gaaagaggca catttggctt     10620
     tacaagaagc tttattcgca ctagaaatcc cagagtcaga aatccagact tatcttgaag     10680
     gtcatttact ttcattacct ggatgggcag ggatgatgct ttggcgctcc caacaatcga     10740
     gccacgaaca tgcactacta acagaatatt tagcggttcg aatatccatg gagtgggctc     10800
     ttataaagcc atacttacct ttgactaatg aacgatctaa gaaaacaatt tcaattgctc     10860
     cccttatagc agcttggatt cattggggtg ggcttacatt agaagaatgg tcacagatga     10920
     cggccagtga acaaaacgaa tatttatcat ttgcctacag ctttgatgag aaacttcgca     10980
     agaaactttg gttagaagct tgggaacaaa cgtacactga tcgattaagc cagaagatca     11040
     tctcgaaaca acgtgaaacc ggccgtgaaa aatctgcatt agctcaatta gcattctgca     11100
     tcgatgtacg atcagaacct tttcgtcgtc aactagaaaa agaaggcccg tttgaaacga     11160
     ttggtattgc tggtttcttc ggggtgccga ttgcaacttg tgaacttggc agtaaacaca     11220
     gtcatgcttc cttgccgatc atacaaaaac cgcaaaataa aataaaagag ttcgcagatg     11280
     aggatgtatt caaaaaatac aatcaacgga agcaagcaat tcattcttta agccatacct     11340
     ttaaaacgat gaagcagaat gcgctttcga gcttactact gcctgagcta agtggacctt     11400
     ggcttactct gcaaatggca gcccgtagct ttgtgccaag aaaggcgggt cgtttcattc     11460
     gtaatctccg tgaggcttgg ttacgcaaac ctgatacaaa actctcgctt catcatgatg     11520
     ctacagaggc agaaatacct gtgggtttta ctgatgaaga aaaagtgaac tatgctcgcc     11580
     aagcattaaa aatgatgggg ttaacagaga acatcgcacc attggtcgtg atttgtgggc     11640
     atggcagtca aagtactaat aatccttatt ctgcagccct tgattgtggt gcctgtggtg     11700
     gagcggccgg tggattcaat gcaagagttt tagctgcttt atgtaatcta tcagaggtac     11760
     gagaagctct tttagctgat ggaattaaaa ttcctgagga tacagttttt gcagcagctg     11820
     aacataatac aacagtagat gaattacatt ggctttatgt accagagctt tccgaagctg     11880
     cacaagaagc atttgaacaa attgaagccg ttatgccgaa agtgagacat catgtaaacg     11940
     cagaacgtct agcccaatta ccgaatttcc aatcgaagct aaaaaatccg aaggctgagg     12000
     caaaccgatt tgcggaagat tggagtgaga tacgtccgga atggggactg gctcgtaatg     12060
     ccgcttttat tatcggtaaa cgtgaattaa ctcaggattg tggtttggaa ggcagagcct     12120
     ttttccataa ttatgattgg aagcaggatg aaagcggtga actcctagca aatattattg     12180
     taggacctgg aactgtagcc caatggatta atttacaata ttacgcatca acggtagcac     12240
     ctcattatta tggcagcgga aataaagcaa ctcaaaccgt tactgcaggt ctcggcgtta     12300
     tgcaggggga atgcaagcga tttgttagcc ggactgcctt ggcaatccgt catggaatca     12360
     gatcacgagg cctatcattc tcctcttcgt ttattgatac tcatccaagc acctagagaa     12420
     catgtagaac ggttattaaa tgcatcatga ttcagcattt ctgcaaaaag ttcaaaatgg     12480
     atgggtccga ctggctagtc ttgatccaga aggatgttgg gaaaagctgg taatgatgaa     12540
     tctaagcatt tatcaaatgg atttgttact caatacaaaa atgataaaca taaggaagag     12600
     gtgtactgta tgaatgtaaa ccaaattaaa aaagtattat ttttgacgga tattgaaaac     12660
     ggtttggagc ctattttaca agaagcgact aacacttctg cagagaatat gttgactata     12720
     ccaagctatg gtgccagtat ttcacatcct tatggagaaa tcatgaggtc tgttattttt     12780
     gcgatttacc aggaagatgt tgaggagatt tttgtagtag gaacaaaaga ttagaagact     12840
     tctgcaggta atggactaac tcaacttgaa acaatgaaag ataagataca aacattggat     12900
     tatctgtttc aaaattgcaa gcctgaattt ttaggtggta cggtcgatga atggctaaat     12960
     gaaaatagca gtgacaccat tgaaaaaagt gttgatatga ttcgacatca tcccctagtg     13020
     ccgtcatatg ttaaagttag aggtttattc gttaatcata agggtggaaa accctcaatc     13080
     gcggaggttc ctgatgttaa aacaggtcaa gccatgcctg atcattgctt gtcatgatga     13140
     aatgcaggtt taacttctaa acgcacccat atatggagaa agcagttcta aggagattgt     13200
     atgagcgcta atttaactga ttttgtcacg aaaacaatag aggaaatgaa ctcgtttgat     13260
     cgtgaaaata tggaatgtat aaaaaaacta attagaaaag caattgattt ttatcatcta     13320
     aagtcttatg aagaagttga ggaaacccat tcaggaaatg ttcgattttt gcatgtccac     13380
     tctatgatgg aagaaaatat gttatccaaa atgatagtgg tcacaagaaa cggtaaaact     13440
     gatttggata ttgaaggtgt atatgaagga tatgttgtaa gagaatatta atgagacgaa     13500
     atcacaaata gaatatgcca atttttttgc tcaggagatg tattagatat gaaaaagtct     13560
     aagggttcta ttgaatcaga gatcagtaag tccattactc aatgggagaa ggattatctt     13620
     gggcgggggt ctgtatctgt taagactgat atactgcggg acatgatcat cgtcaattta     13680
     aaagggattt taacaccagc cgaatatgta gtttgtggat caaaagaggg tatgttatct     13740
     atcaaacaaa ctcgttcaga gttagtcgaa tcaggtatag aaggccttaa ggatattatc     13800
     ttaaaaataa ccggagaaaa agtgaaaagt tttcatactg atttaagctc ccggacaggt     13860
     gaacgagtga tggtatttaa attatgtaat gatctagaga aaaatttgga aaagatctta     13920
     taatctaaag aaaataaatg ttttgacggt gtggaatttg ttgtgaattg accataaaga     13980
     actgccgatt ccttttgatt tacaattatg gtatcattga taacatttta ttcatatcct     14040
     aagcggacat aaagagatgt caaattcata gtacactgtc atgttaatcc tgtcgaaaga     14100
     tctaacatcc gctgttgtta tgagcggatg gttttttaca tctattttaa atacatgcat     14160
     ttgatgctgg tgattagtca cttgaacaat atttgaaaac atccttgtca cctgccgggt     14220
     ttccccaagt gtttagtgac atgattatga gaccaacttc gtaaagcttg ctgataaatt     14280
     taagcggtga acaaaattga tatgctgtct tcagtttcat ttcacggaat tagtcagaga     14340
     taaaccttta attaaatata tccaaaaaac ggattgacat atcgaaatat aacgatataa     14400
     taatcgatat ggaaccaatt gaagtattca aagccttatc aaatgaatca aggctgcaaa     14460
     ttttacaatg gctgaaggag cccgatcgtc attttgcacc ccatgaaggg attgatatga     14520
     acacaatcgg ggtatgtgtc agtcaaataa cagacaaatt gaaaatgacg caatcgacag     14580
     cttctcaata tcttaccatc cttttaagag ccggcctaat taaggcggag cgaagtcgga     14640
     aagtacacgt attataaaag agatgaagaa gccattggga aacttgctga ctttcttaaa     14700
     acagagatat aaaaataaac atcaaaagat gtttattttt acaccataca tatcgacata     14760
     ttacgatgtg tttatttttt tataataaca tatcgataat tcgtgatatg tttattaata     14820
     attaaggagt gaatgtttta tgtctaacac ttggaaaatt tatattttag ccattgtcag     14880
     ctttttagtt ggaacctcag agtacatcat ttccggaatt ttggatcaaa ttgctcatac     14940
     tctcgggatc actttagctg ccgcgggcca gcttattacc attttctcac ttgtatatgc     15000
     tctttctaca cccgtactta tggcgttgac agcaagtatg gatagacgca aattgatgat     15060
     gtatgcccta ggtttgtttg tgttcggtaa tgtcctggct tttgtactgc ctggttatgg     15120
     atggtttatt gcagcgcgga tcattatggc gatgggagca ggtgtggttg ttgtcaccgc     15180
     attaacgatt gccgctaaga ttgcatcgga agggaagcag ggcagtgcca tcgctacggt     15240
     cgtgatggga tttaccgctt ctttaatcat tggtgttccg cttggaagaa tgatagcagt     15300
     agcattaggc tggaagtctg tatttggagc cattgctttg ttgggattga tcgcaatggt     15360
     cgttattttc tttactcttc cgtatactga aggggataag cctgtgcctt tgcttcaaca     15420
     gcttgctctt ttcaaaaaac ggaaagtggc tatgggatta tcaatcactt tcttctggct     15480
     cgggggatat tctgttgctt acacttattt gtcaccgtat ctcttgaaca tctcaggtat     15540
     aaatggcaag ctgctcagcg gtgttttgct tatatttgga attgccagtt tggttggatc     15600
     gaagtttggg ggatatagca ccgataaatg gggagtgccc tttacactcg ttggcgggat     15660
     gacgttgcat atcgtcacac tgattctgct gtcacttgtt actcattcct atatcggagt     15720
     gttggtgatt ctcatattat ggtcgtttgc cgcatggtcc accggtccga cacagcaatt     15780
     tcacctggct acaatagaac cggaaatgtc aggtgttttg cttagcatga atcagtcaat     15840
     gatgcaattc gccatggcgg tcggcgcagg tataggaggg gtttttgtgg aaaacgtatc     15900
     attggcctcg attacctggg ttggtgcgtt aggggttatg attgcaatta ttgcatcatt     15960
     gctgattttc aattcgcaac cgaaacaagc gctaaaagat atcaatcaat aatttcgaaa     16020
     gttctaacat ccgctcgtta tacaagcggg tgtttttttt agcgtagtca gtccatgcat     16080
     gagtcttcca agggccgaca tcgttctgta tgtgtcgaag gtgcactgaa gctgaatgag     16140
     atttcttaag gctttgccgc ggcgagctga agtacagtac gattgccttg atcgaacact     16200
     ggaaacacaa gagaacgtaa acctgaacat ccgcgtaaac gtcaaggaag ttgccacttg     16260
     gggagtaaac acttgcatca tctcgctgaa aggcctagac aatgcggatg acagattcgt     16320
     attgccggaa gtaaacacag cgcttgctct gtttccgttg tcgattgcag ctgattgctt     16380
     actaatgctg ccctgcatct cggttgtgat gtcgataagc agcgtaatga agagtgttac     16440
     tgtggagtaa gatgtttaac ccctctggat attttagccg aaggggtttt tagtatagat     16500
     atttgattta aattacagga gacttcattc atttaaccaa agtcattgct ttcttaatca     16560
     ctaaagttta tttgaaaata atctcttgat ttaatttcct cgaagagatt ttttgtcaat     16620
     ctattaggca tcagaatttt tataacataa tggaccgtct ttttgacgtt ttgtttatag     16680
     aacaagaaaa tattcaaaac ataagtggaa aattaggggt gagctcctgt ttttctcgag     16740
     aggatagctt gtcagctttt ctatttttaa agggttaaaa tattctattt atactaatta     16800
     atgtaatttt taggataata tacaaaatcc cccttacttc gacaattgca atctggtatt     16860
     atcgtatcgc atgggagcta tgtcaataga ctctatgcaa aaattgagag gaggtttact     16920
     tatgaaaaga aaccaaaaag aatgggaatc tgtgagtaaa aaaggactta tgaagccggg     16980
     aggtacttcg attgtgaaag ctgctggctg catgggctgt tgggcctcga agagtattgc     17040
     tatgacacgt gtttgtgcac ttccgcatcc tgctatgaga gctatttaac atttgagaat     17100
     agggagttga gcgtatttgc ttatactcct tattttctct taagggggat tttatatgtc     17160
     atatgatcgt gttaaagatt ttgatttgcc agagttagcg gttcatttac agcctcatgg     17220
     tgctgtaatg attgatagaa aaagtatgtt ttatttcaga ctcagtggac gtggagcaca     17280
     gttggcgttt ctgttatcaa aaaacaaaaa tcttcataaa acggcacgta tttgggagat     17340
     tatgaaaaaa gaagagatga gtgctgacca attaaaagaa gagcttagtg cccatccatt     17400
     tacggaggct tggacggaag ggctgttaga tcagccttta cacgtttcgg gttcgctaga     17460
     ttcatattta cctattagtt gtaccttaca gttgacaaat gcttgtaatt taagctgttc     17520
     gcttttgcta tgccagctca ggtaaaccat atcctgagga attatctagt gaacaatgga     17580
     tattggttat gcaaaagcta gcagcccatg gagttgctga tattacgctg accgggggtg     17640
     aagcaaagct gatcaaaggg tttaaagaat tagtcgttgt tgcaagttcg ttgtttacca     17700
     atgtgaatgt atttagtaat ggattgaact ggcgagatga agaagttgaa ttacttagtc     17760
     acttaggcaa tgtttctgta cagattagta ttgatggtat ggataataca catgaccaat     17820
     taagaggcag aaaaggcggc tttaaagaaa gtatgaatac cattaaaaaa ttatcagaag     17880
     caaacattcc agtgattgtc gctatgacca ttaatgagtc caatgctgat gaagtatcca     17940
     gatgtggtgg agcaatgtgc caatgcgggt gcttttatct ttcgtgcagg aaaaacgtta     18000
