(data stored in ACNUC8465 zone)

EMBL: AB013392

ID   AB013392; SV 1; linear; genomic DNA; STD; PLN; 84129 BP.
XX
AC   AB013392;
XX
DT   12-MAY-1998 (Rel. 55, Created)
DT   14-APR-2005 (Rel. 83, Last updated, Version 8)
XX
DE   Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MIK19.
XX
KW   .
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-84129
RA   Nakamura Y.;
RT   ;
RL   Submitted (06-MAY-1998) to the INSDC.
RL   Yasukazu Nakamura, Kazusa DNA Research Institute, Department of Plant Gene
RL   Research; 1532-3, Yana, Kisarazu, Chiba 292-0812, Japan
RL   (E-mail:ynakamu@kazusa.or.jp, Tel:81-438-52-3935, Fax:81-438-52-3934)
XX
RN   [2]
RX   DOI; 10.1093/dnares/5.3.203.
RX   PUBMED; 9734815.
RA   Kotani H., Nakamura Y., Sato S., Asamizu E., Kaneko T., Miyajima N.,
RA   Tabata S.;
RT   "Structural analysis of Arabidopsis thaliana chromosome 5. VI. Sequence
RT   features of the regions of 1,367,185 bp covered by 19 physically assigned
RT   P1 and TAC clones";
RL   DNA Res. 5(3):203-216(1998).
XX
DR   MD5; 48c306c0e39211bac4235a8891f65799.
DR   ENA-CON; BA000015.
DR   GOA; Q38803.
DR   RFAM; RF00005; tRNA.
DR   UniProtKB/Swiss-Prot; Q38803; MT1B_ARATH.
XX
CC   Address for correspondence: kaos@kazusa.or.jp
CC   For the latest information on annotation of this clone, please see
CC   http://www.kazusa.or.jp/kaos/cgi-bin/agd_graph.cgi?c=MIK19
CC   Genes with similarity to proteins in the databases are described
CC   in 'product' or 'note' qualifiers.  Genes that have no significant
CC   protein similarity are described as 'unknown protein'.
CC   The software programs used to predict genes include:
CC   Grail (Informatics Group, Oak Ridge National Laboratory,
CC   http://compbio.ornl.gov/Grail-1.3/),
CC   GENSCAN (Chris Burge, MIT, http://CCR-081.mit.edu/GENSCAN.html),
CC   NetGene2 (S.M. Hebsgaard, et al., CBS, Technical University of
CC   Denmark, http://www.cbs.dtu.dk/services/NetGene2/) and
CC   SplicePredictor (Volker Brendel, Stanford University,
CC   http://gremlin1.zool.iastate.edu/cgi-bin/sp.cgi).
CC   Genes encoding tRNAs are predicted by tRNAscan-SE
CC   (Sean Eddy, Washington University School of Medicine, St. Louis,
CC   http://genome.wustl.edu/eddy/tRNAscan-SE/).
CC   This sequence may not be the entire insert of this clone.
CC   It may be shorter because we remove overlaps between
CC   neighboring submissions.
