(data stored in ACNUC32233 zone)

EMBL: AB008567

ID   AB008567; SV 1; linear; mRNA; STD; HUM; 7864 BP.
XX
AC   AB008567; AB002300;
XX
DT   09-SEP-1998 (Rel. 56, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Homo sapiens KIAA0302 mRNA for beta-spectrin III, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-7864
RA   Ohara O., Yamakawa H.;
RT   ;
RL   Submitted (07-NOV-1997) to the INSDC.
RL   Contact:Osamu Ohara Kazusa DNA Research Institute, Laboratory of DNA
RL   Technology; 1532-3 Yana, Kisarazu, Chiba 292, Japan
XX
RN   [2]
RX   DOI; 10.1016/S0169-328X(98)00068-0.
RX   PUBMED; 9675416.
RA   Ohara O., Ohara R., Yamakawa H., Nakajima D., Nakayama M.;
RT   "Characterization of a new beta-spectrin gene which is predominantly
RT   expressed in brain";
RL   Brain Res. Mol. Brain Res. 57(2):181-192(1998).
XX
RN   [3]
RX   DOI; 10.1093/dnares/4.2.141.
RX   PUBMED; 9205841.
RA   Nagase T., Ishikawa K., Nakajima D., Ohira M., Seki N., Niyajima N.,
RA   Tanaka A., Kotani H., Nomura N., Ohara O.;
RT   "Prediction of the coding sequences of unidentified human genes. VII. The
RT   complete sequences of 100 new cDNA clones from brain which can code for
RT   large proteins in vitro";
RL   DNA Res. 4(2):141-150(1997).
XX
DR   MD5; f95b40764666f009c656e4348325eb9a.
DR   Ensembl-Gn; ENSG00000173898; homo_sapiens.
DR   Ensembl-Tr; ENST00000309996; homo_sapiens.
DR   Ensembl-Tr; ENST00000529997; homo_sapiens.
DR   Ensembl-Tr; ENST00000533211; homo_sapiens.
DR   EuropePMC; PMC2174577; 10811831.
DR   EuropePMC; PMC2656372; 18678470.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..7864
FT                   /organism="Homo sapiens"
FT                   /chromosome="11"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /tissue_type="brain"
FT                   /note="vector: pBluescriptII SK plus"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        <1..7245
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="KIAA0302"
FT                   /product="beta-spectrin III"
FT                   /db_xref="GOA:O15020"
FT                   /db_xref="H-InvDB:HIT000000227.18"
FT                   /db_xref="HGNC:HGNC:11276"
FT                   /db_xref="InterPro:IPR001589"
FT                   /db_xref="InterPro:IPR001605"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002017"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR016343"
FT                   /db_xref="InterPro:IPR018159"
FT                   /db_xref="InterPro:IPR036872"
FT                   /db_xref="InterPro:IPR041681"
FT                   /db_xref="PDB:1WJM"
FT                   /db_xref="PDB:1WYQ"
FT                   /db_xref="PDB:6ANU"
FT                   /db_xref="UniProtKB/Swiss-Prot:O15020"
FT                   /protein_id="BAA32700.2"
FT                   /translation="PLSSQPQPLATRRAEHRSRKPPTTMSSTLSPTDFDSLEIQGQYSD
