(data stored in ACNUC24361 zone)

EMBL: AB007886

ID   AB007886; SV 1; linear; mRNA; STD; HUM; 5471 BP.
XX
AC   AB007886;
XX
DT   05-DEC-1997 (Rel. 53, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 7)
XX
DE   Homo sapiens KIAA0426 mRNA, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-5471
RA   Ohara O.;
RT   ;
RL   Submitted (06-OCT-1997) to the INSDC.
RL   Osamu Ohara, Kazusa DNA Research Institute, Laboratory of DNA Technology;
RL   Yana 1532-3, Kisarazu, Chiba 292-0812, Japan (E-mail:cdnainfo@kazusa.or.jp,
RL   Tel:+81-438-52-3913, Fax:+81-438-52-3914)
XX
RN   [2]
RX   DOI; 10.1093/dnares/4.5.307.
RX   PUBMED; 9455477.
RA   Ishikawa K., Nagase T., Nakajima D., Seki N., Ohira M., Miyajima N.,
RA   Tanaka A., Kotani H., Nomura N., Ohara O.;
RT   "Prediction of the coding sequences of unidentified human genes. VIII. 78
RT   new cDNA clones from brain which code for large proteins in vitro";
RL   DNA Res. 4(5):307-313(1997).
XX
DR   MD5; 5bbbdbbc4fb1feb44e5f00e68c287f42.
DR   Ensembl-Gn; ENSG00000158691; homo_sapiens.
DR   Ensembl-Tr; ENST00000361028; homo_sapiens.
DR   Ensembl-Tr; ENST00000396827; homo_sapiens.
XX
CC   Sequence updated (05-Jan-1998)
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5471
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /clone_lib="pBluescriptII SK plus"
FT                   /clone="HH1274"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        <119..1960
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="KIAA0426"
FT                   /note="Start codon is not identified"
FT                   /db_xref="GOA:O43309"
FT                   /db_xref="H-InvDB:HIT000000143.19"
FT                   /db_xref="HGNC:HGNC:13172"
FT                   /db_xref="InterPro:IPR003309"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="InterPro:IPR038269"
FT                   /db_xref="UniProtKB/Swiss-Prot:O43309"
FT                   /protein_id="BAA24856.2"
FT                   /translation="NTGSSSTAKMASTWAIQAHMDQDEPLEVKIEEEKYTTRQDWDLRK
FT                   NNTHSREVFRQYFRQFCYQETSGPREALSRLRELCHQWLRPETHTKEQILELLVLEQFL
FT                   TILPEELQAWVQEQHPESGEEVVTVLEDLERELDEPGEQVSVHTGEQEMFLQETVRLRK
FT                   EGEPSMSLQSMKAQPKYESPELESQQEQVLDVETGNEYGNLKQEVSEEMEPHGKTSSKF
FT                   ENDMSKSARCGETREPEEITEEPSACSREDKQPTCDENGVSLTENSDHTEHQRICPGEE
FT                   SYGCDDCGKAFSQHSHLIEHQRIHTGDRPYKCEECGKAFRGRTVLIRHKIIHTGEKPYK
FT                   CNECGKAFGRWSALNQHQRLHTGEKHYHCNDCGKAFSQKAGLFHHIKIHTRDKPYQCTQ
FT                   CNKSFSRRSILTQHQGVHTGAKPYECNECGKAFVYNSSLVSHQEIHHKEKCYQCKECGK
FT                   SFSQSGLIQHQRIHTGEKPYKCDVCEKAFIQRTSLTEHQRIHTGERPYKCDKCGKAFTQ
FT                   RSVLTEHQRIHTGERPYKCDECGNAFRGITSLIQHQRIHTGEKPYQCDECGKAFRQRKK
FT                   TSYKEILLKNHSEPQAGVNLLLSSLIPEWQSCFRRDL"
XX
SQ   Sequence 5471 BP; 1647 A; 1089 C; 1182 G; 1553 T; 0 other;
     tccgggtccc aaaagggttc gaggcctctt gccttcgctc cgtagaggga gttctcttct        60
     ggccctgggg gccgcaggac tgtccaggaa tacagtttcc aggtgagatc ttacttgaaa       120
     caccggtagt tctagcacag ctaaaatggc atctacttgg gctatccagg cccacatgga       180
     ccaggatgaa cctttggaag taaagataga ggaagagaaa tataccacca gacaggattg       240
     ggacctgcgt aaaaacaaca cccatagcag agaggtcttc cgtcagtact tcagacagtt       300
     ctgctaccag gagacatctg gtccccgtga ggctttgagc cgactccgag aactttgcca       360
     tcagtggctg aggccagaga cccacaccaa agaacagatt ctggagctgc tggtgctgga       420