     tctgttggac gtgcgacaga aggctttaag gctttggata ttgattttga agaaatggtt     18060
     caaatacagc ttagggaagc acgtcataaa tggggagatc gcctgaacat aattgattgg     18120
     gagcacgaag agagttcgtt cacaacagat ttttgtacac caggatatct tgcttggtat     18180
     ataagagcag atggatacgt aactccttgc caattagaag atttgccgct agggcatatt     18240
     ttagaagata gcatggctga cattggttca cctgctcgtt tgcttcagtt aaaatgtgaa     18300
     gcaaaaaatt gcaaatgtat agggaaaatt gagctatctg aaccggactt accttttcaa     18360
     aaagaagtca aggcagggat tcaggaatga atagtctatc attggtgttc tggagtattt     18420
     tagcagttgt tggattactg ttatttatta aattcaaacc cccaacaatt gcttcactac     18480
     tcttaagcaa agatgaggca aaagaaataa gcattcaatt tataaaagag tttgttggga     18540
     tagatgtaga gaactgggat ttttattcag tatattggta tgaccacgat acagtaaata     18600
     aacttcatca cttaggcata cttaagaaaa atagaaaggt tttatatgat gttgggttgg     18660
     tcgaatcatg gagagtccgt ttcgttcacc agaatcaatc atttgtagtt ggtgtcaatg     18720
     ccaatcgaga aatcactttt ttttatgcgg atgttccgaa aaaaaccctt tcggggaagt     18780
     ttgaacaagt ttctccagag acactcaagc agaggttaat ggcttcacct gatggacttt     18840
     ggtctagagc aaatatgact ggtactggta aaaaagagga ggattttcgc gaggtcagta     18900
     cttattggta catagcggaa gcggagatat tcggctcaaa gtgactgttg aattacaggg     18960
     cggccgaatt tcttatattg gtactgaaca agaaatacta acagatcaaa tgagtaaagt     19020
     cattcgagat gaacaagtgg aatcgacatt cggagtatct ggtatgctgg gttcagcttt     19080
     agcgatgatc cttgcgattc tcatccttgt atttatggat gtgcaaacaa gcataatctt     19140
     cagtcttgtt ctgggtttgt tgattataat atgccagtca ttgacgctga aagaagatat     19200
     tcaattaaca attgtaaatg cttatgatgc aagaatgagt gtcaaaacgg tcagtttatt     19260
     aggtattttg tctacacttc ttacaggatt attaacagga tttgtagtat ttatatgttc     19320
     attggcagga aatgcgcttg ctggtgattt tggatggaaa acgtttgaac aaccaatagt     19380
     tcagattttc tatggaatag gagcagggct cattagttta ggagtgactt ctctgctgtt     19440
     taacttattg gagaaaaagc aatatttacg aatttcacct gagctttcta accgaactgt     19500
     ctttctatca ggttttacct ttaggcaagg attgaatatg agcatacaaa gttcaattgg     19560
     agaagaggtc atctatcggc tattaatgat tccagtcatt tggtggatga gtggaaatat     19620
     cctcatctcc attattgtat cttccttttt atgggcggtg atgcaccaag taactggata     19680
     tgacccaagg tggatacgtt ggctgcatct atttatattc ggttgctttc tgggagttct     19740
     cttcatcaaa tttggtttta tttgtgtatt agtagctcat ttcattcata atttagtact     19800
     cgtctgtatg ccgctgtggc agttcaagct tcagaaacat atgcatcatg atcagccaaa     19860
     gcatacttca ctctaatgat taggagaaga tttgatgcaa ttgatgcaag tacaaaattt     19920
     aagcaaatgc tatcgaaatg gtgatggggt tgaacatttg tctttctcaa ttcaacgagg     19980
     agaaatcgtg gcgctattgg ggccaaatgg agctggaaaa acaacgacaa ttcgatgttt     20040
     gacaggtctc tataagccgg ataaaggaga tatcctcatt gagggttctc ctccaggaga     20100
     tataaatgtt caaaaaaaag tcgcgcttat tcctgatcag ccatatttgt atcccgcttt     20160
     aactgctgct gaacatattc agtttagggc aagaggatat catccaggta aaaaagatgt     20220
     aaaagaaagg gtttatcatg cattgaagga agtgcacttg gaggagaaag caaaccaatt     20280
     gtgtggtcag ctgtcaagag gccaaaagca gcgggttgtc ctggcggggg cgattgttca     20340
     agacgctttg ctgtatatat tagacgaacc gactgtgggc cttgatatcc catcaaaaca     20400
     gtggctctct aactggttaa aaactaaaac cgatcaaggg tgttcagcat ttgtatcaac     20460
     tcatagtcta gagtttgtta tagagacagc agacagggtg atattaatta gagacggcaa     20520
     actcatgcag gatttgtatg tccctcaatt cgaagaacaa gcggaatgga gaaaagaagt     20580
     gattcgtctt ctaggggaat ggtcagatga ataatatcat ttctttttta tggcttcagt     20640
     caaaaaggcg ttttgtaagt caaggtcagg aaaaaaaaat gccttttttg atcatgctcc     20700
     tttttgttgg ggccatcgga tttcaagtaa gttttgtttc tagatctacg acatgggata     20760
     tgagtattgc tggttgggta cttacaggtg tttttatcct ttatacggca tttggacttt     20820
     tttcaaatcg attaccaagt caaatggcag atattatatg gctttatggc actgccacat     20880
     ctttttcaaa agttgtgtat agtgttttat ttttcagcgt cacttggaag gcgttgcttt     20940
     ggatcatctc agccatattc ggtgatgtat taattgtgct tctgtctggt gatcatatca     21000
     atttattagg ccgatccata atttttgtag ggctcttttt tatcgctgaa gtgtggttga     21060
     tgtcggtctc ttgtgccaga acagtgaaga aaatgaaaag ggtatacgtt ttagtctttc     21120
     ttctaatgtt aggcatttac tccatatgtc tttatcgctt cttctttctc caacattcat     21180
     ctgggatatg ggagagcatt gcccgtttta ttagtggcgt tggattagtg tttgatacat     21240
     tgtcaccgtt gtatgtggtt gtatttattg ggattatcac agtctctttt attacaattg     21300
     cttttacgag ccgtcaggta gaaataaagg aatcgttggt gaaagaagct gaattctggg     21360
     aggaatttca agaacgtcaa tttggttcag gtcaaattat acagaaacca aaaacgactt     21420
     ggtggggctt gcaaggtcta aatggcattt ggtcttttct gtggttggaa ctgttgcttt     21480
     ttaaaaaata tttatttttt catagcattc atacggtcat gctcagtggc gtcttttatg     21540
     tcgtcatttt catgtatcca gaatggtttt atcttctatt ctttcttatc gtctcggcag     21600
     tcatgttaag ttcctattat tcaggaattg tcagacattc tcaatcaggc acccttcatt     21660
     tattccccgg tgccctttgg aaaaaaatca ttattctaga gctgacgaat acagtctggt     21720
     tgtatattct ttactgtgtt tctattactt ttatggcagt tgggaattta gtttattggt     21780
     atatatatgg cttagggata tatatatggt tcatgacaat aaggcttttt gcttttaccc     21840
     atacaaaccg aaacgatatt aagcttcttt cattgcctca atactacaag tcatttttta     21900
     tggcattagg cctgaccggc atttgtttgt atgtaattca tttattgact gctgactggt     21960
     atacattagt ggtggtcgtc tgcataggga gcctaagttg gtgcctgttt tatcgtttca     22020
     aatagtggtt atgtagagta attgttttaa aacgaggaga ggggctcttt tatgaattca     22080
     aatggtgata aattgtcgtt atctgttcag aatttagcga atacaaatga gatcacaatt     22140
     gttcaagcga taggtgagct aaagaaatcg ggaaaagatg caataccagt tttggttgag     22200
     gccttaaaag aggaaggctc tttgtgtaat attgctgcag ctgttttagg tgagtttggg     22260
     gaagacgcga gtgaagcagc ggaggagcta tcatgtttat taaaaagtca tgcggaagat     22320
     acaagaatgg cagcggcgat ttcattaatg agaatcggga agcccagtct gccctttgtc     22380
     atcaaaatcg ctcatgaaag tgaagggcaa tcgtcttttg ggcatcttgg tgtattgcat     22440
     ggattgatcc gtcttgcatt gaacctaaga tgtataaatg tctaaaatac gagcatgaac     22500
     atccttcagg aatagttgct ccgtttgcgg ctgaagaggc attaggaaag ctgattgctt     22560
     ttcagctgaa agataaggag gactgaaagg atgaaagatg gacaaatgtt gactgaatgg     22620
     ccaagtcatt taccatggtt gaatcaatca cagaatgatt ttacatttcc aagtgacaca     22680
     tatcttcttc tttatttttg gtcaatgagc tgtccaaact gtcaccaatt tacagacaaa     22740
     gtccttcaag atataaagga tatgaatgtg aaagtaatcg gagtacatgt cccctatata     22800
     gaagaagaga aatctatgga ggttgtcttg acgtatgctc ttgatagggg actagctatt     22860
     ccgattgtat tagaccaaaa ctatgagatc gtcacaactt gtcacgtaca aggcatcccc     22920
     agcttttgtc tattaagtca atacggtcag atcattacta aaacgatggg agatgttagt     22980
     tgggataaga tgttaaaaaa gattgcaggc ttgtgaaatt ttccgtcttg tatgtgcgac     23040
     aaacggttga atattatgat gaaacggtcc ttcctataag caggaaggtt ttttaatgaa     23100
     ataatttttt attagtaggt aaattcatca aatgttctgc tatgctccaa atgtacacct     23160
     ttccgtaagg gcaaagtcaa atgtgaaaaa aaactgttcc aaagttaatc agaaatttat     23220
     tttcatattg tatccttcgg tatcaaggtg aaaggagcat catatgaaaa cattatggaa     23280
     agtcctcaaa attgtttttg tcagcttggc tgctttggtt ttgcttgtat ccgtctcggt     23340
     atttatttat caccatttcc agctaaataa ggaggcggca ctgctgaaag gtaaaggcac     23400
     agtagtcgat gttgacggta aaaagatgaa tgtgtatcaa gagggaagcg ggaaggatac     23460
     gtttgtgttt atgtccggtt cgggtattgc tgcgcctgct tatgaaatga aggggctgta     23520
     cagcaagttt tcaaaagaaa ataagattgc tgttgtagat cgggcaggtt atggatacag     23580
     tgaagtgtct cacgatgaca gagatattga tacggtattg gaacagacga ggaaagcgct     23640
     tatgaaaagc ggaaataagc ctccttatat tttaatgcct cattcgatat ccgggattga     23700
     agcgatgtat tgggcacaga aatatcccta aggaaattca aggccattat tgcgatggat     23760
     attggattgc cccagcagta cgtcacgtat aaattgagcg gagttgaccg attgaaagtg     23820
     agagggttcc acctgttaac ctcgattggt tttcatcggt ttataccttc cgctgtatat     23880
     aatcctgagg tgattcgaca gtcgttttta actgatgaag aaaaagaaat ctataaagcc     23940
     attaacttta agcaattttt taatgcagat atggagcatg agcttttaca gtcttaccaa     24000
     aacggcagca aatctgtgaa tctgcctgcg ccaaaggaaa ctcccgtctt gattttagat     24060
     gcagtctctg accaaaatag acattcaaag tatgctatac aaaacccgga aaagactatg     24120
     aaccgtttgc ggctcaattc aatactgccg atataaaggg aactgagggg aacacacagt     24180
     atttatttat atcagcctga tcaaatatat aaactgtcca tggagtttat gagaaaggtt     24240
     cgctaggatg aagggttatc gtattttaat cgttgaggac gatgtgatga ttggtgattt     24300
     gctgcaaaag attttgcagc gcgagggata tcgtgtgata tggaaaacag atggagcgga     24360
     tgtgctttcg gtgattcaga aggtggattt ggtcattatg gatgtgatgc tgccgggtga     24420
     agacgggtat caaatgtctg caaaaatcaa aaagctgggg ctgggcattc cggttatttt     24480
     tctctcagcc cgcaatgaca tggacagcaa gcttcaaggt ttgcagatcg gcgaggatta     24540
     tatggtaaag ccctttgatc cgagagagct gctattaaga atgcggaata tgcttgagca     24600
     tcattatggg acctttacgc aaatcaaaca tttgtatatt gatgcggtaa cgaaaaaagt     24660
     gttcaatgaa agcctgcatg atgaggtatt atttactgcg attgagcgga aaattttctt     24720
     ttatttatat gaaaatagag acagtatcct gacaaaggaa catttctttg aatatctatg     24780
     gcagctcgaa gatagaaacc cgaatattgt caatgtgcat attaaaaaaa ttagagctaa     24840
     aatcaatgat caagcgggtg agatgattga aaatatatat ggagaagggt atcggctgaa     24900
     taccgttgtg aagaaatgaa gctcaagaca aaatatcagt tgttattgtt tacggccgtc     24960
     attagtgttc cgatgctatt gctggcggtc agtgttttga tgtcggtgat ttatgacagc     25020
     atgtttaaac cgatgaatca tggtatgccc tttcacaggt cgtttgcata cccggcaatg     25080
     atcgttgtat ttttgatatc actcttattg ttagcttttt tattttcaaa gtcgattcat     25140
     tctctgttgc ataaaatcaa tctattaaat caaaccattc ggcatttggc gagtgatcaa     25200
     agggtgcccg ataaaattga agtgaagcgt gctgatgaaa tcggggaact gatcaagtcg     25260
     gtcaatttgt taattgaacg gacgacatat cgtgaactgg agctgagaca gcaggaggaa     25320
     atcaaaaagg agcttttgca aaaactgcgg catgacatta atacaccttt aacggctctc     25380