CC   The 5' clone is MKN22 and the 3' clone is MPI10.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..84129
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="5"
FT                   /ecotype="Columbia"
FT                   /mol_type="genomic DNA"
FT                   /clone_lib="Mitsui P1"
FT                   /clone="MIK19"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        join(AB019234.1:25158..25884,AB019234.1:26275..26573,
FT                   AB019234.1:26665..26799,AB019234.1:27147..27229,1..190)
FT                   /codon_start=1
FT                   /note="emb|CAB89229.1"
FT                   /note="gene_id:MKN22.8"
FT                   /note="similar to unknown protein"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR006566"
FT                   /db_xref="InterPro:IPR013101"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9FJV2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09873.1"
FT                   /translation="MEKQTRLSDLPDELLLKILSALPMFKVTLATRLISRRWKGPWKLV
FT                   PDVTFDDDDIPFKSFETFMSFVYGSFLSNDAQILDRLHLKLNQKYSASDINFWVQVAVN
FT                   RSVRELRIDLFGKTLELPCCLCSCITLKELTLHDLCIKVVPAWFRLPSLKTLHLLSVKF
FT                   SSDGFVASILRICPVLERLVVDGTKGVNVKIPNMDVPNLRSLSFRSTGELRIELLRKTL
FT                   GLPTCLSSFRNLTELILHGLDQIKNENVMITNIDVPTLRNLSIRNSKGKGTYVEGSKGF
FT                   VIKAPSLTDLNFEDTLSNFLMFEPMPEVIKADIQVICDQSKNFIGSLTSIQHLSLCSLT
FT                   SKTPYPACTVFSSLKYLELCTCSARWANLFACILNAAPELRSLKLKSKHKFNYNDPMTL
FT                   WEEPAVVAKCLSEHLEIFEWRQYEGTEQERNVAGYILANATCLKMATFSTRCRNRNHRM
FT                   LKKLKSMDRVSKACRLVFD"
FT   CDS_pept        join(941..1855,1946..2080,2340..2609)
FT                   /codon_start=1
FT                   /note="gene_id:MIK19.1"
FT                   /note="pir||T06019"
FT                   /note="similar to unknown protein"
FT                   /db_xref="InterPro:IPR006566"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9FJV1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09874.1"
FT                   /translation="MRKLFFFLCTHVPKQRAKFTRIMESCQKKQKLETPTELSDMPDDL
FT                   IFKIFSFLPFFKEDLATRFISEYGKGLWNPDPNAIFDDESLDMTCMSFVYGSLMSKDAQ
FT                   ILDSLHLKLRKYYIASDINFLVQLGVNRSMRELRIDFFGKTLELPCCLSTCTTLKVLVL
FT                   DHLNIMSVPGWFRLPSVETLQLSSVTGGSNYVPSLIRLCSVHERLVVDQNRNKDLVNIN
FT                   VPTLRSLSIDNKRRGHVPLGSFWINVPSLMFLNIKDTFQTIFESMPAMIKANIEVAHDQ
FT                   SQSVKFIESLTSTRHLCLCSPTSENPYPNGTKFSNLVHLKLCTCSAGWQNLLACMLNDA
FT                   PNLRSLTLKLRQKSDVNPKKVWEKPTVVPECLSTRLEILKWRDYEGTEHEKDMVGYILA
FT                   NATFLQRATFSTKDRNQCDSRFSELQSMERVSEICEFVFD"
FT   CDS_pept        complement(join(3056..3148,3239..3284,3384..3607,
FT                   3708..3890,3970..4197,4294..4428,4528..4612,4749..4825))
FT                   /codon_start=1
FT                   /product="protein kinase MEK1 homolog"
FT                   /note="gene_id:MIK19.2"
FT                   /db_xref="GOA:Q9FJV0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9FJV0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09875.1"
FT                   /translation="MVKIKSNLKQLKLSVPAQESPISSFLTASGTFHDGDFLLNQKGLR