     gcagttcctg accatcctac ctgaggagct ccaggcctgg gtgcaggagc agcatccaga       480
     gagtggggag gaggtggtga ctgtgctgga ggatttagag agagaactgg atgaaccagg       540
     agagcaggtc tcagtccaca ctggggaaca ggaaatgttc ttgcaggaga cggtacgtct       600
     acgaaaagaa ggagaaccca gtatgtccct ccagtccatg aaagcccagc caaagtatga       660
     atctccagaa cttgaatccc aacaggagca agttttagat gttgagactg gaaatgagta       720
     tgggaattta aagcaagaag tttctgaaga aatggaacca catgggaaga catccagtaa       780
     atttgaaaat gatatgtcca agtctgctag gtgtggagaa actcgtgaac ctgaagaaat       840
     aacagaagag ccctctgctt gctccagaga agataaacaa cctacctgtg atgaaaatgg       900
     agtaagcctg actgagaact ctgaccatac tgaacatcag agaatctgtc caggagaaga       960
     atcttacgga tgtgatgact gtggaaaagc ttttagtcag cactcacacc tcatagaaca      1020
     tcagaggatc catactggag acagacccta caaatgcgaa gaatgtggaa aagctttccg      1080
     tgggagaact gtgcttattc gacacaaaat aatacacact ggagagaaac cgtataagtg      1140
     taatgaatgt ggcaaagcct ttggccggtg gtcagctctt aaccaacatc agagacttca      1200
     cacaggagaa aaacactatc actgtaatga ctgtggcaaa gcctttagtc agaaagcagg      1260
     cctctttcac catatcaaga tccacacaag agacaaacct tatcagtgca ctcagtgtaa      1320
     taaaagtttt agtcggcgtt ccatacttac tcagcatcaa ggagttcata ccggcgccaa      1380
     gccgtatgag tgcaacgagt gtggaaaagc ctttgtttat aactcatccc ttgtttccca      1440
     tcaggaaatc caccacaaag aaaaatgcta tcagtgtaag gaatgtggga aatccttcag      1500
     tcagagtggc cttattcagc atcagagaat tcacactggg gaaaaaccct acaaatgtga      1560
     cgtatgtgaa aaagccttta ttcaaaggac aagtcttaca gaacatcagc gaattcacac      1620
     tggagaaaga ccctataaat gtgataagtg tgggaaggcg tttactcaaa gatcagtcct      1680
     cacggaacat cagagaatcc acactggaga gaggccctac aagtgtgatg agtgtgggaa      1740
     tgccttccga ggaatcacca gcctcattca gcatcagaga atccacactg gggagaagcc      1800
     ctaccaatgt gatgagtgtg gaaaagcctt cagacagagg aagaagacca gctacaagga      1860
     aatacttctg aaaaatcact ctgaacccca agctggagtg aatcttctcc tgagctctct      1920
     cattccagaa tggcaatctt gtttcaggag agatctctaa tagtgactga tggtaaagga      1980
     agaaggctgt gcctagaaca aagaatcagg ctggcaaaga aatcacaggt ctttcctcaa      2040
     actttaaatt gctactctct ggagatagct acctggactt tacagagctg tcagaagact      2100
     tgggaaggtt tgccagcatt ggaaaaagcc acttggactt cacagagctg tcagaagact      2160
     taggaagctt tgccagtagt tcctgagacc agaaatacat attatgaagc aggtgctgga      2220
     acaggccctg gcccctactt gtgaagctgc agatataggt aagataatat catccagaat      2280
     gtggagacga ggcaatcgat gatgctggaa aagttgaaga gagagtttga atgaaggaca      2340
     aaccaccgat gggaaagctt gactagcaaa aggctttggg aataggatag aaagcagcaa      2400
     acctgaactt taggatccac cagatgtctc tggagccata acccaacatt tcccataaat      2460
     agtaggtttt aattctcctg ctatttaggt gcatctctgg gacctcctct ttctatattg      2520
     ggttttttgt ttgttgggtg ttttaactta ggatttagct tcaaattcca tttcccaaga      2580
     ccaattttat cacattgcct ttaggtctca ggctaaatga tataacaaga tatgcttttg      2640
     gcaaagatag taccttggaa tgaaaggttt cagatcaaac ctaagatcct accttagttt      2700
     acctctcagt gttattgcct tttgatatgg aaagctgatg agagagcatc tctggagaga      2760
     aagaggagag cctcacggga agcttttaga acttttagta gcatcctctc cccagaaaac      2820
     ttgtctctac tcatctcctt ctcattatct acctgattcg ttaagtagga aatctcagcc      2880
     atatttgtag gggattgggg ttttgttttt tttgacccac ttaactcctt tagcttcaaa      2940
     gtgttgcttt cttacatttt agacatgaat attacctaga aaatttattt ccccactgtt      3000