     aggctgcagt tattttattt ggaagaccaa tgtcatggtc aggctgtatt cgaatcattg     25440
     tatcagcaaa tcgaatatat ctcggaatta actaatgaat tcaatctata ttccgctgag     25500
     acgctggaaa gctcttatat tgtaaatgaa gaagtgcgtc taaacgagct attagaaaca     25560
     gcggtgaaaa agtgggatta tttatacagt atgagtggga ttgagctgca ctataagccg     25620
     gcagatcaag atgtgatatg gatgagcaac acgttatgga tggaaaggct gtttgataat     25680
     atttttcaaa atacgttaag gcattcaaaa gctaaaaaga tggaagtcac gattgaacat     25740
     ggcgatgttt ttattcgtga tgacggtatt ggatttgatc ggaatgagag cagtgaggga     25800
     cttgggttaa agattattga ggatacatgc aggctgcttg cgattactta tgagctgcat     25860
     acaaatgata acggaacggg gttcttgttt tcaaaagagt gaccccgctg atgtttttct     25920
     ttctcctata aaatttatat aatagggaga aagaaatggg gtgaacatca tatgtttaaa     25980
     aaaatcatca aaacgattaa gtacctctca agcagttcta gtgaccgata tcgcagacac     26040
     cggcattaca gcagcagccg gcgcagacat tatcgcagct acagcagcag ttcgggcaaa     26100
     agaagacact acgaccgtta tggcggcagt catcgttaca aacgccggag ctacagcagc     26160
     agttaatcca aaaaaagttc ttgttccgct tttgggacaa gggttttttt atgtgaccga     26220
     ttgaatggcc cggtttagat cctcgcgaat ggaagcggtg tgctgatact cttcctcaat     26280
     gcccaataat cttttcagca gcaaggttac ttcctttgtc agtgttaatt cctccagcca     26340
     agtgccgttt ttcttctttt ttcctttata ttgagagtac agcaagaata acagcgtttc     26400
     tccgagatcg aagaagtcat cctgttttcg tacctttatt tcctccattt cttcaggagt     26460
     caattgtttg gcaaggccga aatcgatgag gcagagcctg ccatcattga tgatgatatt     26520
     aggcgttctg atgtcgctgt ggaagataag gcgatcatgc aggtattcta taatctcaag     26580
     cagctgcgaa atcagttgta acgccataag ctctgtgaac ggctgttttc gaaaaaataa     26640
     taattcttct atattctctc cctcaatgaa ctgcatgaca taataagcct gtccgtctat     26700
     gatgaattca tctatgaagc ccggaatttg cgggtggtga atgtttttga gcagttttat     26760
     ttcctgctgg aatcggactt tctctttttc ctttttggct tttgtcggcc gaagctgttt     26820
     taagacataa ggtgtttgag ctaggatatc ggtgcacaaa taaaccaaac cgtagcctcc     26880
     cataccgagg cactcttcga ttttgtattg atgatttaag ataacgccgt tctttagagg     26940
     gcggtcaaat agcagttttt ttagaagttt taatgccatg tctgcacttc ccttggttgt     27000
     actgactata gtttaccttc tagacggaga ataaaaaaga gccggataac cggctcggta     27060
     taagttaaaa ctgctttgtc acgtcgtatt cataatctat ttttgctttt acgttgctca     27120
     tcgtcgatct ggctgtcgct aatgtattat atttaaaact ccataccttt gccacactga     27180
     gttgatccga caaagagata tcataagacc ctgaagtcga gctgtttaca agggcacggc     27240
     tccattcgtt attttcgctt gtcatgatca gatggcgtgt atttccctgg cttggtgttt     27300
     gagtggcggt tgtttgaact ctggttacaa tggcatcacg cggtatccca gattggtttg     27360
     ttaaatcaac cttgatcacg ctggagtcag aacctgaggg gctaaggctt gtatttcctt     27420
     tattttcagc aacgccgctg aattggaacg ttccgctgcc tgatttgatt cggtcttcaa     27480
     ttgaaagcgt aaagtacatg tttccagtat aggtgcctcg tgacactttc acatagaagg     27540
     tatccgtcgt gttttgggcg tctgcatttg cataaataaa agaagaaaac gtattagggt     27600
     taataacttc tgtcccttga gaaacaggta ttctgttctt gtcataaatt tcaattttca     27660
     tccctgtata cgcgctctgg tatgtactcc tcatgtatac tttttctccc ttattagccg     27720
     taaaagtgaa ataggcttca tcttgaccag cttccagtat tgttgtatcg atatttttat     27780
     atttccaata accgatcggc attgcggtat caaatgaatt gtttcctgtg atagcagtga     27840
     ctccgacagc tgatgccgaa tacgtaaagg tagataagac agaaagcata acagcgaatt     27900
     gaataagcca ttttttcacc atgcaaacaa cctcctttta tttccatcat acataataac     27960
     gatttaggtg taaataaatg ttttttgagg ttaatatata cattatattc gccgataaaa     28020
     aagaataaga gagaatactc gggagggaat tcaatgcgtc tgaatcggca atttatccgc     28080
     actcagctga ttgcacagaa catattgagc aagaatgcgc ctgccaaacg ggagaatgcg     28140
     actgaaaatc cagcggcagt tctggaaaag gcatatagca ggcttaagtc acaatcttca     28200
     actgggggaa tcaatcagtt caattattct aaaaccagcg tgtcgggaaa cagcgggacg     28260
     ttcagcaaag tgtatcaatc agcgaatgat cgaacagtga cagacacagg ggaagaaaca     28320
     gtgattcaat cccaaaaccc ctatgaatct gagagtgata tcagaatcaa aatactagat     28380
     gaaaaataca gcaggatgaa tgcgattaat aaaacaaagt ctgatccatt aggctatatt     28440
     aaggataagt accaaaattc aaagtctcct tatttcagaa gtgatctgtc agctgcagaa     28500
     agacaggccg cttacgataa tgaaacagaa tggttattca aagggaaggc gcaaaactat     28560
     aaccttcagg atgctgtgtt tcggaatgtc acatttcatg gggaagtgga agctgagaat     28620
     gaaaaggtgt atcagcgggg acaggttaac cagcagctgc aagtactgtt gaatcgaaac     28680
     catattcata ttccagaggg gacagagctg acgtttacaa tcacaccgat tgactatcag     28740
     gtgcgggtaa gcgggacaga cgatcaggat ctgatcaagc aaattgagca agtgctgcaa     28800
     tctggagaca acagcaaaga actattttta cacatcatga aaagtcaaag cagtgattca     28860
     gcacaatttt ccgaagaggc ctataaaaag tatcaggcag ctcgtgagat gtatgaagtt     28920
     acaggctacc atttgaagga tttagaagtg attgatgggc ggtacgtcac gcctgaggga     28980
     cgtgacttaa tggatgtata taaggaagag cttgaaaaag atccagtgca gaaacaaacg     29040
     gcttcttatg ctatatctta ctatcgttca gagctcagta aaatcgcgga agccgggtat     29100
     aatgccattc cggatttcat cctatcaatt gattacagca atggatctct gagagatgtg     29160
     ggacaaagca agagctatgg gaccggagat accgggtggc ttgaagcatt aaagcgtcaa     29220
     acgggtgtga attattaggt aagctgttca tgtaggacag cttatttttt atgagaatct     29280
     aaggggtgaa ttaatcccaa tattcaaata attttattat ttttatataa aagattttaa     29340
     aagaagtgaa cgattcaaaa ctctgaacaa aggtgtttac ctgaaaaaaa caattgtatt     29400
     ttccagagaa atttattatg atgaaataag taatttagga gattatataa caattttaag     29460
     tttgaatttt ctgattgtta tcactgattc atgtgaaggc aagcaggtct gctgttttct     29520
     catttatgag tattttgtta ggaggaggaa gaggagtggc aaataaagaa ttaaagaggg     29580
     gcctgggcgc gcgccatatt cagatgatcg ccttgggcgg tacaatcggt gttggcttgt     29640
     ttatgggttc tgccagcacg atttcatgga ctggcccatc tgtccttctg gcttatgcaa     29700
     tatgcggaat ttttatcttt tttattatgc gtgcgatggg tgaaatgctg tatgtcgagc     29760
     cgagcacagg ttcttttgcg acgttcggcc atcaatatat tcatccgatg gcaggttata     29820
     taacagcatg gagcaactgg ttccagtgga ttatcgtcgg catgtcagaa attatcgctg     29880
     tcggttctta tacgaagtat tggttcccgg atttgcctgc ttggatacct ggtatcgtgg     29940
     caatggtgat tcttggtgcg gcgaatttaa tttctgttaa gtcgtttggg gaatttgagt     30000
     tttggtttgc gatgattaaa atcgtgacga ttatcttgat gattattgcg ggaatcggaa     30060
     ttattttctt cggttttggc aatggcggag atgcgatcgg tttgtcgaac ctgtggtctc     30120
     acgggggctt ctttgcagga ggtttctcag gtttcttctt tgcactgtct cttgtcattg     30180
     cagcctatca aggagttgag ctgatcggga ttacagcggg tgaagcgaag gacccgcaaa     30240
     acacgctaag aaatgcgatt caaagtatta tctggcgtat tttgattttc tacattggcg     30300
     ctatttttgt gatcgtgacg gtgtatcctt gggatgagct caactcactc ggaagtccgt     30360
     ttgtgtctac gttctcgaaa attggaatta cggcagcggc cggcattatt aactttgtcg     30420
     tgattactgc ggcaatgtcc ggctgtaaca gcggtatttt cagcgcgggc cgcatgctgt     30480
     atacactggg tgtcaatgga caagcaccga aattctttaa gaagatttca cgcaatggtg     30540
     tgccgctgta tggcacaatt gcggtgctga tcggtttggc tgtcggcgtt gtactgaact     30600
     atatcgcgcc gccgaagatc tttgtctatg tatacagcgc aagcgtgctc ccagggatga     30660
     ttccttggtt tatcattttg atcagccata tcggattcag aaaagcgaag ggtgctgcat     30720
     tagataaaca tccattcaaa atgccgtttg ctccttttac aaactatttg acgattgctt     30780
     tcttgctgat ggttctggtt ggcatgtggt ttaacgatga tactcgtatc tccctgattg     30840
     taggcgtgat tttcttagcg cttgtggtca ttagttatta tgtgtttggg attggcaaac     30900
     gcacgcaggc caatttgaca aaaagcgaac aagcagctga ataacgataa aaaagagaca     30960
     ttcacggatg tctctttttt tatttttcgc gtatggattt tccctatttt agcaagctat     31020
     agggtaaaga tagcagaagg aaaggtgttc ataaaatgga tgttacactc ggttatttgc     31080
     gcgaatcact ttcgaatcat ctagaaaatg aagtctgcca gcgtatttgc aagaagatgc     31140
     tggcgaagcg ttatgcaaat gaagaggaat ttgtaaaaga cttagatgat aatgaaatgt     31200
     cttttttgaa ccatgtatta gaaaaagaaa ttaagtatgc ccagaatgaa caggatcaaa     31260
     aacgggccaa ggaattaaac gaggtgtatg aattactgct ttgagaaagg cgggtaagaa     31320
     atgggagcaa ttgaacgaag cggatataca tttcagccgg agtttagcgt tgtccgtcaa     31380
     aacggagcca tccatgtgta ccatcaagga gaatttgtgg aagaaatcga atttgaattt     31440
     aacggggaat atcccgatca tgatttgatt gaagagcttg tgaatcatta ttgttttgag     31500
     catgagattt agagccctgc cgtgcagggc tcttttattt aggatgtaat caggccatac     31560
     tttttcagga tatccacggt gatgtttttg gcttttgtgc cggaatcatc gacattggtg     31620
     acaaagacat aagagccatg ctctgttttg atgaatccga caaaccatcc taatcccata     31680
     tcagtcaggc gggttccggt tttcccgtag agcgtgtaat gatcgccttc ctcttgaatc     31740
     atcatgcgct tgacgatttt catcaccggc ttgtcaaatg gaagctcctc tttagccagt     31800
     ttctccaaaa aagtttcttg ttccagcgga gatattgtga gcgagctttg cagccaaaac     31860
     tggtcgattc ccccgctgat atcctcgttg ccgtaagata gagtatgaag ccatgttttc     31920
     attctttcct cgccgatatc tctcgctaat gcctgataat accagattgc ggattcgcgc     31980
     atggccgagc caagcgtatg gtcgcggttc catgattcga attcacgctt gaccccgtcc     32040
     catcgtttaa catcgtattc atctcttaca gctttgacct gcaaaccgat taaagcgttc     32100
     acgactttaa aggtggattg cggagtttgt ctttgatttg cccgttttct gttatagaca     32160
     aatgtctgat ccttttgtaa atcgtgaaga atgaaggttc catccgtatc cttgaattca     32220
     tcatcgacat tcattttgct gacattcaag tgtttttcat gagcagatga tgctgcgtgg     32280
     acggagaagc cgccgatccc tgcaatactc agcacaagca caacatatat ccattttttc     32340
     attttgttct ccccttcgtt ttgattaact accttttctc tctttcgttt gttcttcctt     32400
     taaaaaataa tcaaaaagcg cttaaatttg gttttgcaaa caaatactgt tactgggttt     32460
     atagtcggaa gataacgtga aaatagaggg taaaaaggaa ggcagggtaa gcggatgaat     32520
     gagcagattc cacatgacaa aagtctcgat aacagtctga cactgctgaa ggaagggtat     32580
     ttatttatta aaaacagaac agagcgctac aattcagatc tgtttcaggc ccgtttgttg     32640
     ggaaaaaact ttatttgcat gactggcgct gaggcggcga aggtgtttta tgatacggat     32700
     cgattccagc ggcagaacgc tttgcctaag cgggtgcaga aatcgctgtt tggtgttaat     32760