FT                   LTSDEKQSRQSDSKELDFEITAEDLETVKVIGKGSGGVVQLVRHKWVGKFFAMKVIQMN
FT                   IQEEIRKQIVQELKINQASSQCPHVVVCYHSFYHNGAFSLVLEYMDRGSLADVIRQVKT
FT                   ILEPYLAVVCKQVLLGLVYLHNERHVIHRDIKPSNLLVNHKGEVKISDFGVSASLASSM
FT                   GQRDTFVGTYNYMSPERISGSTYDYSSDIWSLGMSVLECAIGRFPYLESEDQQNPPSFY
FT                   ELLAAIVENPPPTAPSDQFSPEFCSFVSACIQKDPPARASSLDLLSHPFIKKFEDKDID
FT                   LGILVGTLEPPVNYLR"
FT   CDS_pept        join(5726..5780,5997..7280,7375..7408,7494..7641)
FT                   /codon_start=1
FT                   /product="beta-1,3-glucanase-like protein"
FT                   /note="gene_id:MIK19.3"
FT                   /db_xref="GOA:Q9FJU9"
FT                   /db_xref="InterPro:IPR000490"
FT                   /db_xref="InterPro:IPR012946"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9FJU9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09876.1"
FT                   /translation="MARDFKLIFSISILLLLLDCCYGGKVGVCYGRSADDLPTPSKVVQ
FT                   LIQQHNIKYVRIYDYNSQVLKAFGNTSIELMIGVPNSDLNAFSQSQSNVDTWLKNSVLP
FT                   YYPTTKITYITVGAESTDDPHINASSFVVPAMQNVLTALRKVGLSRRIKVSTTLSLGIL
FT                   SRSFPPSAGAFNSSYAYFLRPMLEFLAENKSPFMIDLYPYYAYRDSPNNVSLDYVLFES
FT                   SSEVIDPNTGLLYKNMFDAQVDALYYALTALNFRTIKIMVTETGWPTKGSPKEKAAASS
FT                   DNAETYNSNIIRHVVTNQGTPAKPGEAMNVYIFSLFNENRKAGLDSERNWGLFYPDQTS
FT                   VYQLDFTGKSNGFHSNSSGTNSSGSSNSWCIASSKASERDLKGALDWACGPGNVDCTAI
FT                   QPSQPCFQPDTLVSHASFVFNSYFQQNRATDVACSFGGAGVKVNKDPSYDKCIYITAGG
FT                   NKTKATNATALTSSASTPRGNELLQWILKLCLMISLFFSLQTMNSQAL"
FT   CDS_pept        complement(join(8087..8221,8288..8425,8793..8915))
FT                   /codon_start=1
FT                   /product="profilin-like protein"
FT                   /note="gene_id:MIK19.4"
FT                   /db_xref="GOA:Q9FE63"
FT                   /db_xref="InterPro:IPR005455"
FT                   /db_xref="InterPro:IPR027310"
FT                   /db_xref="InterPro:IPR036140"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9FE63"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09877.1"
FT                   /translation="MSWQTYVDDHLMCDVAGNRLTAAAILGQDGSVWAQSNNFPQVKPE
FT                   EIQGIKDDFTTPGTLAPTGLFLGGNKYMVIQGEPNAVIRGKKGAGGVTIKKTTLALVFG
FT                   IYDEPMTPGQCNMVVENLGEYLIESGL"
FT   CDS_pept        join(13604..13668,13748..14074,14151..14235)
FT                   /codon_start=1
FT                   /product="retroelement pol polyprotein-like"
FT                   /note="gene_id:MIK19.5"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FJU8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09878.1"
FT                   /translation="MTLYFIQKFVQEKIWQTYFQILSIVHHIQEDCGMYAGKKTPTIMY
FT                   EENAAYIAQLKDGYIKGDRTKHILPKFFYTHDLQKSGDVRVLQIRLNDNLADLFTKALP
FT                   TATFKKLVYRIGLRCLKNLDEYTHKGEQHFKYFTSYGTIMVIRGSVMNKDGCPL"
FT   CDS_pept        join(14943..15139,15345..15429,15493..15582,15665..15758,
FT                   15841..15923,16024..16182)
FT                   /codon_start=1
FT                   /note="contains similarity to unknown protein"
FT                   /note="gb|AAD15447.1"
FT                   /note="gene_id:MIK19.6"