     aattttccag tttattgatt tccccacatc agattagtgt gtattttgaa actggtttag      3060
     ctattgtttc aagttaactt tgatcatatc ccgttgttta ctgatccact caacaaatat      3120
     ttattgaaca ttctgtaggt ttatagtagt agccaagata cttaaagtga gtagaaatag      3180
     tccttttaac tgtccttaac aaattaaact ttctcttggt ttcatgatat tccttgtttc      3240
     tcagctttgg attcaaactg atcttctctt ttttgattat actttcctga tttcttttat      3300
     tgtcacattt ttgtgaaaag tcttccatgc acttccagtc tctttctgcc tagctgtctc      3360
     ttctcaccca aattggaccc ccctactcct accctgccac gtgccttcac aaaaatgaga      3420
     tgcttgttta gagacttaga aaaggcatgc actttaggta aaagtggatt ttatttttaa      3480
     tcactgtacc ctatcataaa tctcatttca gaagagacaa ctgacatttg aattgtctgt      3540
     gcattttgtt ttagatggtg ttactgagaa ggaaactaag gacttggctc caaaacaaaa      3600
     caaaacaaaa tctggagatg ctgaattttg ttggggggaa tgtctgtaga actgcaacat      3660
     caatgcagta agtgtagtaa aagctttagt ttatggtgag tcattactca gcatcatgga      3720
     gtccacgatg aagagaatct cttttcaatc tgtgcaatca acaagttttt gaaaggcttt      3780
     tgtttatagt ggaaccctct tttcccccta gaagaaccac cacaaggaaa aatgctgtca      3840
     ccataaggaa tgtgggaaag ttttcagcca catggcctta tttgacttca aagaatccac      3900
     atgagagaga gactgcataa atgtaataac tgaggaggcc tttgttcagc aaagaaacct      3960
     tatacaaact cgtataaaga atgtaggaag accttcaccc agaagccagg actgactgtg      4020
     caccagagaa tctgcacaat aaacatgatg aatgtggaga tgcttgcttc agcattggag      4080
     aattcacagt aaagggaaac cctgccagtg tgatgagtac ggaaaagtct tcagaggttg      4140
     gaacttggga aaaatcagtg agtgaattca tattagagag gctcttataa atgagaggat      4200
     tgtggaaact tgtatagaca gagatcagac ctcaacaagg gagcctccac agtattgaaa      4260
     agttaatata attaatgtaa gtgggcaagt tgtatgggga atgggtagtc taaattgctc      4320
     attttagcca gtaaaaacat taaattagtt tcttagatca agaaaaggaa atgttagaag      4380
     ttatttttcc cttccagagg ggtctatatg tgtaagcaac caggactttt gaaataagtt      4440
     gcatctctgg atttgtgatc tgtctcctgg atgattatct ctgttttggg agacaggtat      4500
     tttttcttca tgcctgctct agtctcatct catatcttta attcattcag caagtataca      4560
     caatagtatt atcgtctact gtttgttgta aatatatata tattattttc tttttggtct      4620
     gagtaggctt gtattggtac cctaggacat aaaaatcaca tatatcatgt ttcagtaaat      4680
     gcagtgaaag gaactatatt attaaattgc tgggaatttc tgtaaatttg agactacctt      4740
     tatattctcc aacacaagac cgtgtaggtg tcccttcaga gagtatattt ttctagcttg      4800
     gcttctttat tttctttatt tttttgagat ggagtcttgc tcctgtcgcc caggctggag      4860
     tgcaatggca cgatctcggc tcactgcaac ctccgcctcc caggttcaag tgattctcct      4920
     gtctcagtct cccgagtagc tgggattaca ggcacttgcc accattccca gctaattttt      4980
     gtatttttag tagagacggg gtttcaccat gttggccagg ctggtctcga actcctgacc      5040
     ttgtgatctg cccaccttgg cctcccaaag ttcagggatt acaggcatga gccaccatgc      5100
     ccggctgttt ttttaagata gaaaaatata cttcatgtat agcctattga cagataatga      5160
     ctgatatttt ttcttataga taacacatag taaacattgt gaagactaat aagtaacttg      5220
     cttattcttt tcagttctaa aacctgtagg aaagaatgtt tagaagctgt caacaagttg      5280
     ataatgtagc ccgatctcta cccatgatag gagagtaagg cttatatatt ttatagtagg      5340
     gcactaaata caggaaccat gtatttaaaa actttttagt gattatctca gaattctagg      5400
     tgtccctctg ctgtacatcc ctaaattttt tgcgtaggta ttattaataa attcattatt      5460
     ttcaaagatg g                                                           5471
//

If you have problems or comments...

PBIL Back to PBIL home page