(data stored in ACNUC10243 zone)

EMBL: AB006818

ID   AB006818; SV 1; linear; mRNA; STD; ROD; 942 BP.
XX
AC   AB006818;
XX
DT   10-SEP-2007 (Rel. 93, Created)
DT   10-SEP-2007 (Rel. 93, Last updated, Version 1)
XX
DE   Rattus norvegicus hnRNP mRNA for heterogeneous nuclear ribonucleoprotein
DE   B0b, complete cds.
XX
KW   .
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-942
RA   Kamma H.;
RT   ;
RL   Submitted (25-AUG-1997) to the INSDC.
RL   Hiroshi Kamma, University of Tsukuba, Institute of Basic Medical Sciences;
RL   1-1-1 Tennodai, Tsukuba, Ibaraki 305, Japan
RL   (E-mail:hkamma@md.tsukuba.ac.jp, Tel:81-298-53-3320, Fax:81-298-53-3320)
XX
RN   [2]
RX   DOI; 10.1006/excr.1998.4323.
RX   PUBMED; 9925756.
RA   Kamma H., Horiguchi H., Wan L., Matsui M., Fuiwara M., Fujimoto M.,
RA   Yazawa T., Dreyfuss G.;
RT   "Molecular characterization of the hnRNP A2/B1 proteins: tissue-specific
RT   expression and novel isoforms";
RL   Exp. Cell Res. 246(2):399-411(1999).
XX
DR   MD5; d16837f27e7640de98cafa99be601def.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..942
FT                   /organism="Rattus norvegicus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10116"
FT   CDS_pept        1..942
FT                   /codon_start=1
FT                   /gene="hnRNP"
FT                   /standard_name="hnRNP B0b"
FT                   /product="heterogeneous nuclear ribonucleoprotein B0b"
FT                   /db_xref="GOA:A7VJC2"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034486"
FT                   /db_xref="InterPro:IPR034489"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/Swiss-Prot:A7VJC2"
FT                   /protein_id="BAF79678.1"
FT                   /translation="MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWG
FT                   KLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGK
FT                   PGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDH
FT                   DPVDKIFLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPG
FT                   PGSNFRGGSDGYGSGRGFGDGYNGYGGGPGGNYGSGNYNDFGNYNQQPSNYGPMKSGNF
FT                   GGSRNMGGPYGGGNYGPGGSGGSGGYGGRSRY"
XX
SQ   Sequence 942 BP; 291 A; 132 C; 287 G; 232 T; 0 other;
     atggagaaaa ctttagaaac tgttcctttg gagaggaaaa agagagagaa ggaacagttc        60
     cgtaagctct ttattggtgg cttaagcttt gaaaccacag aagaaagttt gagaaactac       120
     tacgagcaat ggggaaagct cacagactgt gtggttatgc gggatcctgc aagcaaaaga       180
     tcaagaggat ttggctttgt aactttctca tctatggctg aggttgatgc tgccatggct       240
     gcaaggcctc attccattga tggcagggtg gttgagccaa aacgtgctgt ggcaagagag       300
     gagtctggga aaccaggagc ccatgtgact gtgaagaaac tgttcgttgg tggaattaag       360
     gaagatactg aggagcatca ccttagagat tactttgaag aatatggaaa aattgatact       420
     attgaaataa ttactgatag gcagtctgga aaaaaaagag gctttggctt tgttaccttt       480
     gatgaccatg atcctgtgga taagattttc ttgcagaaat atcacaccat aaatggtcac       540
     aatgcagaag ttagaaaggc attgtctaga caagaaatgc aggaagtcca aagttctagg       600
     agtggaagag gaggaaactt tggttttgga gattctcgag gtggcggtgg caattttgga       660
     ccaggaccag gaagcaactt tagggggggt tctgatggat atggaagtgg acgtggattt       720
     ggggatggct ataatgggta tggaggagga cctggaggaa attatggaag tggaaattac       780
     aatgattttg gaaattataa ccagcaacct tctaactacg gtccaatgaa gagtggaaac       840
     tttggtggta gcaggaacat gggaggacca tatggtggag ggaactatgg tcctggagga       900
     agtggaggaa gtgggggcta tggtgggagg agccgatact ga                          942
//

If you have problems or comments...

PBIL Back to PBIL home page