     gcgattcagg gaatggatgg cagcgcgcat atccatcgga agatgctttt tctgtcattg     32820
     atgacaccgc cgcatcaaaa acgtttggct gagttgatga cagaggagtg gaaagcagca     32880
     gtcacaagat gggagaaggc agatgaggtt gtgttatttg aagaagcaaa agaaatcctg     32940
     tgccgggtag cgtgctattg ggcaggtgtt ccgttgaagg aaacggaagt caaagagaga     33000
     gcggatgact tcattgacat ggtcgacgcg ttcggtgctg tgggaccgcg gcattggaaa     33060
     ggaagaagag caaggccgcg tgcggaagag tggattgaag tcatgattga agatgctcgt     33120
     gccggcttgc tgaaaacgac ttccggaaca gcgctgcatg aaatggcttt tcacacacaa     33180
     gaagatggaa gccagctgga ttcccgcatg gcagccattg agctgattaa tgtactgcgg     33240
     cctattgtcg ccatttctta ctttctggtg ttttcagctt tggcgcttca tgagcatccg     33300
     aagtataagg aatggctgcg gtctggaaac agccgggaaa gagaaatgtt tgtgcaggag     33360
     gtccgcagat attatccgtt cggcccgttt ttaggggcgc ttgtcaaaaa agattttgta     33420
     tggaataact gtgagtttaa gaagggcaca tcggtgctgc ttgatttata tggaacgaac     33480
     cacgaccctc gtctatggga tcatcccgat gaattccggc cggaacgatt tgcggagcgg     33540
     gaagaaaatc tgtttgatat gattcctcaa ggcggggggc acgccgagaa aggccaccgc     33600
     tgtccagggg aaggcattac aattgaagtc atgaaagcga gcctggattt cctcgtccat     33660
     cagattgaat acgatgttcc ggaacaatca ctgcattaca gtctcgccag aatgccatca     33720
     ttgcctgaaa gcggcttcgt aatgagcgga atcagacgaa aaagttaaat taaaaagctc     33780
     tcttccttta tcgaagagag ctttttgatt acttcttttt ttcatcgtag tattggacgg     33840
     gatacatgga gccttctgat accattttgt tgtcctcgat atcttacggg tccgggtggc     33900
     cggctttatc aactgggaac gtttccatgt ctggctgttt tgttattttc atcttcatgc     33960
     tgtgaatgaa ttctcttgcc ttttggcgat ttgacaggtc ttttaataga taagaagtga     34020
     tgccgacagt tgaaacagcg agacctgaaa gtaacagctt ttgtttcatg gtgatactcc     34080
     tttctatttt aagaatagtg tttcctgtat cattcccgtt ttggaaattg ctaaacctgt     34140
     tgtgttttta tcattggaat taacagtaaa ttccatttaa gaagaaacta gtgacttcat     34200
     tcctgtattg gaaggtaata tacattgact tattatagat ttcagtcaaa attcgataaa     34260
     tattgacaaa gtaaagtaat cagaataata atataattag caagagaatg tcatcataca     34320
     tgaaaggtgt ttacgatatg aatcaattgc atcgaagaat gggaacgttt tccctcatga     34380
     tggtcgggct cgggtcgatg atcggttcag gctggctgtt cggggcttgg cgtgcggctc     34440
     aaatagcagg accagctgct attatttcat gggttattgg aatggtcgtc attttattta     34500
     ttgctctttc ttatagtgaa ctaggttcta tgttccctga agcgggggga atggtcaaat     34560
     acacgcaata ttcacacggt tcgtttatcg gttttattgc gggctgggcc aactggattg     34620
     cgattgtgtc cgtcattccg gttgaagcgg tggcctccgt tcaatatatg agttcttggc     34680
     cttgggaatg ggcgaaatgg acaagcggtt tggtgaagaa tggaacgctg actggggaag     34740
     gactagcgtt tgcctctgta ttgcttctca tttattttct gctgaactac tggacagtca     34800
     atctattttc gaaagcgaat tcattaatta cgatttttaa aattattatt ccgggtctta     34860
     cgattggagc tttgctgttt gtcggattcc acggagaaaa ctttactggc ggtcaaagca     34920
     ttgcgccgaa tggctgggca agtgtgctga cggcggttgc cacttccggt atcgtttttg     34980
     cgtttaatgg tttccaaagc ccgattaata tggcgggtga agcaaaaaat ccggggaaat     35040
     caatcccgat tgcggttgtt ggctctcttt ttgttgcgac agtgatttat gtcctgctgc     35100
     agatcgcctt cattggagct gtgaatcctt ctgatattgc tcacggctgg agccatctga     35160
     attttaattc tccttttgct gatctggcga ttgcgctgaa tattaactgg cttgttattg     35220
     tgttatatgc agatgcattt gtatcaccgt ctggaacggg gattacgtat acggcgacaa     35280
     cgtcccgaat ggtttacgga atggaaaaaa acaaatacat gccgagtata ttcgggaagc     35340
     ttcatccgat ttacggcgtt ccgcgacaag caatgttctt taacttgatt gtttcgttca     35400
     tctttttgtt cctgttcaga ggatggggcg tattagcgga aattatttct gttgctacgt     35460
     taatttctta tatcaccggc ccgatcacag tgatgacatt gagacggacg gggaaagacc     35520
     tgtacaggcc tcttcgttta aaaggcttaa atgtgattgc tccgcttgga tttatctttg     35580
     cgtcactggt gctgtattgg gcgcgctggc cgttaacagg acaggttctg tttattatcc     35640
     tgatcggtct tccgatttat ttctattatc aggcgaaggc gaaatggaaa gggtttggcc     35700
     ggaactttaa agccggcgtc tggatggtgt tttatctgct ggccatgatg gttatttctt     35760
     atttgggcag tgataaattc ggcggcctga atgtcattca ttatggctgg gatatggttc     35820
     tgattgcgat ggtatccctt gtattctatg tgtgggcgct gaagagcggc taccagacag     35880
     aatacttaaa ggatgcgaaa gagataaatt ctcagctgct taatggacag tcagaagctg     35940
     ctgccggaaa agaataaaat atagaagaaa accttgcgat agttgtcgca aggttttttg     36000
     cttttaataa ccctttttta ctttgtggaa aagatcagga tagttggtga acactcctgt     36060
     tacgccccaa tcaagcaggc gatgcatatc agcttcatta ttgactgtgt aaggatgaag     36120
     caggaggccg tggctgcgga tcatacggac gttttcttga tttaaagctt tataatccgg     36180
     gcccgcaccg acagcgtatg ttttgatttc ttccagggca gcatctgtca ttgacgccat     36240
     ttgtttggct tccagcaatt gaacggtcgg caggtttggc tgtaattgat ggacttttac     36300
     caggctttct ttgctgaacg attgaatgat cacctggcct ggcttagaat gctttcccag     36360
     taatttatgt ttctgcaaag aagcgatcag tttttcttcc atacctgggt aggtgtcagg     36420
     cgattttgtt tcaatgtagt agttcgcgtg ctttccgaaa cggtctaata cctcttctaa     36480
     tgtaggaact ttaaggccga cgtactgcgg ctttgctttt tccggatagg cttcattaaa     36540
     ccaagaaccg gcgtcaagct tcttaatgtc tgcgagcgta tggtctttca cccaacccat     36600
     tccgtttgtg gtgcggtcca gtttttcgtc atgcatgaca atcaattttc cgtcttttgt     36660
     catttgcaga tccaattcaa taaaatcagc tttcattttc tgagcggttt cgtaagacag     36720
     aatcgtgtgc tcaggcacat atccagaagc ccctctgtgc gcgacggtca ggatacggtc     36780
     aggtgacagc aggtttcctt ttgacgctgc cgacactggc gttaccataa atgagagtaa     36840
     gcccagcgac agaacaaaca aggccagtat tctatttttt ctcatgattt ctcctcctta     36900
     tagataagca ctacctgtct ttcataataa aaaacggatg taaacggcgt gttggaaaac     36960
     tattaatctt ttatgtgtct ttcttaaaca tgctctgccc gttttcctgt attccacgtc     37020
     aaagccaaga agacgatggc aagaatgcag gatgagatca gcatgataaa gccgccgttc     37080
     cagttaaaac ggtccacgac aaagcccata atggcgtttg cgaaggcgga tccgccgatg     37140
     tatccgaaaa atccggtcaa accggctgca gttccggctg cttttttcgg tgctaggtca     37200
     attgcttgaa ggccgatcag cataacaggt ccgtagatta agaagccaat gctgatcagg     37260
     gcgatattgt ccacgagcgg attgccggcc ggattcagcc agtacaccaa tacggcaatg     37320
     aaaacacccg ccataaacaa aacgcctgcc ggtgcccggc ggcttttgaa gaatcggtca     37380
     ctgatccagc cgcacaagat cgttcccggt atgcctgcgt attcgtaaag aaaatacgac     37440
     cagcgtgagt cttcaggaga aaagcctttg gcttctgtta agtaagtagg cgcccagtca     37500
     accacgccgt atcgcacgaa ataaacaaat acattggcaa aagcgatgta ccaaagaaat     37560
     ttgttgttca gcacatattg aaaaagaatt tcttttgttg ttaattcttt ttcctgattt     37620
     ttaaaagcgt gttttggata gtcattccga tactcttcaa ttggcgggag tccgcaggat     37680
     tgaggcgtat cacgaaccaa taaaacaatt aaaaatgaaa tgataatggc gatgatggca     37740
     gggaagaaaa acacgctttt ccaagtgacg aacatcgcga tcccaagagt gacaagcgga     37800
     gcaagaatac cgccgcctat gttatgggcg acattccaga tcgacatttt tgtgccgcgt     37860
     tcacttatgg agaaccaatg ggccatcgtc ctgccgcatg gcggccagcc cattccttga     37920
     aaccatccgt tgataaacat aaaaataaac atgatggtga cgctcgaagt cacccaaggc     37980
     attgaaacga atagaatatt aacgattgct gataaaaata ggcctgtcgc cagaaaatat     38040
     ctcggattac agcggtcaga caccattccc atgatgaatt tgctgaagcc gtacgcaatg     38100
     gacacagcgg ccagcaccaa acccagttct gttttcgaaa atccctgttc ctgcagataa     38160
     ggaatggcaa aggcaaagtt tttccgcagc aggtagtagc ctgcgtagcc aatgaaaata     38220
     ccaatgaata cttgcagtct gagccgtttg tatgccgcat ccatctttga atcatccagt     38280
     ctctcaatat gaggagccgg tttaaatata ttaagcatta ataattatcc ccctttgctg     38340
     tttgtgctgg atgtgtggcg tgcctccttt cccgaaaaac aaaaagagcc agaaaacacc     38400
     ccttgtcaaa aggggttgga ttcctggctc tcctcatctc catccaagct attaacttat     38460
     catgatagcg ctttcttaaa ttatcatagt ccggagcgaa tgtaaacggg taattttcaa     38520
     attgggcctt agggaagtga atattatcct tttactaaat gcaattatat ttttttacta     38580
     gtaacataaa aatctggagg gaggctgttt aaagatggat gaattagata tcgcattctt     38640
     tattttaccg ttaggaatta tgctgctatc gattgtcggg acctgtattt gtaaaaaccc     38700
     gtatctgatg ccaatgctta gtttggtgat ttctcttgtg ctcaccttta ccatttttaa     38760
     tcaatcattt ttgggatggg ctgttgtcta tagcttggtt tctctggctt tatcctatat     38820
     cacattgatt gtggtaagga aaaggaagga atcaggaaat taaaaagacc tcactttcta     38880
     acatatcgtt gactaaagca actatatgtg attataattg ctttagtcaa cgatattaga     38940
     aagtgggaat tgatttgaaa acaagagaat catctgtcgg gttaaaattc agaaagttca     39000
     atcgatttta tacaaacgtc cttggtttcc ttaatgagca catttacgac agcccgtttt     39060
     ccttaacaga aacacggatt ttatttgaga tttataatac gcctaattgt acggcaaaag     39120
     ctcttcagga taagctgggg cttgaccggg gatatgtcag caggattgtg aagcagtttg     39180
     aaaaagaaga tttgatttat aaacagagga gcaaagatga cgcccgccac cattacattt     39240
     ttgtcacaga aacaggaaaa acgatttata aaaagctgga ggagaaagcc aacgaacaag     39300
     tagaactgat gctgaaggta atcaaccaaa aggagcagca caagcttgcc gaggcgatgg     39360
     cagagattga agcgatcctt tcacagtcgc tttctgccag agcatcagag atatcgatta     39420
     gagattattt tctttcggag gatcttcaac tccttattga gaaacaaaga caattttacg     39480
     cggaggctca cggttgggat gacacgtttt tagcttatct tcaggagaca tttgacgctg     39540
     acatcgaaaa aatatggatt gcggaaagcg gcgggaaatt tgccggctct gtcgggttgg     39600
     tcaagcacga tgaaaagaca gtccagctca gatggtttct ggttgatgcg gattttcggg     39660
     gcagggggct tggcacgcaa ttgctggagc atctggttgc atactgccaa gacatgaagt     39720
     ttgaccgcat tttcctttgg acggtgagca cgatggctga ggctcgtccg ctctataaaa     39780
     aatttggatt caggataagt gaagtaaaac aagaagcgcc attatgggga cagcagctga     39840
     cagaagaacg gtgggatttg gagctgtcat gaaaagactg cattatgcgt ggatcatcgt     39900
     ctccgtcacc tttttgatct tattggcggt tcagggggtg cggctgtcgt ttggtgcgtt     39960
     tgtggagccg tgggaacggc agttttcaat cgatagaagc accatctcgc tgatttcgac     40020
     ggtgagtttt attgtttatg gcatatcaca gcctgtgatc ggtcggcttg tggacaaatg     40080
     gggtgcccgg gctgttttgg catggagtgc gttactgaca ggagtcagca ttttcttaac     40140