FT                   /db_xref="GOA:Q9FJU7"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FJU7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09879.1"
FT                   /translation="MTDETEEDDTTQQRSSRNDGVSKNKGKGFKGDKAKRALIGAGGRI
FT                   LFYPTLLYNLVRFKLQSQFRCYAVDYRNFELFTKISEYQFGSDFESMQKDVPRLKKLGV
FT                   GGVITLNEPYETLVPSSLYSAYEMEHLVIPTRDYLFAPSIVDITLAVNFIHKNALLGKT
FT                   TYVHCKAGRGRSTTVVLCYLIEHKSMTVAAAFEHVRSIRPRVLLHPSQRKVSLDRFIDM
FT                   LHQRDNRITKMKT"
FT   CDS_pept        complement(join(16726..16824,17130..17372,17821..18332,
FT                   18890..19082,19231..19344))
FT                   /codon_start=1
FT                   /note="gene_id:MIK19.7"
FT                   /note="pir||T13434"
FT                   /note="similar to unknown protein"
FT                   /db_xref="GOA:Q9FJU6"
FT                   /db_xref="InterPro:IPR003441"
FT                   /db_xref="InterPro:IPR036093"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FJU6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09880.1"
FT                   /translation="MKNSKCNLIDSKLEEHHHLCGSKHCPGCGRMIQAATKPNWVGLPA
FT                   GVKFDPTDQELIEHLEAKVKGKEENKKWSSSHPLIDEFIPTIDGEDGICYTHPQKLPGV
FT                   TRDGLSKHFFHKPSRAYTTGTRKRRKIIQTDHDSELTGSSETRWHKTGKTRPVMINGQQ
FT                   RGCKKILVLYTNFGKNRRPEKTNWVMHQYHLGINEEEREGELVVSKIFYQTQPRQCVSN
FT                   TNWSDHHGSKDVIGIGVGDEISSVAATLQSLGSGDVVSRVNMHPHTRSFDEGTAEASKG
FT                   RENQHVSGTCEEVHDGIITSSMSSHHMIHDHHNQHHQIGDRREFHMSSSYPMTPTITSQ
FT                   HESIFHVTSTMPFQGSVVWFGIRRPNYGLYHSYVYRRRKFLTNLCI"
FT   CDS_pept        join(22516..22617,22808..22854,22935..22974,23115..23324,
FT                   23408..23566,23656..23709,23800..23998,24082..24344,
FT                   24431..24631,24742..24933)
FT                   /codon_start=1
FT                   /product="pyrophosphate-dependent
FT                   phosphofructo-1-kinase-like protein"
FT                   /note="gene_id:MIK19.8"
FT                   /db_xref="GOA:Q9C5J7"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012004"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9C5J7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09881.1"
FT                   /translation="MSSPRSNKPKIVNGPGGYILQDVPHLIDYLPDLPTYPNPLQDNPA
FT                   YSVVKQYFVHADDSVPEKVVVHKDGPRGVHFRRAGPRQKVYFESDEVHACIVTCGGLCP
FT                   GLNTVIREVVSSLSYMYGVKRILGIDVSLGGYRGFYAKNTIPLNSKVVNDIHKRGGTII
FT                   GTSRGGHDTNKIVDSIQDRGINQVYIIGGDGTQRGASVIFEEIRRRRLKVAVVGIPKTI
FT                   DNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESNENGIGFVKLMGRYSGYIAMYATLAS
FT                   RDVDCCLIPESPFYLEGEGGLFEFIERRLKDHGHMVIVLAEGAGQDLMCKSMESTPMDA
FT                   SGNKLLKDVGLWLSQSIKDHFKKNKMVMNLKYIDPTYMIRAVPSNASDNVYCTLLAQSA
FT                   VHGAMAGYTGYTSGLVNGRQTYIPFYRITETQNNVVITDRMWARLLSSTNQPSFLGPKD
FT                   TSEEKKELPETPLLDDGAVDIPPVTKEVTK"
FT   CDS_pept        complement(join(25739..25765,25861..25942,26048..26126,
FT                   26210..26279,26372..26494,26652..26704,26807..26866,
FT                   26966..27170,27390..27474,27561..27690,27813..27843))