FT                   INNRWDLPDSDWDNDSSSARLFERSRIKALADEREAVQKKTFTKWVNSHLARVTCRVGD
FT                   LYSDLRDGRNLLRLLEVLSGEILPKPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSH
FT                   DIVDGNHRLTLGLVWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNV
FT                   HNFTTSWRDGLAFNAIVHKHRPDLLDFESLKKCNAHYNLQNAFNLAEKELGLTKLLDPE
FT                   DVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDHAMEAERLVEKYESLASE
FT                   LLQWIEQTIVTLNDRQLANSLSGVQNQLQSFNSYRTVEKPPKFTEKGNLEVLLFTIQSK
FT                   LRANNQKVYTPREGRLISDINKAWERLEKAEHERELALRTELIRQEKLEQLAARFDRKA
FT                   AMRETWLSENQRLVSQDNFGLELAAVEAAVRKHEAIETDIVAYSGRVQAVDAVAAELAA
FT                   ERYHDIKRIAARQHNVARLWDFLRQMVAARRERLLLNLELQKVFQDLLYLMDWMEEMKG
FT                   RLQSQDLGRHLAGVEDLLQLHELVEADIAVQAERVRAVSASALRFCNPGKEYRPCDPQL
FT                   VSERVAKLEQSYEALCELAAARRARLEESRRLWRFLWEVGEAEAWVREQQHLLASADTG
FT                   RDLTGALRLLNKHTALRGEMSGRLGPLKLTLEQGQQLVAEGHPGASQASARAAELQAQW
FT                   ERLEALAEERAQRLAQAASLYQFQADANDMEAWLVDALRLVSSPELGHDEFSTQALARQ
FT                   HRALEEEIRSHRPTLDALREQAAALPPTLSRTPEVQGRVPTLERHYEELQARAGERARA
FT                   LEAALALYTMLSEAGACGLWVEEKEQWLNGLALPERLEDLEVVQQRFETLEPEMNTLAA
FT                   QITAVNDIAEQLLKANPPGKDRIVNTQEQLNHRWQQFRRLADGKKAALTSALSIQNYHL
FT                   ECTETQAWMREKTKVIESTQGLGNDLAGVLALQRKLAGTERDLEAIAARVGELTREANA
FT                   LAAGHPAQAVAINARLREVQTGWEDLRATMRRREESLGEARRLQDFLRSLDDFQAWLGR
FT                   TQTAVASEEGPATLPEAEALLAQHAALRGEVERAQSEYSRLRALGEEVTRDQADPQCLF
FT                   LRQRLEALGTGWEELGRMWESRQGRLAQAHGFQGFLRDARQAEGVLSSQEYVLSHTEMP
FT                   GTLQAADAAIKKLEDFMSTMDANGERIHGLLEAGRQLVSEGNIHADKIREKADSIERRH
FT                   KKNQDAAQQFLGRLRDNREQQHFLQDCHELKLWIDEKMLTAQDVSYDEARNLHTKWQKH
FT                   QAFMAELAANKDWLDKVDKEGRELTLEKPELKALVSEKLRDLHRRWDELETTTQAKARS
FT                   LFDANRAELFAQSCCALESWLESLQAQLHSDDYGKDLTSVNILLKKQQMLEWEMAVREK
FT                   EVEAIQAQAKALAQEDQGAGEVERTSRAVEEKFRALCQPMRERCRRLQASREQHQFHRD
FT                   VEDEILWVTERLPMASSMEHGKDLPSVQLLMKKNQTLQKEIQGHEPRIADLRERQRALG
FT                   AAAAGPELAELQEMWKRLGHELELRGKRLEDALRAQQFYRDAAEAEAWMGEQELHMMGQ
FT                   EKAKDELSAQAEVKKHQVLEQALADYAQTIHQLAASSQDMIDHEHPESTRISIRQAQVD
FT                   KLYAGLKELAGERRERLQEHLRLCQLRRELDDLEQWIQEREVVAASHELGQDYEHVTML
FT                   RDKFREFSRDTSTIGQERVDSANALANGLIAGGHAARATVAEWKDSLNEAWADLLELLD
FT                   TRGQVLAAAYELQRFLHGARQALARVQHKQQQLPDGTGRDLNAAEALQRRHCAYEHDIQ
FT                   ALSPQVQQVQDDGHRLQKAYAGDKAEEIGRHMQAVAEAWAQLQGSSAARRQLLLDTTDK
FT                   FRFFKAVRELMLWMDEVNLQMDAQERPRDVSSADLVIKNQQGIKAEIEARADRFSSCID
FT                   MGKELLARSHYAAEEISEKLSQLQARRQETAEKWQEKMDWLQLVLEVLVFGRDAGMAEA