     ataccttgtg acttcgcctt ggcagctgtt tttgctttac gggctgggtg tctcgcttgg     40200
     agtgggcgga gcatcgaatg tggcggcaag tgtattggtc gtcaattggt tcagcaaaaa     40260
     gcggggacta gcctttggga tcatggaagc aggctttggc gcggggcaaa tgcttctcgt     40320
     tcccggctca ctcatgttga tccattggtt tagctggaag ctgacggttg tggtgttggg     40380
     actgctgtta atcgtgattg tctttccggc tgcgctgctg atgctgcgga acaatccttc     40440
     agaaaagaat acagagccga taggcggact ggctgcatca gaaaaagaaa cagcacccaa     40500
     aacaacagct ctttcagtgg ccgggatgtt tcgtatgagg caattctggt tcttgatttt     40560
     tccgtttttg atctgtggat ttacgaccgt ggggctgatg gatacccatt tgattccgtt     40620
     ttctcatgat catggctttt caacgacagt cacgagtgct gctgtcagtc tgctagcagg     40680
     ctttaatatt gctgggatct tgctgtccgg aattgtagcg gaccggtgga gcagccggaa     40740
     aatcctgtgc attttatatg cggtgcgggc gctgtcgatc gtgattctta tttacagcca     40800
     cgagccctac ttgcttttag cctttgcgat tctgtttgga ttagtggact ttgcaacggt     40860
     agcaccgact caaatgctcg ccacccagta ctttcaaaac tactcgatcg gcctcatgat     40920
     tggctggctg tcactcgccc atcagatcgg atcggcacta ggtgcgtatg tgcccggcgt     40980
     catctacacg gtaacgggtg agtatacact ggctttttat ttgtcgattg gaatgctcgt     41040
     gcttgcgagc gtaatgaatg tgatgctgag ggagccagct gcggttacgc gtgacagtgc     41100
     ggctgtggta gacaagtgat gaggacaaag ggaaagcatc tctgatttcg agattattca     41160
     gagatgcttt ttttgcattt ttgttctaat acgaagtcga tcataccgac tatgcgggcg     41220
     ttttcggatt tttgtttgaa gcgttcagaa atttgaactt ttcttgaaaa tggggaaaca     41280
     ataaaaaccc aaaaaaggcc gatcaaggca aaaaacattt gtacagctaa ttctattaat     41340
     tcattaaaac gagtgctgaa aaaatagaag tataacgtta ttaatgtcac agtacatacg     41400
     attttggcaa gtgtgtttga atgtaagcaa tggttcacta aagaatacct ttaattgatt     41460
     cagcatgatt gaatcatatt tgtttaggaa aataagaagt tctttatcat cttttttatg     41520
     ttctaaaata aagttgctgt ttctgtttct ttatatgtat ggtggtctac attcaatata     41580
     tacatctctt aaagtataaa aattgagtat ttcttagtaa ggatgaaaca aaattacatg     41640
     atttttttgt tatatctttc agttagaata aaatctataa ctcctctcat tcgcaaatat     41700
     tcggctctct gtgcaaagtg cagaacagta tgtaattgtc cttttctaga tatatttaaa     41760
     agctttatca aatcaataag gattttcaag aaaataatta ataatagaaa gataaaaatg     41820
     tgtggtatgt caatgtaatt gatttgtcct gaaaataaag aagttgcata gacaacaata     41880
     atacttccgc aaaacatcaa actcatataa tgtggaaggg aaaatggacg agttgaaaaa     41940
     tatgctttta attggcttag catagcatta tctcttgtat ctaagtagcc caaaagctct     42000
     ttatcatttt tactaattgt aagaacatga ttcaatacag cactaaaatt cattgaatct     42060
     tcattatcag aggcagtatg tttattagcc tgtatgtttt gttgatccat tttatatttt     42120
     ttataaagta ttgtattaat taacttgttt ttctcataga attcagatcg ttgattaagg     42180
     gatgcttttc ctttgttttt atttcctttt tttatgattt tagtataagt cataaaaata     42240
     caaatgactg taaaaataga aaacactgca ggtgaaatat ctgaaagaat agtattggtg     42300
     aagacttctt ttgcttggat gaaaaggaaa gaagctaaag tcatagatat aaacatgcat     42360
     aaaactgcta ctttcacaag aaactgaagc ggaagagaag gttccgaata atagtgcttc     42420
     aactggttga gtgtcagaga atcttggcga aaaagataat ctattatctc ctgctgattt     42480
     tgcatctgat tgatatcatg agcgatgttt tttgtttttt caaaaactat ttgatcattt     42540
     ttcatttttg ataaacctcc aaaagacgat agataaacta aaaaaactgc atgagcatat     42600
     tttaacttat gttcatgcag ttttgtatta aagttagcta gtataataag caaaaatggc     42660
     cagtaacata gcagataatg cggtagcgac tttgactcct ttattgttcg ttaaatcact     42720
     gcccatattc ccaattagta aaagtgcagc aacacctaca acagggaata aatattgatc     42780
     ataagacggc caatctaacg ctaattcact ctcgggagac gtaactggta ctcccttgta     42840
     cgtctttatt ttaaacgtaa tcgtagtcgt tagtccagtt gtgacattgt caccgactgg     42900
     aatatcaggt gtatagattt taatttgaat gtttaaagat tcagctgttg gatttacata     42960
     aacctccaaa taaccgttgc gtactgataa gctcagacta tttaaaaggt tttgataaga     43020
     gtcgatttgt gacgcagtga gagacgtttg agtgtcgccc aataaacccg tgatataggc     43080
     acctggttta ccatttgtaa tggtaattgt gtttggtgaa ccttcacttg gtatggttgc     43140
     cagaagtgaa gttgatagaa taatatccaa ctcaggtgat gtgaaaatgg tttctgtcgt     43200
     atcaaattca aacatcgcgt ttgccagact tgttagattt tctaaagctg gaatggtaga     43260
     taaaatgtct gtcagtgtac gcagtcttgc atcatatacc ggatcagacg gcggatttac     43320
     attgcttgca cctgagtctc ttcctgaata cccgtcttta tcaatcccga tgcttccaga     43380
     gccgcttccg atggttcctt cataaaattg atcaaaggcc cagttgtttg gcatcggata     43440
     gccgagattg ccgctaaatc ctgttgacat atttgccaca aaactatact ttgtcagtcc     43500
     tgcttcagat gtacggatac aaatgtttct tggtccgtaa acccctattt catacttagg     43560
     tgcggttgaa aatgtctgca tttttgtaaa tgctgactta atctcttgga aataaggaat     43620
     gattttatcg gtcacttcat aatcgtatgc atcaaaatcg acagcgaaat aaatggtcgt     43680
     gcctgacgga aaacctaatc ttctagcagc agaagcggca ctatatgcat ctcttgtgcc     43740
     ttggtctttg acaaaataag aagattcata gccgccgtct tgataaattg ggaaaacctt     43800
     caatccggca tcaagaataa ctgcaagctc tttagatgtc agggctttag atgtgaggcc     43860
     gctgcttgtc cgcacatttc cggtcaaata tctgccaacc gttttataac cgttattccg     43920
     cagtgtttga gctttttctg cggttataat tgtagcagtg tcacaagcag aagcggtgcg     43980
     agttgtgtct cctgagcttg ataataaagc tttaatggtt ggcatatctg cataacctgt     44040
     ttgcggcagg cacatgaact cttgaaatgc tttaacagct gaaacaacac ccacaccata     44100
     tttgccgtca aactcaccag gatcgaacga ttttccgtta caatagaggg cgtactgaac     44160
     aattaagaca aatcctgttc ttgaatcgcc gggagttaaa gtagggcaca aacttgtggt     44220
     gccgtttccg aaaaatccat tggcaacact tgtgctcatg ccttcttctt tttgcagggc     44280
     ataaataaga gctttatttg tatcgcggcc atacagtccg tcacaaggca ttaacccgat     44340
     atagtcattg tagtctcgat ttaagttttg ttgaatctgg cgaattcttg aatcaccccc     44400
     agacaccagc ttaaaagcgc tcatgtctaa taaggctttc ataattaacg tggtgacaat     44460
     cccatcctgt gttgtcagtc cggcagcttt ttgaaattct tttaccgcat tttctgtttt     44520
     ttcgtaaaag acgcctgtaa aaccgccggg attaaagcct ttacaccata aagccccttg     44580
     taaaataaaa ttcatgttgc ttggttttga atctggagct tggcgtttaa gaggcttaaa     44640
     taagcgctgt gttgtcggcc cgaagttatc ggctggctct gagataccca attcaatttg     44700
     aagcgcccga gtcagaccgt agatcgtatc ccacccagtt ttcccgcttt cttcaactgg     44760
     gttataccca tgtttgccgc tgtacgtatc gttcagccat tgctgtgtga ttaagaccat     44820
     ttcatcaacc atttcgattc ctcctttgtt agattgcgtt catttatagg tggcaaacgt     44880
     aggacaaaat aaaaaaatgg atgccgttaa gcatccattt tacatccgtt ctccaacagc     44940
     ttcgctttcg gtttcagctc tgaaatgtag aggcctaaaa gtgtaagcgc gcctcctaga     45000
     agagcgatcc atgtcatgtt ttcgtgcaga atcaggacag aagcggcgat cgtgataacc     45060
     gggaccatgt aaatatacgc actggatttg acggctccga gcactccaac tgaataattc     45120
     caagtggcga agcacagggc agaagcgcca atccctaaga aaagcatgtt gagtatattt     45180
     gaagcagatg aaaatcggct taggtcaaaa tggaagtcga acaaaaataa agcgggaacc     45240
     ataaacaata aaccatacaa aaatactctc tgtgtcagct cgatgatgtg gtattcgtag     45300
     gcgcttaatt ttttcatgaa tatcgagtat ccgccaaaca cgagagcagc cccggctgcc     45360
     atgatgtctc cgagcggatt tagacgcagt accacattgc cgttaaacgt aatcaataaa     45420
     agcccgatca gtgccgagat aaatccaatc aaaaaagtca gacgcaattt ttcgccttcg     45480
     agcagaaaat gggccaaaac cgcagtgatc atcggtataa tggacacgat catgccgaca     45540
     ttggaggcgt atgtataggt gagagctata ttttctaata gaaagtataa ggttacgcca     45600
     aataaaccag ctccggcaaa caacagctcc tgccgccaat ttctgaacgg aatcatgttg     45660
     ggacggacga ggataagagc gataaagccc atcaaaaacc gataaaataa tatttccatt     45720
     ggagagaagt cagccagcag aacttttgtc gaaataaagg tcgtccccca aatcagaatg     45780
     gtcacaatgg ctgcgatatg ccccgaagtt tctctttgta tgttcatctg tgaagctcct     45840
     tttcaaaaat cttcatgtat tgcttcggcg tcagccccac ctgccgttta aaaaacttcg     45900
     tcatatgact ctgatcgctg aatcctgtct gaaatgccgc atcaatcggc cttacccctt     45960
     gttcaaggag ttttttggct tgattaatcc ggattgtttc catgtagcta ttaggggtaa     46020
     tgcctttttg ttttgtaaat gaacgcaata aatgatactt gctccagcct gttaattcac     46080
     tcaaatcatt gagtgtaaca ttttcggcat aatgctcttc taaaaattca caaaccattt     46140
     tgacttcgtc tgatggttct ggaacgctgc taaggaacgt gacatctgaa taatggcgga     46200
     tcagctcctc taatagatga agaaacagct cctccttacg caaagcttgt ttttcctcgg     46260
     atatcaaaat atgcaattcc tgcaggctgg ctgtcagctc atggcggaat aacacatgct     46320
     gggagaaata agggagatgc ccggagccag taatctcttt caccgccttc tccatgatat     46380
     ccggcatgac attgatacac cgataatcaa gcgtccggcc gtcaatctgt tcacagctat     46440
     gcgtgtcacg ggggttaaag aggagaagat cacctggatt gatgatatat tcttgatcct     46500
     gacaggccag ataccgttgc cctttttcaa taaatccaat cacataataa tcgtgaaagt     46560
     ggttcgggaa cttctgcata attcccttga agcggtaggc ttctatatga aggtgtgggt     46620
     caagctgcag tgtgcgggtt tcgttttgca tgggatgcct cctgtcggtg tggtggtctt     46680
     ggattaagtg tagcatgatt ttgggggatt tcttgtatga tgttgctgtt taggaataga     46740
     gaaagcagac cgttatttgt ctgctttcgt ttaagaattt aaaagatttt aaccctcaat     46800
     aataatttta tcttttttaa taaaaattta tttttcaaat atttcagtta taatggtttg     46860
     gaacagatag gaggggcaaa gatgtatcaa tcaaagaagg ttttattgtt aggttcaggt     46920
     gaattaggta aagaggtagt gattgaagcc cagcgtcttg gggtacagac ggtggcagtt     46980
     gacagttacg agcatgctcc ggcgatgcag gtcgcgcata acagttatgt cgttgatatg     47040
     ctggacccag agcagatcag aaccatcatt gagaaagaaa atccggattt gattgtgcct     47100
     gaggttgagg cgattgcgac ggatgaattg ctgaagcttg aagaggaagg atttcacgtt     47160
     atcccgaatg cccgtgcggc caagctgacg atggatcggg aaggcatcag acgacttgcg     47220
     gcggaaacgc ttggacttgc gacagctggc tatgaatttg cgaatacata tgatgaattt     47280
     atacaagcgg cagctcagat cggttttcct tgtgtcgtta aaccattgat gagttcttct     47340
     ggaaaaggcc aaagtgtgtg ccgctctgaa gcggatttag agagctgctg ggagacggcg     47400
     atggaaggcg gacgggtgaa aaacggccgc gtgatcgttg aggagtttat ccctttcgaa     47460
     tcagaaatca cactcttaac cgtacgtgcg gttaacggta cggcattttg tgagccgatc     47520