FT                   /codon_start=1
FT                   /note="gene_id:MIK19.9"
FT                   /note="pir||T06010"
FT                   /note="similar to unknown protein"
FT                   /db_xref="GOA:Q9FJU4"
FT                   /db_xref="InterPro:IPR007828"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9FJU4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09882.1"
FT                   /translation="MNISVENPVFVHEDSTTQKTGELRLDSDIPMSKISSDDEVFLAPE
FT                   MNAFGRQFRDYTDTNSERQKSVEHFYATQHTNQTLDFVQKMRSEYGKLDKMVMNIWECC
FT                   ELSKEVVDESDPDLDEPQIQHLLQSAEAIRKDYPNEDWLHLTALIHDLGKVLTLPQFGG
FT                   LPQWAVVGDTFPVGCAFDESNVHHKYFMENPDFNNPKYNTKAGIYSEGCGLENVLMSWG
FT                   HDDYMYLVAKENGSTLPSPGLFIIRYHSFYPLHKAGAYTHLMNEEDKENLKWLHVFNKY
FT                   DLYSKSKVHVNVEKVKPYYMSLIKKYFPENLRW"
FT   CDS_pept        join(29030..29383,29492..29617,29692..30006,30088..30210,
FT                   30295..30693)
FT                   /codon_start=1
FT                   /product="IAA-amino acid hydrolase homolog 1 precursor"
FT                   /note="gene_id:MIK19.10"
FT                   /note="sp|P54969"
FT                   /db_xref="GOA:P54969"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54969"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09883.1"
FT                   /translation="MALNNFLTFQLLLLLLRVSSESPWIVAGDVSRIPINFLELAKSPE
FT                   VFDSMVRIRRKIHENPELGYEEFETSKFIRSELDLIGVKYRFPVAITGIIGYIGTGEPP
FT                   FVALRADMDALPIQEAVEWEHKSKNPGKMHACGHDGHVAMLLGAAKILQQHRQHLQGTV
FT                   VLIFQPAEEGLSGAKMMREEGALKNVEAIFGIHLSPRTPFGKAASLAGSFMAGAGAFEA
FT                   VITGKGGHAAIPQHTIDPVVAASSIVLSLQHLVSRETDPSDSKVVTVTKVNGGNAFNVI
FT                   PDSITIGGTLRAFTGFTQLQERIKEIITKQAAVHRCNASVNLAPNGNQPMPPTVNNMDL
FT                   YKKFKKVVRDLLGQEAFVEAVPEMGSEDFSYFAETIPGHFSLLGMQDETQGYASSHSPH
FT                   YRINEDVLPYGAAIHATMAVQYLKDKASKGSVSGFHDEL"
FT   CDS_pept        join(31483..31839,32008..32133,32210..32524,32605..32727,
FT                   32818..33216)
FT                   /codon_start=1
FT                   /product="IAA-amino acid hydrolase"
FT                   /note="gb|AAC04866.1"
FT                   /note="gene_id:MIK19.11"
FT                   /db_xref="GOA:P54970"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="PDB:1XMB"
FT                   /db_xref="PDB:2Q43"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54970"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09884.1"
FT                   /translation="MALNKLLSLTFQLLLFLLSVSSESPWIAEDTSQIQTKLLEFAKSP
FT                   EVFDWMVKIRRKIHENPELGYEELETSKLIRSELELIGIKYRYPVAITGVIGYIGTGEP
FT                   PFVALRADMDALPIQEGVEWEHKSKIAGKMHACGHDGHVTMLLGAAKILHEHRHHLQGT
FT                   VVLIFQPAEEGLSGAKKMREEGALKNVEAIFGIHLSARIPFGKAASRAGSFLAGAGVFE
FT                   AVITGKGGHAAIPQHTIDPVVAASSIVLSLQQLVSRETDPLDSKVVTVSKVNGGNAFNV
FT                   IPDSITIGGTLRAFTGFTQLQQRVKEVITKQAAVHRCNASVNLTPNGREPMPPTVNNKD
FT                   LYKQFKKVVRDLLGQEAFVEAAPVMGSEDFSYFAETIPGHFSLLGMQDETNGYASSHSP
FT                   LYRINEDVLPYGAAIHASMAVQYLKEKASKGSVSGFHEEL"
FT   CDS_pept        complement(join(33618..33664,33948..34085,34183..34186))