FT                   WLCSQEPLVRSAELGCTVDEVESLIKRHEAFQKSAVAWEERFCALEKLTALEEREKERK
FT                   RKREEEERRKQPPAPEPTASVPPGDLVGGQTASDTTWDGTQPRPPPSTQAPSVNGVCTD
FT                   GEPSQPLLGQQRLEHSSFPEGPGPGSGDEANGPRGERQTRTRGPAPSAMPQSRSTESAH
FT                   AATLPPRGPEPSAQEQMEGMLCRKQEMEAFGKKAANRSWQNVYCVLRRGSLGFYKDAKA
FT                   ASAGVPYHGEVPVSLARAQGSVAFDYRKRKHVFKLGLQDGKEYLFQAKDEAEMSSWLRV
FT                   VNAAIATASSASGEPEEPVVPSTTRGMTRAMTMPPVSPVGAEGPVVLRSKDGREREREK
FT                   RFSFFKKNK"
XX
SQ   Sequence 7864 BP; 1732 A; 2348 C; 2584 G; 1200 T; 0 other;
     ccactgagca gccaaccgca gcctctggcc acaaggagag cggagcacag gagcaggaag        60
     ccgcctacca ccatgagcag cacgctgtca cccacagact ttgacagctt ggaaatccag       120
     ggccagtaca gtgacatcaa caaccgctgg gaccttcctg actcggactg ggacaatgac       180
     agcagctcgg cccgcctctt tgagaggtct cgcattaagg ctctggcaga tgaacgagaa       240
     gctgtgcaga agaaaacctt caccaagtgg gtaaactcgc acctggcccg ggtcacgtgc       300
     cgggtggggg acctgtacag cgacctccgg gacggacgca acctgctgag gctcctcgag       360
     gtgctctcgg gagagatact gccaaagcct acaaagggcc gcatgcggat ccactgcctg       420
     gagaacgtgg acaaggcact gcagttcctc aaggagcaga aagtgcactt ggaaaacatg       480
     ggctcccatg acattgtgga cggaaaccac cgactgaccc ttgggctggt ctggaccatc       540
     atccttcgat tccagatcca agacatcagt gtggagacag aagacaacaa ggagaagaag       600
     tcagccaagg atgccctgct tctgtggtgc cagatgaaga ctgcaggtta tcccaacgtc       660
     aatgtacaca acttcaccac cagctggaga gatggactag ctttcaacgc catcgtgcat       720
     aaacaccggc cagacctgct ggattttgag tctctgaaga agtgtaatgc acactataat       780
     ctgcagaatg cattcaatct ggctgaaaag gaactgggac ttaccaagct gctggatccc       840
     gaagacgtga atgtggacca gccagatgag aagtcaatca ttacctatgt ggctacttac       900
     taccattact tctccaagat gaaggccctg gccgtggaag gcaagagaat tggcaaggtg       960
     ctggaccatg ccatggaggc agagcgcctg gtggagaaat acgagtccct ggcctcggag      1020
     ctgctgcagt ggatcgagca aacgatcgtg accctcaatg accggcagtt ggccaactcc      1080
     cttagcgggg tccagaacca gctgcagtcc ttcaactcct accgcaccgt ggagaagccg      1140
     cccaagttta ccgagaaagg gaacttggaa gtgctgctct tcaccatcca gagcaagctt      1200
     cgggccaaca accagaaggt ctacacgccc cgcgagggcc ggctcatctc ggacatcaac      1260
     aaggcttggg agcggctgga gaaggcggag cacgagcgtg agctggccct gcgcaccgag      1320
     ctcatccgcc aggagaagct ggagcagctg gccgcccgct tcgaccgcaa ggctgccatg      1380
     cgggagacct ggctcagcga gaaccagcgc ctcgtgtccc aggacaactt tgggctggag      1440
     ctggcagctg tcgaggcagc agtacggaag cacgaagcca ttgagacgga catcgtggcc      1500
     tacagcggcc gggtgcaggc agtggacgcc gtggctgcag agctggccgc cgagcgctac      1560
     cacgacatca agcgcatcgc cgctcggcag cacaacgtgg cacggctctg ggacttcttg      1620
     cggcagatgg tggccgcccg gcgggagcgg ctcctcctca acctggagct gcagaaggtg      1680