     ggtcatgtgc aaaaggacgg ggattatatc gaatcgtggc agccgcatga tatgacagag     47580
     cagcaaatag aagaagcgaa gcatattgcg aaaacgatca cggatgagct tggcggatac     47640
     ggcctgtttg gtgttgagct gttccttgcg aaagataggg tatatttcag tgaggtatct     47700
     cctcgtccgc atgatacggg tcttgtcacg ctggtgacgc aaaatttgtc agaatttgcg     47760
     ctgcatgtcc gggcgattct cggctttccg attacagaaa tcacacagct ttctcctggc     47820
     gccagcaggc ccctcaaagc gccggaagaa ttagcggatt acactgttga aggattggaa     47880
     aacgcactgg cagtcccaaa gactcaagtg cgcgtctttg gaaagccgat aacaaaagcc     47940
     ggacgtcgta tggcagttgc gctttctgct gctgattcag ttgaaacggc aagagagaat     48000
     gcaaagaaag cgttggacca gctaatttta aaatagagtt tgaacaggtc ttgtcatggg     48060
     acaaggcctg tttttttctt tctccgtaaa agttttatca taagaatcag aaacctgatt     48120
     ataatgtaaa agtcttccat cgatacgggt ggttgacact aaaggaggga gatgacaaaa     48180
     tgaaattagt tccaagattc agaaaacaat ggttcgctta cttaacggtt ttgtgtttgg     48240
     ctttggcagc agcggtttct tttggcgtac cggcaaaagc ggcagagaac ccgcaaactt     48300
     ctgtatcgaa taccggtaaa gaagctgatg ctacgaaaaa ccaaacgtca aaagcagatc     48360
     aggtttccgc cccttatgag ggaaccggaa aaacaagtaa atcgttatac ggcggccaaa     48420
     cggaactgga aaaaaacatt caaaccttac agccttcgag cattatcgga actgatgaac     48480
     gcaccagaat ctccagcacg acatcttttc catatagagc aaccgttcaa ctgtcaatca     48540
     agtatcccaa cacttcaagc acttatggat gtaccggatt tttagtcaat ccaaatacag     48600
     tcgtcacggc tggacattgt gtgtacagcc aggatcatgg atgggcttcg acgataaccg     48660
     ccgcgccggg ccgcaatggt tcgtcatatc cgtacggtac ttattcaggc acgatgtttt     48720
     actccgtcaa aggatggacg gaaagcaaag acaccaacta tgattacgga gctattaaat     48780
     taaacggttc tcctggaaac acggttggct ggtacggcta ccggactaca aacagcagca     48840
     gtcccgtggg cctttcctcg tcagtgacag gattcccatg tgacaaaacc tttggcacga     48900
     tgtggtctga tacaaagccg attcgctccg ctgaaacgta taagctgacc tatacaaccg     48960
     atacgtacgg ctgccaaagc ggctcgcctg tttatcgaaa ctacagtgat acagggcaga     49020
     cagctattgc cattcacacg aacggaggat cgtcatataa cttgggaaca agggtgacga     49080
     acgatgtatt caacaatatt caatattggg caaatcaata aatacagcaa actagccata     49140
     ttcatgtcta ttttgttttt atgcgggtgc agttcgcaga cgcattcttc tcaaaaagaa     49200
     acgactattc ctgtcactct tcatgtggag gatgctaagg ggctgccggt cgaaggggtt     49260
     caagtgacga ttgtcaaagc gccctcttca gatgaggagc cgagtacaga gattggcgag     49320
     atactcggta aaacagacaa aaacggagat atcaaatggg ataccggcag aaaaggcgat     49380
     tactcagtcg cgttgacgaa gggtgaaaca tcagtaaccc atcacatctc gttaacagag     49440
     gataaaaaag atcatgccat tccattagtc ttcaaagaat agcagtttcc ttgattttaa     49500
     gggaactgcc ttttttattt attgcaggaa accaaactat atactggaaa tttattatgt     49560
     gagataataa gaaataggta ttttttctta cgagacaaaa ggggcgttat cctttatatc     49620
     aatcaaaccc ggaggaaaaa gaagaagatg atacaagatt caatgcagtt tgccgcggtt     49680
     gaaagtggtc tgcgctttta ccaggcatat gatcaaagcc tttctttgtg gccgattgag     49740
     tcggaagcat tctatgtttc tactcgtttt ggaaaaacac atatcattgc aagtgggcca     49800
     aaggacgcac cttcgctcat tttgcttcac ggaggccttt tcagctctgc gatgtggtat     49860
     ccgaatatcg cagcgtggag cagtcaattt cgtacatatg cggtcgatat aataggagac     49920
     aaaaataaaa gtataccatc agcagccatg gaaacgagag ctgattttgc agaatggatg     49980
     aaagatgtct ttgattctct tggacttgag acggcacatc tggccggcct ttcgcttggc     50040
     gggtcccata tcgtgaattt cttactccgc gcgcctgaaa gagtagagcg ggcggttgtt     50100
     atcagtcccg ctgaagcgtt tatttcattt catccggatg tctataaata cgctgcagag     50160
     cttacagggg caagaggagc tgaatcatat atcaagtgga tcacaggcga cagttatgat     50220
     ctgcatcctt tactgcaaag acaaattgtg gcgggcgtgg aatggcagga tgagcaaagg     50280
     agcctgaagc cgacagaaaa cggctttccg tacgtgttca cagaccagga attgaaatca     50340
     atacaagtcc cggtacttct gatgttcggt gagcacgagg ctatgtacca tcagcaaatg     50400
     gcctttgagc gggcttcggt attggtgccg ggaattcagg ctgaaatcgt aaagaacgcc     50460
     ggacatctgt tatctctgga gcagccagag tacgtcaatc aacgcgtctt gtccttttta     50520
     tgcgggggga taaaatagta aggaacatga aaagattggc attcattttt caaaaggtaa     50580
     caaatgttgt ataataatag aatttgaatg ctgctttttt tgggagcatt ctatgttatc     50640
     atgcttattg gagaaaaatt tttcctgtaa cgctattcga tcactatcgt caaataatat     50700
     agatggtttt acaattggag gtttggttac actgtgaatt acatcccctg tatgattacg     50760
     ataggaaact tcatttgcgg attgctggcg attcattcct tgctatatca caacattcat     50820
     tcagcagtgc tttttatttt tacaggcatg ttccttgatt tctttgacgg gatggctgct     50880
     cgtaagctga atgccgtttc tgatatgggg agagaactgg attcgtttgc cgatctggtt     50940
     acgtttgggg tggctccttc tatgcttgct tacagtgtcg cgttgtatac cctgccattt     51000
     atcgggatct tatgcgcatt gacgtacagc atttgcggaa tgcttcgcct ctctaaattt     51060
     aacattgaac aaagcaagct cccgacgttt atcggtatgc cgattccgtt tgcgggcatg     51120
     tgtctcgtta ttctaagctt cacctataac ccgatccttc tggcaatcgg cacttgcgga     51180
     ctctcatatt tgatggtgag taaaataaaa ttccctcatt ttaaaaaaca tgcggcagaa     51240
     aacctggagt ctgggagatg gaattagttc agcagctcat agcggattac ggttatctcg     51300
     ctattttttt gatgctggta ttaggaattg taggattgcc gattccagat gaagtgatga     51360
     tgaccgttgt tggctatttc acgcataccg atgtattgaa ttatgagctt tcgatattga     51420
     ttagttttgt cggggctttg ttaggtatgc tgatcagcta catgattggc agaaaagccg     51480
     gacgcccgtt tatcgacaag tacggcaagt gggtcggctt aaaagaaaaa agaatgatga     51540
     aagtggaaaa atggatgaag aaatacggtc catattctct tattttaggt tattttattc     51600
     ccggcgtcag acatgtgacg tgctactttt cggggatcgg caaaatggat ctgaaaacgt     51660
     atgttgcgtt tgctgcaatc ggcgcctttt tatggtgctt tgtttttatt acaatcggaa     51720
     gggttatagg gattattcat gtttaatacg gctgtaaaga ttctgtatcg atcattgata     51780
     gagctgacga atcatcgtct gtcatcctat ctgattaaag gattttgcga gtcgaaaatc     51840
     agcaaaccgg tcattccgct tttctcaaaa cattttcggc tgaattggga tgatgtggac     51900
     ggtacggctg ctgattacgg atcgctgtcc gaattgttca ttcgacaaat aaatctggag     51960
     cggcgccctg tgtcaaaaga ggcgcatgcg gtggtcagcc ctgttgacgg tgtggttcag     52020
     acggtaggaa tcatcaaccc gaatcaaacc tttacggtga agggaaaaga ttactcattc     52080
     gctgagctga ccggctgtaa aagcgcagac catcaataca acggcggata tttcgtcgtg     52140
     ctgtatttaa gcccgaggca ttatcaccgt ttccattctc cgatcagctg caggtatcaa     52200
     aagctggccg agctcggaaa tcgctcatac ccggtaaatc aactaggctt aaaatacggg     52260
     aaagatgtgc tgtcgaaaaa ttatcggttt gtgtacgagc tgaatagcgg cagccgaaat     52320
     gtcctgatga ttcctgtcgg cgcgatgaat attaattcta tcgtgcagac gaatacccgt     52380
     actgaattgg agatcggcga ggagctggga tacttttcat ttggctcaac cgtcattttg     52440
     gtttttgaaa aagacgcgtt ccagccgtcc gcccatttag cagaaggcca agaagtccaa     52500
     gtcggagaac tgataggtta cgaagaataa aaagaggagc ttgcataaac gcagcgcctc     52560
     tttttttgaa gaaaggtgag attcatggag aaacaaatca tcagctggat tacagattat     52620
     cagaacaccg gagatgaagc cgtcctgcgg caagtgcgag aagtgtgctg gccgatcgtt     52680
     gaagcggttt tgcaagagaa agtaatggat gatgaacaag cgaacaattt gcgcgaaaaa     52740
     ggaatcgagc ggtttccatt catcatcagc aaataccaag cggatgtgca gcttccggtt     52800
     gagacatttt tacaaaatac gtatcggttt tactttcatc aggtgatgag agaatccagc     52860
     taaagcttct ttcaacagag aagctttttt ttgttggcag gaaaaggaaa ctttttctat     52920
     atctatctcg taatgactag agaacctagc agaaaaggag agatagaatt gaaacgaatg     52980
     atagtgagaa tgaccctgcc gctgctgatc gtttgtctgg cgttttcttc tttttcagcc     53040
     tcagcccgtg ctgcttctga agaaaaatat tgggatcact ggattgaacg acatgcacag     53100
     cctctggatg cttccaatgc ttcaaacaaa gaccttcgat ttctaaaaaa ggtgctgaag     53160
     ggaaaacgaa tcgttcagtt aggagaaacc acacacggtg ctggcgaaat caatgccaca     53220
     aaggtcagaa tgatcaaata cctccacgaa gagctgggat acgatgtatt ggcctttgaa     53280
     tccggctttc ctgatacaaa tgcatcctac cttaatatgg accaattaac ccctaaaagc     53340
     acgatgaaaa actccattta cgctgtatgg cacacagaag atgtcgtcga attgtttgat     53400
     tacatgaaag agcaaaaaga gaaaggcgat ccgctgatcc ttaccggttt tgatattcaa     53460
     agcatgaaga attcattcaa tgtagctgcg actcaatggg taaaagcggt ggaccctgag     53520
     aaagcagagt tgctctccca atcagaaaat gatttttcaa cattagtgac agacagcaat     53580
     acgtttgatg aattttcgca aaagaaggaa aagcttgtga aaaactatca gaagctgatc     53640
     aagttcacta aaacacatgc ttcagagcta aaagaaaacc ttccaaaaga gccgaaagct     53700
     tatgagatgt ttatgcattc tcttcagctg agaattgacg taatggaaac atatatgctg     53760
     gaagaaatga aagaaaaact agaggagtat ccggagaata ttgaggattt ttcattcttt     53820
     atgagagacc gcatgatggc tgaacaattt cagtgggtag ccgacaccct ttatccgaaa     53880
     aagaaaatca ttgtctgggg ccacaattac catctacgca aacagaatac gaagatgata     53940
     aaggactggg tacagctaaa cggccctaac atgggtgatt atttgccgga gcggctgaaa     54000
     aaacaaacat atacgattgg catttatgct tactcaggtg cgagtcttga tagctccgat     54060
     aataagactg ttaagccggt tacaagcccg ccgccgtctg ggagccttga agctttgctg     54120
     aaagcggcgg accgaccggc tgtttttgtt gattttctcc atacaaaaaa caagaaaggc     54180
     acttcgtgga tgtatacccc gcggactgcg ctctattggg ggtacatgga agagcagatg     54240
     atcctgaagg aacaatatga cggtgtcatt tggctggagc atatcacgcc ctctgtcatt     54300
     atcaagtgag cggtgtcccc tgtggtaaac aggggatttt tacatatcgc aaaaataatc     54360
     aaaacatata atccgtgatc cattattcta aaacagaaag gagattggag cgtgcagtgt     54420
     attatgaaaa agctgtccag aaaacaatca attggattga atcacattta catgagcaaa     54480
     tatcaaacga ggatattgtt aacgtttcaa gcttttcaaa attccatttt catcggattt     54540
     ttcaaaaaga agtcggcatg tcggttgctt cttatattcg gttaagacgt cttgcgaatg     54600
     cggcggcagc tttgctttat acagatcatc gtattatcga tattgctttg tattatcagt     54660
     ttgaatctca agaagcattt acgaggacgt tcaaaaagat gtatcacatg ccgccaggag     54720
     cataccgaac atttatgaaa cgctttactt caaaaaagga ggaatcttac atggagaaaa     54780
     aaatgaaagg ctgggtattg agcgggagcc atccgttcca attcgaaatg gggattgacc     54840
     gggaaaatgt acatcaggga aaagcttcag ggtatttaaa gtcaacgatg gttcaggata     54900
     tcggtgaatt tgcgacgatg atgcagcaat tcaaagcaga tcgctatcta ggaaaaaggc     54960
