(data stored in ACNUC10243 zone)

EMBL: AB006817

ID   AB006817; SV 1; linear; mRNA; STD; ROD; 906 BP.
XX
AC   AB006817;
XX
DT   10-SEP-2007 (Rel. 93, Created)
DT   10-SEP-2007 (Rel. 93, Last updated, Version 1)
XX
DE   Rattus norvegicus hnRNP mRNA for heterogeneous nuclear ribonucleoprotein
DE   B0a, complete cds.
XX
KW   .
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-906
RA   Kamma H.;
RT   ;
RL   Submitted (25-AUG-1997) to the INSDC.
RL   Hiroshi Kamma, University of Tsukuba, Institute of Basic Medical Sciences;
RL   1-1-1 Tennodai, Tsukuba, Ibaraki 305, Japan
RL   (E-mail:hkamma@md.tsukuba.ac.jp, Tel:81-298-53-3320, Fax:81-298-53-3320)
XX
RN   [2]
RX   DOI; 10.1006/excr.1998.4323.
RX   PUBMED; 9925756.
RA   Kamma H., Horiguchi H., Wan L., Matsui M., Fuiwara M., Fujimoto M.,
RA   Yazawa T., Dreyfuss G.;
RT   "Molecular characterization of the hnRNP A2/B1 proteins: tissue-specific
RT   expression and novel isoforms";
RL   Exp. Cell Res. 246(2):399-411(1999).
XX
DR   MD5; 4890c0be53794db7a7ba99162f8946da.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..906
FT                   /organism="Rattus norvegicus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10116"
FT   CDS_pept        1..906
FT                   /codon_start=1
FT                   /gene="hnRNP"
FT                   /standard_name="hnRNP B0a"
FT                   /product="heterogeneous nuclear ribonucleoprotein B0a"
FT                   /db_xref="GOA:A7VJC2"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034486"
FT                   /db_xref="InterPro:IPR034489"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7VJC2"
FT                   /protein_id="BAF79677.1"
FT                   /translation="MEREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPA
FT                   SKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFV
FT                   GGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIFLQKYH
FT                   TINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGY
FT                   GSGRGFGDGYNGYGGGPGGNYGSGNYNDFGNYNQQPSNYGPMKSGNFGGSRNMGGPYGG
FT                   GNYGPGGSGGSGGYGGRSRY"
XX
SQ   Sequence 906 BP; 276 A; 128 C; 279 G; 223 T; 0 other;
     atggagagag agaaggaaca gttccgtaag ctctttattg gtggcttaag ctttgaaacc        60
     acagaagaaa gtttgagaaa ctactacgag caatggggaa agctcacaga ctgtgtggtt       120
     atgcgggatc ctgcaagcaa aagatcaaga ggatttggct ttgtaacttt ctcatctatg       180
     gctgaggttg atgctgccat ggctgcaagg cctcattcca ttgatggcag ggtggttgag       240
     ccaaaacgtg ctgtggcaag agaggagtct gggaaaccag gagcccatgt gactgtgaag       300
     aaactgttcg ttggtggaat taaggaagat actgaggagc atcaccttag agattacttt       360
     gaagaatatg gaaaaattga tactattgaa ataattactg ataggcagtc tggaaaaaaa       420
     agaggctttg gctttgttac ctttgatgac catgatcctg tggataagat tttcttgcag       480
     aaatatcaca ccataaatgg tcacaatgca gaagttagaa aggcattgtc tagacaagaa       540
     atgcaggaag tccaaagttc taggagtgga agaggaggaa actttggttt tggagattct       600
     cgaggtggcg gtggcaattt tggaccagga ccaggaagca actttagggg gggttctgat       660
     ggatatggaa gtggacgtgg atttggggat ggctataatg ggtatggagg aggacctgga       720
     ggaaattatg gaagtggaaa ttacaatgat tttggaaatt ataaccagca accttctaac       780
     tacggtccaa tgaagagtgg aaactttggt ggtagcagga acatgggagg accatatggt       840
     ggagggaact atggtcctgg aggaagtgga ggaagtgggg gctatggtgg gaggagccga       900
     tactga                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page