(data stored in ACNUC10243 zone)

EMBL: AB006816

ID   AB006816; SV 1; linear; mRNA; STD; ROD; 1062 BP.
XX
AC   AB006816;
XX
DT   10-SEP-2007 (Rel. 93, Created)
DT   10-SEP-2007 (Rel. 93, Last updated, Version 1)
XX
DE   Rattus norvegicus hnRNP mRNA for heterogeneous nuclear ribonucleoprotein
DE   B1, complete cds.
XX
KW   .
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-1062
RA   Kamma H.;
RT   ;
RL   Submitted (25-AUG-1997) to the INSDC.
RL   Hiroshi Kamma, University of Tsukuba, Institute of Basic Medical Sciences;
RL   1-1-1 Tennodai, Tsukuba, Ibaraki 305, Japan
RL   (E-mail:hkamma@md.tsukuba.ac.jp, Tel:81-298-53-3320, Fax:81-298-53-3320)
XX
RN   [2]
RX   DOI; 10.1006/excr.1998.4323.
RX   PUBMED; 9925756.
RA   Kamma H., Horiguchi H., Wan L., Matsui M., Fuiwara M., Fujimoto M.,
RA   Yazawa T., Dreyfuss G.;
RT   "Molecular characterization of the hnRNP A2/B1 proteins: tissue-specific
RT   expression and novel isoforms";
RL   Exp. Cell Res. 246(2):399-411(1999).
XX
DR   MD5; 01890a0ae5beb88f777d573f57247ce4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1062
FT                   /organism="Rattus norvegicus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10116"
FT   CDS_pept        1..1062
FT                   /codon_start=1
FT                   /gene="hnRNP"
FT                   /standard_name="hnRNP B1"
FT                   /product="heterogeneous nuclear ribonucleoprotein B1"
FT                   /db_xref="GOA:A7VJC2"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034486"
FT                   /db_xref="InterPro:IPR034489"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7VJC2"
FT                   /protein_id="BAF79676.1"
FT                   /translation="MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWG
FT                   KLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGK
FT                   PGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDH
FT                   DPVDKIFLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPG
FT                   PGSNFRGGSDGYGSGRGFGDGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQGG
FT                   GYGGGYDNYGGGNYGSGNYNDFGNYNQQPSNYGPMKSGNFGGSRNMGGPYGGGNYGPGG
FT                   SGGSGGYGGRSRY"
XX
SQ   Sequence 1062 BP; 320 A; 145 C; 340 G; 257 T; 0 other;
     atggagaaaa ctttagaaac tgttcctttg gagaggaaaa agagagagaa ggaacagttc        60
     cgtaagctct ttattggtgg cttaagcttt gaaaccacag aagaaagttt gagaaactac       120
     tacgagcaat ggggaaagct cacagactgt gtggttatgc gggatcctgc aagcaaaaga       180
     tcaagaggat ttggctttgt aactttctca tctatggctg aggttgatgc tgccatggct       240
     gcaaggcctc attccattga tggcagggtg gttgagccaa aacgtgctgt ggcaagagag       300
     gagtctggga aaccaggagc ccatgtgact gtgaagaaac tgttcgttgg tggaattaag       360
     gaagatactg aggagcatca ccttagagat tactttgaag aatatggaaa aattgatact       420
     attgaaataa ttactgatag gcagtctgga aaaaaaagag gctttggctt tgttaccttt       480
     gatgaccatg atcctgtgga taagattttc ttgcagaaat atcacaccat aaatggtcac       540
     aatgcagaag ttagaaaggc attgtctaga caagaaatgc aggaagtcca aagttctagg       600
     agtggaagag gaggaaactt tggttttgga gattctcgag gtggcggtgg caattttgga       660
     ccaggaccag gaagcaactt tagggggggt tctgatggat atggaagtgg acgtggattt       720
     ggggatggct ataatgggta tggaggagga cctggaggtg gcaattttgg aggtagccct       780
     ggttatggag gaggaagagg aggatatggt ggtggaggac ctggatatgg caaccagggt       840
     gggggctacg gaggtggtta tgacaactat ggaggaggaa attatggaag tggaaattac       900
     aatgattttg gaaattataa ccagcaacct tctaactacg gtccaatgaa gagtggaaac       960
     tttggtggta gcaggaacat gggaggacca tatggtggag ggaactatgg tcctggagga      1020
     agtggaggaa gtgggggcta tggtgggagg agccgatact ga                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page