     ttcgtctatc aagttttatc aaaacaaagg gggtgcagca ttttgcctca ctttggatgc     55020
     gggttgacag tgctgctgat gatgttctcc aatttgataa tatgagcaac agacctatta     55080
     ccggaacaac caattggaat cattatgcta tcgttttaga tgtcccagaa aatagcgctg     55140
     tgatatcttt tggcgttcaa ttatctgggc cgggtcaggt gtggatggat catgttgttt     55200
     ttgaagaggt agatgagagc gttccttcaa caaaccttga aatgccggga gaacttttag     55260
     atgaaccggt aaatttatct tttgaagagg aactacaaaa atagttttca gacaactact     55320
     tttattagtg agttaatgga aaatactatt tgttattaat aaacccttgt gctgcttagg     55380
     tttgtaagag cttggatatt tttatcagtc tgggcggatc tgttcatctt tgcggcattt     55440
     tcctgtatga tatagtaaga gtgtgcatag caactaacta taattgaaca gggtgtttaa     55500
     aacatggaaa aacaatacag agtattactt tactataaat atgttccgat tgaagatcca     55560
     gaggcgttta gagagcagca tctggctttt tgtaaggagc ttggtttgtt aggccgtatc     55620
     cttgtttctt ctgaaggaat taacggtacg gtatcaggta cggttgaaca gactgaaaaa     55680
     tatatggaaa caatgaaagc tgatcctcgc tttgcggaca tggtatttaa aattgatgaa     55740
     gcagaaggcc atgccttcaa aaaaatcttc gtccgccata aaaaagagct tgtaacgctt     55800
     cgtcttgaag atgatgtcga tccgaacgaa acaacaggcc agcatttgaa gcctgcagaa     55860
     ttttatgaga agatgcagga tccaaacaca attgtcatcg acgcgcgtaa cgattacgag     55920
     tatgaccttg gccatttcag aggtgcggtc cgtcctgaca tcgaagcctt ccgtgaatta     55980
     cctgaatgga ttgaagagca caaagatatg cttgaaggca aaaagatttt aacgtactgt     56040
     acaggcggcg tgcgctgtga aaagttctca ggatggctgg tgaagcaagg ctttgaagat     56100
     gtagctcagc ttgatggcgg aatcgtgaca tacggaaaag atccagaggt gcaaggcaag     56160
     ctttgggacg gccagtgcta cgtatttgat gaaagaatca gcgtgcctgt caaccgtgtc     56220
     gagcatgtga ttgtcggcaa ggactacttt acaggagaac cgtgtgagcg ttatgtgaac     56280
     tgcgcaaatc catcttgcaa taaaaaaatg atatgcacac cggaaaatga gtataaatat     56340
     atgcgcagct gcagccacga atgccgcacg aacccaagaa acctgtatgt gaaagagcat     56400
     aatatgacag aagaagaagt aaacgcaaga ctggcagcga ttgaaacaga agatcacgct     56460
     gctgctgaat aaaaaaagaa cacctcgtat tgaggtgttc tttttttcta tatactttca     56520
     gtttggctgt ttgcggaaac ccattctttt tggcggaagg ccttttccca ttttgatacc     56580
     acgatacagg cgatcgcatg tcccggtacg ttcacgcctg ttctcgccat gtccatgacg     56640
     cggtcaacac ccgcgataat ggcaacgcct tcagccggca gtcctacagc attggcagtc     56700
     gccagaagaa ctacaagcga tcctgagggt acagctgcaa tgcctttact ggtcatcaca     56760
     agcacaagca tcatgagcag ctgctgggac aatgtcatgt ctacttgaaa ggcctgtgcg     56820
     agaaagatac aagaaaccga taaatataag ctggagccgt cacagttcaa tgacaagccg     56880
     gagggaacga caaatgatac cactcgtttg ggacagccgt atttctccat tctatccatc     56940
     agctgaggga gaatggtttc agtgcttgtg gtggaaaatg caattaaaaa cagatcccat     57000
     atcattttca atacttcgaa atacttaatc tgaaagatga gaccgacaag cggaaagagg     57060
     acaaagagga tcaggaacag gccaaggaat acggtgccaa ccagcttaaa catagggagg     57120
     aggagttcaa tgccatattg gcctacagaa gcagccatca gggctaacac gccgatagga     57180
     gcagtgacca tgacgatttg cgtgagcttg aacataatct gagctgtaga ttcaaaaaac     57240
     ttcattactg gttcagaagc tttgccgata ccagctgcgg cgacaccaaa taaaatggcg     57300
     aagaaaataa cggcaagcaa atcatttctg gccatgacat caataatgtt tgtagggata     57360
     atatccagga tcatttgctt gaaatcaaca actttgtctg tgtagccgga aagttcatga     57420
     atatcttttt ttgccaaatg ggagaggtca agcccgacac ctggttttaa gacattcgct     57480
     aataaaagtc caagccctaa taccaacgtt gtaatcactt cgaaccaaat gatcgtcttg     57540
     atgccgagac tgcccatttt tttcatgctt ccgcttcctg cggctccaat gacaatggta     57600
     gaaaatacaa tcggcacaac aatcatttta atcaggcgga taaatccatc tccgacaggc     57660
     ctcagtgcca tcccgaaatc aggaaaaaag tggccgatca ccgcgccgac agccaaagcg     57720
     attaaaattt gaaacgcgat taattttttc aaatgaatcc ccctttagaa cgatagaatg     57780
     taggcatatt catatcattc gtgattcaaa tgcaaacacc ttttttcaag ttattttatt     57840
     ttgacagcgc tttcattatg ttggcgaaaa agtcccccgc agcagggggg acttttttac     57900
     ttcatttgaa tgtgctttag atcttcttca gaggtatttg tgaaaataac cggtgttatg     57960
     gctgaagcgg catgctgctt gatgtaattg agatcaaagg tgagaagcag ttcgccttgt     58020
     ttgacggctt gtccgcttgt gacatgtgct tcaaagcctt ccccattcag tttgacggta     58080
     tcgatgccga catgaatcag gatttcagtg ccgccggcgc tcataaagcc gatggcgtgt     58140
     tttgtcggaa aaatcgagac gatctcgccg tccgcaggtg caacgacttt tccttctgat     58200
     ggtataatcg caaatccctc gcccatcatt ttttctgaaa agacctgatc aggcacatcc     58260
     cctaaagaga ctgtttctcc tttaatcgga taaataaagg tctcatcgga atcgggcttc     58320
     agcggtttgt cagttaccgt gtccagcgcg gcggcggtgg cagggacgcc tccggccatg     58380
     attgttttga tgtcgtcttt taaggcatcg gacttggttc cgaatattgc ctggaagttg     58440
     ttgttgacct ccagcacacc tactgcacca agccgtttta attcatcctt gcagacttgg     58500
     cttggctgat gaacggtcac acgaagcctt gtgatacatg catccaggtt agcgatattt     58560
     tgctgtccgc ccaaggcctg cagcacgtga aaggcaagct ggtcttttgc aactggagct     58620
     ttctcctcat tctgaccgtc ttcatctgtc tcacggccgg gcgttttcaa attccatttc     58680
     agaatcgcaa atcggaacaa ataataataa atgaaagcaa acacgatccc gacaggaatg     58740
     acaacccagc cgtttgtaga cagtccgtag ttcaagacgt agtcaattcc tccgcctgag     58800
     aacgtatagc cgtggcggac atggaataaa tcacaaacga caaagatgac gccggcaaga     58860
     atagagttaa tcaaatagag cacgggcgca acgaacaaga aagaaaactc aaccggttct     58920
     gtaattccgg tcagcataga tgtgagcgcc gcagaaatca tcacgccgga gatcattttt     58980
     ttcttttccg gacgcgcggt atggataatg gcaagagcaa cggccggcag acagaaaatc     59040
     atgtaaggga aatcccccat cataaagcgc ccggctgtcg ggtctcccgc gaaaaacctt     59100
     gtcaggtcgc cggttacggt gttgcctgtt gatgggtctg tgtattctcc catcataaaa     59160
     tagaaaggcg tataaaaaat atgatgcagg ccaaaaggaa tcagcaaacg atagatcgtt     59220
     gcataaaaga acaggccgac tgttgaatcg gcaattaaac tgctggctgc gttaattccg     59280
     ttttggatca gcggccaaac gaatgagaaa atgacgccga tcaccaatga actgacggaa     59340
     gtaatgatcg ggacaaagcg ttttccagag aaaaatccaa ggaccggatg cagctcgatt     59400
     gatgaaaatc gcttatataa ataggcggcg agaagcccga taatgattcc tccgaaaacc     59460
     cccatatcaa tcaggtgctc ggctccttca tacggaggct gaaggccgag taattttccc     59520
     atattgtcga gggtgacggt taaaattaag tatccgatga cagcggcaag tccggctaca     59580
     ccttctccgc cggctaatcc gatcgcgacc cccacggcga aaatcagcgg aaggttatcg     59640
     aatacaacgc cgcccgcatc ctttataata gggatgttca gtaaatcctt gtctccgaaa     59700
     cggagcaaaa gacctgctgc cggcaggacg gcaaccggag tcatcaacgc gcggccaagc     59760
     tgctgcagaa tttgaaatgc ctttttaaac atgacagtct ccttttattg tgttatgaga     59820
     atgatgcact ctttaatttt tgagctgctt tataatcggc gataacggtt acatgattgt     59880
     gtttttgaag aatggaggct ggtacatctg tcgtgacagg accttcagcc atcttttgaa     59940
     tggcgtctgc tttttcctcg ccgcttgcta aaagcacaat atgtttgctg aattccatga     60000
     tggttttaat gcccattgaa atcgcgagtc tcggaaccag caccggatcg ccgccgaaga     60060
     atctggcatt tgcctgtatc gtgctttccg agagcttcac aacacgtgtc cggtcttcaa     60120
     aatcagatcc cggttcatta aaaccgatat ggccattggc gccgatgccg agaatttgga     60180
     catcaatgcc tcccgcctgg cggatgagat cctcgtatac tttgcatgcc gcctcaagct     60240
     gcggattgtc tccttgcggg atatgaatat gatcaggctg catattgata tgctgaaaaa     60300
     gatgctcatg cataaaatgg ttataacttt gcggatgaga tggagagaga ccagcatatt     60360
     catccaaatt aaatgtagta acctttgaaa aatcaatttc gcctgcctga tagtctgaaa     60420
     tcaactgctt atacaagccg accggtgtgc ttcctgttgc caggccgaga acggcatctt     60480
     tcttagcttg tatttgttct ttaataatgg cagcgcttaa cttacagagt tcttcgtagt     60540
     gctcggcgat cagaatcttc atgtgacacc ccctcaaaga gatagacaag caccatattt     60600
     gttatgacca atttatgata cttgtcatta cgaatttagc accgccctta tcaaactgtc     60660
     aatattaatt tctgaaaatt tgttataaaa gaaggataca aatctttcat attgggaggg     60720
     caaatggtat tatggtctca atgaaaaaga acggattgca tacagaatgg ggagaatgaa     60780
     atgacagctt tatattctgt tatcaagttt aaaatcattg agttaattaa atcgggcaaa     60840
     tatcaggcga atgatcagct gccgacggag agtgagtttt gcgaacaata tgatgtcagc     60900
     agaacaactg tgagactggc tctgcagcag ctagagcttg agggatatat taaaagaatt     60960
     caaggaaaag ggacatttgt atcggcggcc aaaatacaaa cgccgattcc gcataagatt     61020
     acgagctttg cagaacaaat gagaggactt cgttctgaat caaaagtgct tgagcttgtg     61080
     gtgattcctg ccgatcattc catcgccgag cttttgaaaa tgaaagagaa tgaacctgtc     61140
     aacaagcttg tcagagtcag atacgccgag ggggaacctt tgcagtatca tacctcatat     61200
     attccctgga aggcggcacc ggggctggcg caggaggaat gcaccggctc gctgtttgaa     61260
     ttgttaagga caaaatacaa tattgaaatc agcaggggca cggaatcgat cgaaccgatt     61320
     ttaacggatg aaacgatcag cggacactta ttaaccaatg tcggagcgcc tgcgttttta     61380
     tcagaatccc ttacctatga taaaaatgaa gaagtggtgg aatatgcgca aattattaca     61440
     cggggagacc gaacgaaatt caccgtagaa cagtcatatc attcataaag caatgtgttt     61500
     taagaaggga atggtggttc tatgttttta tttacgaatg gaaaagtgct gtggggagca     61560
     gtgattgctg cattcatcct ttcaattgta ttttaccctt ttctgccgac gcagatgccg     61620
     attcattatg atgttgcgac agtccggatc tgacggttaa caagctggcg gggactgtga     61680
     tgctgcctgt tttgatggtg gtgtttgcat gggcgcggaa gatcaattgg caatttgtat     61740
     tcgcagtgta tattttgctg atttgccaca ttgtcgtcct ttgtttagcg ctctaaatca     61800
     aacagccaga ataaaactgg ctgttttctt taatttcagc ttcatctgac aatgaatgtg     61860
     gtgtataata gctgatgatc ctaaagaata ttctgaaatt tataggtgtg aagcggcgta     61920
     ttattaaagg aaaggctgta tactttttgc agctttaaaa agactgaata tttaaacaat     61980
     tatgtgaaag gtgtgctgat tagattgaat aagcttattg aacgagaaaa aactgtatat     62040
     tataaggaaa agcccgaccc gtcttccttg gggtttggac aatattttac agattatatg     62100
     tttgtgatgg actacgaaga ggggattgga tggcatcatc cgagaattgc gccgtacgca     62160
     ccgcttacgc ttgatccgtc ttcatctgtt tttcattacg gccaggctgt ttttgaagga     62220
     ttaaaagcat acagaacaga cgacggcagg gtgctgctgt tccgtccgga tcaaaatatc     62280
     aaacggctga acagatcgtg tgagcgcatg agcatgcccc ctttagacga agagctggtg     62340