     ttccaggacc tgctctacct catggactgg atggaagaga tgaagggccg gctgcagtct      1740
     caggacctgg gcaggcacct agcaggagtg gaggacctgc tgcagctgca cgagctggtg      1800
     gaggcagaca tcgccgtgca ggccgagagg gtgcgggccg tcagcgcctc tgccctgcgc      1860
     ttctgcaacc cagggaaaga gtatagacct tgcgacccgc agctggtgtc ggagcgggtg      1920
     gccaagctag agcagagcta tgaggcactg tgcgagttgg cagcggcgcg gcgggcccgg      1980
     ctggaggaat cacggcggct ctggcgtttc ctctgggagg tgggtgaagc tgaggcctgg      2040
     gtgcgggagc agcagcacct cctggcctca gccgacacgg gccgagacct gaccggtgcc      2100
     ctccgcctgc tcaacaagca cacagccctg cggggcgaga tgagcggccg gctggggccc      2160
     ctgaagctca ccctggagca gggccagcag ttggtggccg agggtcaccc tggggcaagc      2220
     caggcctctg cccgtgcagc tgaactccaa gcccagtggg agcggctaga ggccctggcc      2280
     gaggagcgtg cccagcggct ggcccaagcc gccagcctct accagttcca ggccgatgca      2340
     aacgacatgg aggcctggtt ggttgacgca ctgcgcctgg tgtccagccc cgagctgggg      2400
     cacgacgagt tctccacgca ggctctagcc aggcagcatc gggccctgga ggaggagatt      2460
     cgaagccacc ggccaaccct ggacgccttg agggaacagg cagcagccct gccccccaca      2520
     ctgagccgca cgcccgaggt gcagggccgg gtgcccaccc tggagcggca ctacgaggag      2580
     ctgcaggccc gggcaggcga gcgagcgcgg gccttggagg cagccctggc gctctacacc      2640
     atgctcagcg aggccggggc ctgtggactc tgggtggagg agaaggagca gtggctcaac      2700
     gggctggccc tgcctgaacg cctggaggac ctggaggtcg tgcagcagag gttcgagacc      2760
     ctggagcctg aaatgaacac ccttgcagca caaatcaccg cggtgaatga cattgccgag      2820
     cagttactga aggccaaccc cccaggcaaa gaccgcattg tcaacaccca ggagcagctc      2880
     aaccacaggt ggcagcagtt tcggcgtctg gcagacggca agaaggcagc tctcacctca      2940
     gccctgagca tccagaacta ccacttagag tgcacggaga cccaggcctg gatgagagag      3000
     aagaccaaag tcatcgagtc cacccagggc ctaggcaacg atctggctgg ggtgctggcc      3060
     ctgcagcgca agctggccgg cacggagcgg gacctggagg ccatcgccgc ccgggtgggc      3120
     gaactgactc gagaggcaaa tgccctggct gccggccatc ccgctcaggc agtggccatc      3180
     aacgcccggc tgagagaggt gcagaccggc tgggaggacc tcagggccac catgcggcgt      3240
     cgagaagagt cgctggggga ggcgcggcgg ctgcaggact tcttgcgcag cttggatgac      3300
     ttccaggcct ggctaggccg cactcagact gctgtggcct ctgaagaagg gccggccacc      3360
     ctgcctgagg cagaggccct cctggcccaa catgcagccc tgcggggaga ggtggagcgg      3420
     gcccagagcg agtatagccg gctgcgagcc ctgggcgagg aggtgacccg ggaccaggct      3480
     gacccccagt gcctcttcct acgacagcga ctggaggccc tgggaactgg ctgggaggag      3540
     ctgggccgaa tgtgggagag ccggcaaggt cgcctggccc aggcccacgg cttccaggga      3600
     ttcctgcggg atgctcgtca ggctgagggc gtgctcagca gccaggaata tgttctgtct      3660
     cacacggaga tgccagggac actccaggct gctgatgctg ccattaaaaa actggaggac      3720
     ttcatgagca ccatggacgc caatggggaa cggatccacg ggctcctgga ggctggccgc      3780
