(data stored in ACNUC8465 zone)

EMBL: AB009978

ID   AB009978; SV 1; linear; genomic DNA; STD; FUN; 2141 BP.
XX
AC   AB009978;
XX
DT   29-AUG-2000 (Rel. 64, Created)
DT   14-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Candida glabrata gene for squalene synthase, complete cds.
XX
KW   ERG9; squalene synthase.
XX
OS   [Candida] glabrata
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Nakaseomyces;
OC   Nakaseomyces/Candida clade.
XX
RN   [1]
RP   1-2141
RA   Izuta M., Nakayama H., Arisawa M.;
RT   ;
RL   Submitted (24-DEC-1997) to the INSDC.
RL   Miho Izuta, Nippon Roche Research Center, Mycology; Kajiwara 200, Kamakura,
RL   Kanagawa 247-8530, Japan (E-mail:miho.izuta@roche.com, Tel:81-467-47-2222,
RL   Fax:81-467-46-5320)
XX
RN   [2]
RX   DOI; 10.1128/AAC.44.9.2411-2418.2000.
RX   PUBMED; 10952588.
RA   Nakayama H., Izuta M., Nakayama N., Arisawa M., Aoki Y.;
RT   "Depletion of the squalene synthase (ERG9) gene does not impair growth of
RT   Candida glabrata in mice";
RL   Antimicrob. Agents Chemother. 44(9):2411-2418(2000).
XX
DR   MD5; cb40e3f6237edbcabc8338d99cd972b9.
DR   EuropePMC; PMC1803144; 17158937.
DR   EuropePMC; PMC90078; 10952588.
DR   StrainInfo; 177502; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2141
FT                   /organism="[Candida] glabrata"
FT                   /strain="ATCC2001"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:5478"
FT   CDS_pept        508..1839
FT                   /codon_start=1
FT                   /gene="ERG9"
FT                   /product="squalene synthase"
FT                   /db_xref="GOA:Q9HGZ6"
FT                   /db_xref="InterPro:IPR002060"
FT                   /db_xref="InterPro:IPR006449"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR019845"
FT                   /db_xref="InterPro:IPR033904"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9HGZ6"
FT                   /protein_id="BAB12207.1"
FT                   /translation="MGKVLDLALHPLELRAALKLKFIRQPLFSTNDTRATPQLERCYEL
FT                   LNLTSRSFAAVIMELHPELRNVIMVFYLILRALDTVEDDMTIDPQLKVKVLREFDSKLD
FT                   TTDWSFDGNDLKEKDRVVLTEFPCILGEYHKLKPEYQKVIKRITGLMGNGMADYILDEN
FT                   FNLNGVQTVKDYDKYCHYVAGLVGDGLTELIVLAGFGSDDLYHGKNSFQLYESLGLFLQ
FT                   KTNIIRDYAEDLDDGRSFWPKEIWSEYATKLTDFRDPKNTQKGVDCINHLVLNALTHVI
FT                   DVLTYLSSIHEQSSFQFCAIPQVMAIATLAKVFNNPEVLRKNVKIRKGTTCDLILNSRT
FT                   LKGCVDIFQYYLRDMKQRLPVEDPNYLKFNIQVAKIEQFIEEMFQDNLPAGVEPRETMI
FT                   YLKVQERLKWDTQVIPRVQEEDYKFNMALSVVFCVLLSFYFFTK"
XX
SQ   Sequence 2141 BP; 677 A; 438 C; 438 G; 587 T; 1 other;
     ccgaggccac aatggactcc gggatatatc agcacactgg cgccaccagt actacaagct        60
     ggccattggc atcgacagac ctgagtcgcg agacccgcag gcggtggccg actacgtact       120
     cagtaaagta ccccagcgcg atgccactta catagagaac actacaacgt ctaaggcact       180
     cgagctgctg caaagacagt tcccatatat ataattgtac atagtctgaa cagctaacca       240
     tcaataagcc ttccatcaca tactattata tccgataaac tcttataatc cactaaacga       300
     aagtgggtcc cgaagagcca aatttttcat acgagggaag tctgagcata aacttcgaag       360
     tccatatatt gctgttataa gagcagtgga taacggttgc tagagtcaat tgatctttct       420
     gttgtagggt atacaggagg aacaagctgt ttaatagaga tcaagaatcg gtatcaatat       480
     tacaaaaaaa aaaataccag ataaacaatg ggtaaagtac ttgacttggc gctgcatccg       540
     cttgaattga gagctgcttt gaagcttaag tttatcagac agccattgtt cagcaccaat       600
     gacaccagag ctactccaca gctggagaga tgttacgagc tgttgaatct gacctccaga       660
     tcctttgctg cggttattat ggagttgcac cctgagttgc gtaatgtgat catggtcttc       720
     tatctgattc tgagggcttt ggacactgtc gaggacgata tgaccattga tcctcaattg       780
     aaggtcaaag tgttgcgtga atttgactcc aagttggaca ccaccgattg gtcctttgat       840
     ggcaatgatc taaaggagaa agaccgtgtt gtattgaccg agttcccatg catccttggt       900
     gaatatcaca agttgaaacc agagtatcag aaggttatca agagaattac cggtcttatg       960
     ggtaacggta tggccgacta catcttggat gagaacttta acttgaacgg tgtgcaaact      1020
     gttaaggact acgacaaata ctgccactat gttgctggcc tagtcggtga tggtttgact      1080
     gaattgattg tccttgcagg ttttggttct gacgatttat accatggtaa aaacagcttc      1140
     caattgtacg agagcttggg attatttttg cagaagacca acattatcag agactacgcc      1200
     gaggatttgg atgacggtcg ttctttctgg cctaaagaaa tctggtctga atatgctacg      1260
     aagctaaccg acttcagaga cccaaagaac acccaaaagg gtgtcgattg tattaaccac      1320
     ttggtattga acgccttgac ccatgtcatc gatgtcttga cttacctaag ttcaatccac      1380
     gagcaatcct cattccaatt ctgtgccatt cctcaagtta tggccatcgc cactttggcc      1440
     aaagtcttca acaaccctga agtgctaaga aagaatgtta agatcagaaa gggaaccacc      1500
     tgcgacttaa ttttgaactc tagaactttg aaaggctgtg ttgacatctt ccaatactac      1560
     ttacgtgaca tgaagcaacg tttgcctgtt gaagatccaa actacttgaa gtttaacatt      1620
     caagttgcta agattgaaca attcattgaa gaaatgttcc aggacaactt accagccggt      1680
     gttgaaccaa gagaaaccat gatctacttg aaggtccaag aaagattaaa atgggacacc      1740
     caagttattc caagagtgca agaagaagat tacaaattca acatggcttt gagtgttgtc      1800
     ttctgtgtat tgttaagttt ctatttcttc actaagtgaa gagtaagtgt aacggaatgc      1860
     taataacgat tttcatgagt ctctttaatg ctttataagt caatatcccc aaaaaatcat      1920
     aaaagatgaa aacaaaacat caaaagatta aattcattaa caaattaaat actatgtaaa      1980
     acttctatag aaataaaaat tcatacacct gtagtntact acactaacag aatgccaaaa      2040
     actgatgatt actcacagat atagcatttt acatgatcgg gaggggccta tcagagaata      2100
     ttactttgta ttcaatgatg tccagcatct ctacatttta c                          2141
//

If you have problems or comments...

PBIL Back to PBIL home page