     cttgaggcat tgacgcaatt agttgagctg gagaaagatt gggttccaaa ggaaaaagga     62400
     acgtcactgt atattcgtcc ttttgtcatt gccacagaac cgagtctcgg tgtgaaggca     62460
     tccaggagct atacatttat gatcgtgctt tcgcctgtcg gctcctatta tggcgacgat     62520
     cagctgaagc cggttagaat ctatgtcgaa gatgagtatg tgagggcggt caacggagga     62580
     gtcgggtttg caaaaacggc tggaaactat gccgccagtc ttcaggcaca gcggaaagcg     62640
     aatgaactgg gctatgacca ggtactgtgg ctggacgcca tcgaaaagaa atatgtggaa     62700
     gaagtaggga gcatgaacat ctttttcgtc ataaacgggg aagctgtcac acctgcttta     62760
     agcggaagca ttttaagcgg ggttacacgt gcgtctgcga ttgaattgat tcgaagctgg     62820
     ggcattccgg ttcgtgaaga gagaatatcg attgatgagg tgtatgcggc ctctgcacgc     62880
     ggagaattga cagaggtctt tggcacaggc acggcagcag tcgttacgcc tgtcggtgaa     62940
     ctcaacatcc atggaaaaac ggtgattgta ggcgacgggc aaatcgggga cctctcgaaa     63000
     aagctgtatg aaacgataac agatattcag cttggcaagg taaaaggccc gtttaactgg     63060
     acagtggaag tgtgaaaatc gaaaaagaac ctgcccggag gcaggttctt tttattttga     63120
     atgagtcata tcagcagccg gctggctttt gcggtttttt acataatata ttgcatagca     63180
     aatggccata aatggaacgc cgcaatagag tgcgattctt tgattcggat caaaggcaat     63240
     gccaacgacg gaagccaggc ataacaggaa cgcagcaatc ggcacgaacg gatacaaagg     63300
     ggttctgtat ttcaaatcag taaccttgtt tcccgcttcg atataacgtt ttctgaacat     63360
     gaattgagaa gcagcgattc ccatccacac gacaacgacg gcaaaaccgg aaatcgacac     63420
     gagcacaacg tatacagtgt ctggcgcaaa tacgctggac agcaacgaca gaatgccgcc     63480
     gatcatgctg aacaccagcg cgttaaaagg ggttcctttt gacgtcagct ttgcaaatgt     63540
     cggatgaagc gttttttctt ttgataaaga ccacagcatc cgggaagaag cgtagagtcc     63600
     ggaattagcc gctgacagga tcgctgtcag gataacaaag ttcatgatat cggctgcgta     63660
     tggtacaccg actctgtcaa agacagcgac aaacgggctt ttgatgacac ctgcatcttg     63720
     aatcggaatc agccctgaca gcacaaaaat tgttccgaca aagaagagcg agagacgcca     63780
     gaccgttgtt tttatcgctt ttggtatcgt cttgtcagga tcaacgcttt caccggctgc     63840
     gattccgatt agttccgttc ccgaaaaggc aaaattgacg gacagcatcg tcatcaaaat     63900
     cgggacaaat ccattgggaa aaagcccgcc ttccgccgtg aagttggaca gcatcggagc     63960
     ggcttctccg cctttgatcg ggatgatgcc gaacatggca gagccgccta aaagaataaa     64020
     taatacaatg gctaatactt tgatgctgga aaaccaaaat tctgattcag cgaaaaactt     64080
     gaccgaaaat gcgttaagca agaagatgaa cagcgcaaag acggcactcc acatccaaac     64140
     cgatgtatgg gggaaccagc gctgcattaa caggccggct gctgtgaatt ctgatcccaa     64200
     tgccacggtc catgtcagcc aatacagcca agcgaccgta aatccggtgc ccggccctat     64260
     gtatttggct gcataggtgt gaaaggcgcc ggtcacaggc atggcgactg acagctcacc     64320
     gaggcatagc atgaccagat agacgatgcc ggccccgact aagtaggcga gtatcgttcc     64380
     ggccgggcct gcttgctgaa tggtataacc tgagcttaaa aacagcccgg ttccgatgac     64440
     acctcccaag gaaagcataa agaggtgccg gcttttcata cttctctgaa aggttgtctc     64500
     attcttgttg tgggcagagt tcatcttttt ccaactttct atcagcgatt tatttccttc     64560
     ctaataaaaa atctcatgtc agaaagtgac acgagactcc ggcgaaccgg ctttaagtta     64620
     gaatatacaa actattccga taagtcaagt tgtttttaaa gagcgggccc aagccgcaat     64680
     ttcttgaata ttttcgggtt ttgtccggca gcagccgcca atcagcctcg ctcctttttc     64740
     atgccaggtg cgggcgctcg ccccgtaaga ttctgcgcat gctgcgccgt tccacgtttt     64800
     tgtttccgga tcatattgct cacctgaatt cgggtagaca atgatcggtt ttgacgtgtt     64860
     cttttttaac tcctctatca aggaagggat atgctgaagc ggcgtgcagt tgatgccgag     64920
     tgctgcaatt tggcggtgtt catcaagcca cgatgcgcag tcagctgcag gtgttccgtc     64980
     actgatatgc aagccgtctt tagcactgaa gctgatccat gcatacgttt caggaaattc     65040
     cttcaacagc cgaacaatcg ctttggcttc agtcagacac ggaatcgttt cgcatgccaa     65100
     tacatcagct ccggcttcaa tcagcgcctt catccggggg cgatgaaatt caatcagttc     65160
     atcttctgat attgcgtagt tgccgcgata ctcagacccg tctgcaagat aagcgccata     65220
     agggcctata gaagccgcaa tgatcggttt tggccgattc aaacggttct cttcaagcga     65280
     ccaaaattca tcacgtgctt cagctgcgat gctgacggac aactcgatga gccggcgtgc     65340
     ttccgcttcg ctcagcccgc gtgcggcaaa gccttcaaat gtagactgat agctggcggt     65400
     gattgcacaa tcggcgcctg ccgcaaaata atcagtatga acttgtttaa tcagctccgg     65460
     ctcttccatc aggatttttg ccgaccacag actgtcattc aaattacagc ccttgcgttc     65520
     aagctcggtc gccatggcgc cgtctagcac aataagcggg tatgtatcta atatgtgttg     65580
     gataggattc atagaatgta ccgatgcctt ctttcagatt tttttgaaaa agatatgaaa     65640
     atcgtaatgg aggcttacgt gtttgtcaat aaacgcaaaa agagaaaggt gttcagccca     65700
     tatgtctgaa cacccttttc ttatgatatt tgtttgttgt gcgtgtcagt ctttgtgtct     65760
     gaaaccggcc agcactcaat gccattatgg tttttgagca catctttata aaagaccgga     65820
     tccttgcctg cttttttctg gcgtgtatag tctttcagcg ccgtaaaaac gacctttgat     65880
     agtaagaaaa tcgcgattaa attcacgatg accatcaaac ccatgaacaa atcagcaaga     65940
     tcccagacga gctggacttt ggcaacacag ccaaacacga tcattgccag cacgccgata     66000
     cggtagacaa aaatcagttt tttgcttttg ttcaaaaagc cgatattggt ttcgccataa     66060
     taatagtttc caattagagc acagaatccg aataacaaaa tcagaatcgc gagaaagcct     66120
     gatgcccatg atccgacatg ggagctgagg gaggcttgtg tcaaggcgat tccgctcaga     66180
     cccggagtat gataggcatc cgaaaacaga atgataaaag cggtgcttgt acaaatgacc     66240
     agtgtatctg tcagtacacc aaaagcttgg atcagcccct gtttgacggg atggcttgtt     66300
     gtggcggtgg cagcggcatt tggtgcgctt cccattcccg cttcgtttga aaagattccc     66360
     cgtctgacgc cttgcatgag tgccgcgccc aaagccccgc cggcggcctg gtcaaaacca     66420
     aacgcatttt tcacgattag cgcaagcaca cctggcagct gcgtaatgtt ggagaaaatg     66480
     acgaaaaacg caactccgat atacaggaca gccaatacga cgacaatgga ttcagccagc     66540
     tttgcaatgc gcttgactcc gccaaaaata atcgtgccga atacagcaat taaaatgagt     66600
     cccaatgtca ggcggtttgt gccaaacgcg ttttcaaagg caaggctgac tgtattggat     66660
     tgaaccgagt tgaagacgat accgaacgat aaggtgatta acacagcgaa cagcgcgccc     66720
     atccaccttt tgttcagccc tttttccatg taatacgccg gcccgccgcg gaagccgttt     66780
     acatctttta ctttataaat ctgagccagt gtgctttcca caaagctgga tgctgatccg     66840
     ataatggcga taatccacat ccagaagatt gcaccgggcc cgccgagtgc aatggcgata     66900
     gcaatgcccg taatatttcc cgttccgaca cgggccgcca tgctgatgca aaaggcttga     66960
     aacggagaaa tgctgttttt tgaccgggaa gcagcacctt ctcttaatac cctgaccatt     67020
     tctttcagca tgcgaacctg taaaaactta agcctgaaac gtaaaaatag attccaaaag     67080
     aaaggagcaa aacaattaat agctttgacc acaaaagatc atttgcaata ccgacgatat     67140
     gttctaggat ttgctgcata gaatcacctc ttttttcatg tttaaaaaat gctgagctcc     67200
     cattcctgcg ccatatgctt cagcagcata ccgccagtga ggctgttgcc gtattcatca     67260
     atggcaggcc cgtaaatgcc gatgccgcat ccggattgaa aaggctgttc tcttctggcg     67320
     cttggaggca ccagcgccat gatgccgccg gagacgccgc ttttggccgg cacgccgaca     67380
     aacgccgcat atttgcctga agcgttgtac atgccgcacg tcagcattaa tgccttggcc     67440
     aattttgcca catcttttgg aatcacctgc tcgtgtcgaa tcggatgata cccgtcatga     67500
     gcaaggatca ggccgatcaa cgcaatatct tctgtagtgc tctccatagc gcattgcttc     67560
     aagtacacct caagtgtttc ttctacttca gcttctaaaa agtttgtttc ttttaaatag     67620
     taggccagcg ctctgttgcg gtgggcggtt tcccattcag aacggaatac ttcttcatga     67680
     attcttggcc gttttcctat caaagtttcc atcaccgagt aaagaaactc gagcttttcg     67740
     tatgcagatt ctccgggaag gatcgaagcg atggtgaggg cacccgcgtt gatcatggga     67800
     ttgaagggct ttcccggctt gttgatttcg agccgaatga ttgaattaaa ggcgtcacct     67860
     gtcggctcga catctacgcg gtcaagcaca tagggaatgc cgcggctcat gcaggcggca     67920
     ataaagctaa tcacttttga aatgctttgc atggtaaaag agacgttcca gtcgccggcg     67980
     tgtatcatcg ttccatcagg ctccaataca cagatgccga gctgtgaatc attgactttt     68040
     cctaaagcgg ggatatagtt tgcgctttgt ccattggcgg caaaagggcg atagtattca     68100
     acccaatcat gaagctgtaa cgccgggttt atgtctttct ggtgctcttt tatcaattct     68160
     ttcatcgaat tcctcctcac tgattttttt cttaaaggac tgaggtgtat caaaacgaag     68220
     gctaaggggg cgttaaacgc tttcataata gcggaaggta taattactgt ataatggaga     68280
     ctacagaatc atacaaaata cgacaaaaac attttgaaaa taagcagtaa gatttataaa     68340
     aacctcatgt tctgggtcaa aagcaatttg caggttttct cccgattccc caaaataaaa     68400
     agcgaggatg tgatcaacat aaaactggaa cggtttattg aaaaagacgg atatatactg     68460
     gccctcatgc tgattacggt gccgctggcc ggtgaactga aattttatcc cctcaatgaa     68520
     gaattccggg tcagctttgg ggcaccggtt tttttcttct ttttatcatt gttgcggcat     68580
     gtgctccgct gtgctgccgg gttttctgac tggagcggct gttttcatct ttcgcgtctt     68640
     tctggaatta tggggcggag gacacaatgg gctgactccg attctgtatg atcaagcgtc     68700
     tggctttttc ttttatatga cttacgcctg tctgttttcc atattaaagg ccaatcgttt     68760
     ccgtgaacgg ccgattatgc tcggtttcat tgggtttatg attgaagttg tgtcagattg     68820
     tgtcgagcta actgtgcaat ttctcatttt tcatacggtt gtcacgcctg agaaaatcac     68880
     tgacattgcg gtgattgcga tttctcacac atttattgtg atgagctttt atagtgtgct     68940
     gaagctgtat gaaacacaat cgagagaaaa acagacaagg cagcagcacg agcacatgct     69000
     gatgatcgtt tccaatttat atgaagaaac ggtgcaccta aaaaagacat tgaaaacgac     69060
     agagaaagtg acaaacgatt cgtatcagct ctatcgggaa atgaagggca aggatgttca     69120
     gctgagcggc agaatcctga gactggccgg agagattcat gaagtgaaaa aggacaacca     69180
     gcggatattc gcagggcttt caaaactgat ttcgaatgag agtttgagag attatatgag     69240
     ggcttctgat ttgctgcagc tcgtgattcg aatgaatgaa aagtacgctg aagcactagg     69300
     gaagcagatt gatttttact gctcgatcga gggagagcat gacgaatatc acgtatttat     69360
     cgtgctttcg atcattaata atctaacagc aaatgcggta gaggctatgg atgaagaggg     69420
     aatggtcagc ctgaggctcc gtaagccaaa tgagagtatg gtagaattcc aggtggaaga     69480
     caatggcccc gggatttccg agaaaatcgg agacattgtg tttgacccgg gctttacttc     69540
     aaaatatgac gaatttggca cgccttctac gggtatcgga ctttcctacg taaaggaaat     69600
     cgtgacagag ctagaagggg atatcacgtt tgataatcag cagcggggag                69650
//

If you have problems or comments...

PBIL Back to PBIL home page