     cagctggtat ctgaaggcaa catccacgcc gacaagattc gggaaaaggc agactccatt      3840
     gagaggaggc acaagaagaa tcaagacgca gcgcagcaat ttctgggccg tcttcgggac      3900
     aaccgggagc agcagcattt cctgcaagat tgtcacgagc tgaagctctg gatcgacgag      3960
     aagatgctga cagcccagga cgtgtcctat gacgaggccc gcaacctgca tactaagtgg      4020
     cagaagcacc aggcattcat ggccgagctg gctgccaaca aagactggct ggacaaggtg      4080
     gacaaggaag ggcgagagct cacccttgag aagccagagc tgaaagccct ggtgtcggag      4140
     aagctgagag acctgcacag gcgctgggac gagctggaga ccaccaccca agccaaggcc      4200
     cgcagcctct ttgatgccaa ccgagctgag ctgtttgccc agagctgctg tgccctggag      4260
     agctggctgg agagcctgca ggcccagctg cactcggatg actacggcaa ggacctcacc      4320
     agcgtcaaca tcctgctcaa gaagcagcag atgctggaat gggagatggc tgtgagagag      4380
     aaggaggtgg aggcaatcca ggcccaggcc aaagcactgg cccaggagga ccagggtgca      4440
     ggggaggtgg agagaacctc gagggccgtg gaggagaagt tcagggcctt gtgccagccc      4500
     atgcgggaac gctgccggcg cctgcaggct tctcgcgagc agcaccagtt ccaccgcgat      4560
     gtggaagatg agattttgtg ggtgacagag cggctgccca tggccagctc catggagcat      4620
     ggcaaggacc tgcccagcgt ccagcttctc atgaagaaaa accagaccct gcagaaagag      4680
     attcagggcc atgagccccg gatcgcggac ctgagggagc ggcagcgtgc tctaggtgca      4740
     gcagcagcag gtccagagct ggctgagctg caggaaatgt ggaaacgcct gggccacgag      4800
     ctggaacttc gagggaagcg actggaggat gccctgcgag cccagcagtt ctaccgcgat      4860
     gccgccgagg cggaggcctg gatgggcgag caggaattac acatgatggg ccaggagaag      4920
     gccaaggatg agctgagtgc ccaggcagag gtgaagaagc accaggtgct ggagcaagcc      4980
     ctggccgact acgcgcagac catccaccag ctggcggcca gcagccagga catgattgac      5040
     cacgagcacc cagagagcac tcggatatcc atccgccaag cccaggtgga caagctgtat      5100
     gccggcctga aggagctggc tggagagcgg cgggagcgcc tgcaggagca cctccggctg      5160
     tgccagctcc gccgcgagct ggatgacctg gaacagtgga tccaggagcg cgaggtggtg      5220
     gcggcctccc acgagctggg ccaggactac gagcatgtga ctatgctccg agacaaattc      5280
     cgagagttct cccgggacac aagcaccatc ggtcaggagc gcgtagatag cgccaatgcg      5340
     ctggccaatg ggctcattgc tgggggccat gctgcacggg ccaccgtggc cgagtggaag      5400
     gacagtctca acgaggcctg ggctgacctg cttgagctgc tggacacacg gggtcaggtg      5460
     ctggccgcgg cgtacgagct gcagcgcttc ctgcacgggg cacgccaagc cctggcgcgg      5520
     gtgcagcaca agcagcagca gcttccggac gggactggcc gcgacctcaa cgctgccgag      5580
     gccctgcagc gccgacactg tgcctacgag catgacattc aggccctcag cccccaggtc      5640
     cagcaggtgc aggacgacgg ccaccggctc cagaaggcct acgctggaga caaggctgag      5700
     gagatcggcc gccacatgca ggccgtggcc gaggcctggg cccagcttca gggaagctct      5760
     gccgcccgcc ggcagctgct gctggacacc acagacaagt tccgcttctt caaggctgtc      5820
     cgggaactga tgctctggat ggatgaggtc aacctgcaga tggatgccca ggagcgtccc      5880