FT                   /codon_start=1
FT                   /product="40S ribosomal protein S30 homolog"
FT                   /note="emb|CAB79697.1"
FT                   /note="gene_id:MIK19.12"
FT                   /db_xref="GOA:P49689"
FT                   /db_xref="InterPro:IPR006846"
FT                   /db_xref="UniProtKB/Swiss-Prot:P49689"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09885.1"
FT                   /translation="MGKVHGSLARAGKVRGQTPKVAKQDKKKKPRGRAHKRLQHNRRFV
FT                   TAVVGFGKKRGPNSSEK"
FT   CDS_pept        join(34850..35347,35447..36037,36125..36381,36467..36596,
FT                   36706..36764,36863..37046)
FT                   /codon_start=1
FT                   /product="SYNC1 protein"
FT                   /note="gb|AAD46681.1"
FT                   /note="gene_id:MIK19.13"
FT                   /db_xref="GOA:Q9SW96"
FT                   /db_xref="InterPro:IPR000738"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SW96"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09886.1"
FT                   /translation="MADEIVPPATQLAAVSLENDGSTVQRAQFSNRVLIRTILDRPDGG
FT                   AGLAGQTVRIGGWVKSGRDQGKRTFSFLAVNDGSCPANLQVMVDPSLYDVSNLVATGTC
FT                   VTVDGVLKVPPKGKGTQQQIELNVVKVIDVGTVDASKYPLPKTKLTLETLRDVLHLRSR
FT                   TNSISAVARIRNALAFATHSFFQEHSFLYIHTPIITTSDCEGAGEMFQATTLINYTERL
FT                   EQDLIDNPPPTEADVEAARLIVIERGNVVAELKAAKASKEAITAAVAELKIAKETFAHI
FT                   DERSRLRPGLPKKDGNIDYSKDFFGRQAFLTVSGQLQVETYACALSNVYTFGPTFRAEN
FT                   SHTSRHLAEFWMVEPEIAFADLEDDMNCAEAYVKYMCNWLLEKCYADMELMAKNFDSGC
FT                   IDRLKLVASTPFGRITYTKAIELLEEAVAKGKEFDNNVEWGIDLASEHERYLTEVLFQK
FT                   PLIVYNYPKGIKAFYMRLNDDEKTVAAMDVLVPKVGELIGGSQREERYDVIKKRIEEMG
FT                   LPIEPYEWYLDLRRYGTVKHCGFGLGFERMILFATGLDNIRDVIPFPRYPGKADL"
FT   CDS_pept        join(37928..38791,38883..39029,39107..39304)
FT                   /codon_start=1
FT                   /note="gene_id:MIK19.14"
FT                   /note="pir||T02649"
FT                   /note="similar to unknown protein"
FT                   /db_xref="GOA:Q9FJU3"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR006566"
FT                   /db_xref="InterPro:IPR013101"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9FJU3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09887.1"
FT                   /translation="MAEISGLPDDLLVKILAFLPTKVAISTSVLSKQWRFLWMWLPKLK
FT                   YDDYDDITDGFNSVSAFQTYRDFIAKNLPLHRAPIIESLSLGFRCGTLQPEDLKSWVEV
FT                   AVSRSVRELSILAYYRNNYALSSSSLYTCKSLVTLKGFNIRVDVPPTVCLLPSLRTLEL
FT                   KRVRYLNEDSLRMLLSFCPVLEYLSIERHDNDNLRGLVVDVPSLRRLSLTSYTGCSSDD
FT                   YVIVTPSLKYFKAFDYRSEISSYKIEKIPELEEADISIERNPEKLFVYFKSIKCLSLQV
FT                   DFNSKEEPGYDSGIVFNHLEELTPYINDANWSKLLFRLLNDSPKLRVLEISNSKSFYKE
FT                   KIGEYLPVSWSKNQGSVPKCFLNSLETFRVKWYYSEEQEDRDFLSLIFKHARCLKSTSI
FT                   LHR"
FT   CDS_pept        join(40196..40231,40309..41034,41142..41282,41368..41583)
FT                   /codon_start=1
FT                   /note="gene_id:MIK19.15"
FT                   /note="pir||T02649"
FT                   /note="similar to unknown protein"
FT                   /db_xref="GOA:Q9FJU2"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR006566"
FT                   /db_xref="InterPro:IPR013101"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9FJU2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09888.1"
FT                   /translation="MAKISDLSDELLMWLSKLEFYFSDGSESACLRDFIAKNLPLHKAP
FT                   IIESLRFCSFFGSLQPKDLKSWVRIAVSRCVRELSISLHDTTAAVSLPSSLYTCKSLVT
FT                   LKLYGKKVLLDVPRTVFLPSLKTLQLERLRYSDEDSLRLLLSYCPVLEDLSIVREDYDN
FT                   LRALVVIVPSLQRLSLEIPGNCSSDGYVIVTPSLKYFKVVDYRESMSYLIEQMPELEEA
FT                   DIVVLQYPEKLLESVTFFKRLSIRVIFNTYTETVYRDGIVFNRLENLKLCICNGDWSKL
FT                   LIQFLKDSPNLRVLNLLVDDYPSSLGDYEPVRWKNNKSSVPKCLLESLETFEFAGYIGT
FT                   PEERDFLSYIFKHARCLKSSSILSRPERYHGI"
FT   CDS_pept        complement(join(42208..42487,42893..42972))
FT                   /codon_start=1
FT                   /product="60S ribosomal protein L31"
FT                   /note="gene_id:MIK19.16"
FT                   /db_xref="GOA:P51420"
FT                   /db_xref="InterPro:IPR000054"
FT                   /db_xref="InterPro:IPR020052"
FT                   /db_xref="InterPro:IPR023621"
FT                   /db_xref="UniProtKB/Swiss-Prot:P51420"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09889.1"
FT                   /translation="MSEKKGRKEEVITREYTINLHRRLHKCTFKKKAPKAIKEIRKFAE
FT                   KAMGTKDVRVDVKLNKQIWSKGIRGPPRRIRVRVARKRNDDEDAKEEFFSLVTVAEIPA
FT                   EGLSGLGTKVIEEED"
FT   CDS_pept        join(43742..43802,43965..44923)
FT                   /codon_start=1
FT                   /product="cytosolic malate dehydrogenase"
FT                   /note="gene_id:MIK19.17"
FT                   /db_xref="GOA:Q9FJU0"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001252"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010945"
FT                   /db_xref="InterPro:IPR011274"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9FJU0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09890.1"
FT                   /translation="MCNLLNIEKDPIRVLITGAAGNIGYAIAPMIARGIMLGPDQPMIL
FT                   HLLDIEPASSSLEAVKMELQDSAFPLLKGVIATTNVVEACKDVNIVIMIGGFPRIAGME
FT                   RKDVMSKNVVIYKAQASALERYASDDCKVLVVANPANTNALILKEFAPSIPEENITCLT
FT                   RLDHNRALAQLADKLSVPVSSVKNVIVWGNHSSTQYPDTNHATVSTKTGDRPLKELVTD
FT                   HNWLKNEFIVEVQQRGAAVLRARKQSSAFSAAGAACDHIRDWFLGTPKGTWVSMGVCSD
FT                   GSYGIPPGLVYSFPVICEKGSWKIVQGLSIDEFSREKMDDSARELAEEKDLAYSCLNV"
FT   CDS_pept        complement(join(45111..45176,45262..45459,45552..45632,
FT                   45728..45838,45926..46042,46119..46202,46320..46401,
FT                   46700..46791,46872..47021,47104..47268,47635..47654,
FT                   47727..47868,47979..48084,48403..48616,48708..48777,
FT                   48864..49001,49162..49335,49422..49556,49628..49765,
FT                   49850..49975,50060..50306,50567..50781))
FT                   /codon_start=1
FT                   /product="zinc protease PQQL-like protein"
FT                   /note="gene_id:MIK19.18"
FT                   /db_xref="GOA:Q9FJT9"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9FJT9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09891.1"