     cgggatgtgt cctccgcgga tctagtcatc aagaaccagc aaggcatcaa ggcagagata      5940
     gaggcccggg cagaccgctt ctcctcctgc atcgacatgg ggaaggagct gctggccagg      6000
     agccactatg cggccgagga gatctcagag aagctgtctc agctgcaggc acggcgccag      6060
     gagacagctg agaagtggca ggagaagatg gactggcttc agctggtttt ggaggtgctt      6120
     gtgtttggaa gagatgcagg gatggcagag gcctggctct gcagccagga gccactggtg      6180
     cgcagcgctg agctgggttg cacggtcgac gaagttgaga gcctcatcaa gcggcacgag      6240
     gccttccaga agtcagcagt ggcctgggag gagcgattct gtgcgctgga gaagcttact      6300
     gcgctagagg agcgggagaa ggagcgaaag agaaagaggg aggaggagga gcggcggaaa      6360
     cagccgcctg ctcccgaacc cacagccagt gtgcctccag gggacctggt gggcggccag      6420
     acagcttctg acaccacctg ggacggaacc cagccacggc caccaccatc cacacaagca      6480
     cccagtgtta atggagtctg cacagatgga gagccctcac agcccctgct gggacaacag      6540
     agacttgagc acagcagctt ccccgaaggg ccgggacctg gctcagggga cgaagccaat      6600
     gggccccggg gagagaggca gacccggact cggggcccgg ccccatctgc aatgccccag      6660
     agcaggtcta ccgagtcagc ccatgctgcc accctgccgc ctcgaggccc agagccatct      6720
     gcccaggagc agatggaggg gatgctgtgc cgcaagcagg agatggaggc cttcgggaag      6780
     aaggctgcca acaggtcctg gcagaacgtg tactgtgtcc tgcggcgtgg gagcctcggc      6840
     ttttacaagg atgccaaggc agccagcgcg ggagtgccat accacggaga agtgcctgtc      6900
     agcctggcca gggcccaggg cagcgtcgcc tttgattacc gaaagcgcaa acatgtcttc      6960
     aagctgggct tacaggatgg aaaagaatat ttattccagg ccaaggatga ggcagagatg      7020
     agctcgtggc tacgggtggt gaatgcagcc attgccacag cgtcttctgc ctctggagag      7080
     cctgaagagc cggtggtgcc cagcaccacc cggggcatga cccgggccat gaccatgccc      7140
     ccagtgtcac ccgtcggggc tgaggggcct gttgtgctcc gcagcaaaga cggcagagaa      7200
     cgagagcgag aaaaacgctt cagcttcttt aagaagaaca agtagttggg ggcaaggtcc      7260
     caggccaact ccctccctcc gttcaggaaa ctgccaggga cagtcgacag ggaccgccct      7320
     cttgtcagga caactgcctg ctgctagggt ctgttgccaa ggtcaaccca tcaccaggaa      7380
     ctgtcactgg ggacgagtcc atgttcccaa gggcagccct tctcttctgc tgtttaattc      7440
     cagactggtg gtgggaccca ggtaaccccc tctcccaccc ccgccgactt ctcccctttc      7500
     cccagcctcg tgcctctgtc cctcaccacg gtgtggacag tgccgcaccc tcaacatagg      7560
     ccatgtgggg agtggctgcc cctgcctcag ggtcattctc ctgccatgcg agggcactcg      7620
     ccttctgcct tctggttcct cacccctcag accagccagg aacctctcag agctgaagca      7680
     ggccctgggg gcagaagtgc cagatgacag tcagaggcgc aggagccctc cctccccacc      7740
     cccaccctgt aactccagct gccactccat ctccagctgc tctcaatggc ttccaggtgt      7800
     gttgttcggg gacagccacc gccttgagtc tggccaagga ggtgattaaa cagctcagct      7860
     tctc                                                                   7864
//

If you have problems or comments...

PBIL Back to PBIL home page