FT                   /translation="MDLIAGESSKVLRKQGFRSLKLMSVDMEQELGNELEPFGADYGRL
FT                   DNGLIYYVRRNSKPRMRAALALAVKVGSVLEEEDQRGVAHIVEHLAFSATTRYTNHDIV
FT                   KFLESIGAEFGPCQNAMTTADETIYELFVPVDKPELLSQAISILAEFSSEIRVSKEDLE
FT                   KERGAVMEEYRGNRNATGRMQDSHWQLMMEGSKYAERLPIGLEKVIRSVPAATVKQFYQ
FT                   KWYHLCNMAVVAVGDFPDTKTVVDLIKTHFEDKRSSSEPPQIPVFPVPSHEETRFSCFV
FT                   ESEAAGSAVMISYKMPVSDLKTVKDYRDMLAESMFLHALNQRLFKISRRKDPPFFACSV
FT                   AADVLVARVRLHGFSEREISVVRALMMSEIESAYLERDQVQSTSLRDEYIQHFLHKEPV
FT                   IGIEYEAQLQKTLLPQISASDVSRYSEKLRTSCGCVIKSMEPKSAATIDHMRNVVSKVN
FT                   SLEEEKMIAPWDEENIPEEIVSEKPTPGDITHQLEYPEVGVTELTLSNGMQVCYKSTDF
FT                   LDDQVLFTGFSYGGLSELPESDYISCSMGSTIAGEIGMFGYKPSVLMDMLADLETALQL
FT                   VYQLFTTNVMPQEEEVGIVMQMAEESVRARERDPYTVFANRVKELNYGNSYFFRPIRIS
FT                   ELRKVDPLKACEYFNSCFRDPSTFTVVIVGNLDPTIALPLILQYLGGIPKPPQPVLNFN
FT                   RDDLKGLPFTFPTKITKEFVRSPMVEAQCSVQLCFPVQLTNGTMIEEIHCIGFLGKLLE
FT                   TKIIQFLRFEHGQIYSAEVSVFLGGNKPSRTADLRGDISVNFSCDPEISSKLVDLALEE
FT                   IVRLQKEGPSQEDISAILEIEQRAHENGMQENYYWLDRIIRGYQSRVYAGDLGASCKIL
FT                   EEGRLRMRESLAPQTAQAALQRILPHPCKKQYTAVILMPQRSRFGFLSSIFSSRSEGPY
FT                   IRDTKILAGIAGLGVVVFGIWRYSRK"
FT   CDS_pept        complement(join(51214..51873,51961..52118,52215..52296,
FT                   52409..52496,52622..52698,52777..52815,52916..52984,
FT                   53094..53203,53557..53598,53704..53782))
FT                   /codon_start=1
FT                   /product="histone acetyltransferase HAT B"
FT                   /note="gene_id:MIK19.19"
FT                   /db_xref="GOA:Q9FJT8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017380"
FT                   /db_xref="InterPro:IPR019467"
FT                   /db_xref="InterPro:IPR037113"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9FJT8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09892.1"
FT                   /translation="MVQKQQASAGPGTEPKKRRRVGFSPADTGVEANECIKIYLVSSKE
FT                   EVDSSDISSVKPVDLNDFFDGDGKIYGYQGLKINVWINSISLHSYADITYQSTINGDKG
FT                   ITDLKSALQNIFAETIVDTKDEFLQTFSTQRDFIRNMVSNGEVMHAGATDGSSKNAEVV
FT                   PSDPQVIRMEIGSPNAGLLYSRLVPLVLLFVDGSNPIDVTDPDWHLYLLIQKKEEKEDP
FT                   LYRIVGFTAIYKFYRYPDRLRMRLSQILVLPSFQGKGLGSYLMEVVNNVAITENVYDLT
FT                   VEEPSEKFQHIRTCIDINRLRSFDPIKPDIDSAVQTLTKGKLSKKAQIPRFTPPLNAIE
FT                   KVRESLKINKKQFLKCWEILIYLALDPIDKYMEDYTSVITNHVRTDILGKDIETPKKQV
FT                   VDVPSSFEPEASFVVFKSVNGEEANTNVQVDENKPDQEQQLKQLVEERIREIKLVAEKV
FT                   SKSGQTLKV"
FT   tRNA            54046..54120
FT                   /product="tRNA-Pro(TGG)"
FT                   /note="gene_id:MIK19.20"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        join(54710..54953,55140..55266)
FT                   /pseudo
FT                   /note="gene_id:MIK19.21"
FT                   /note="unknown protein"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT   CDS_pept        join(56191..56250,57096..57195,57270..57367,57458..57546,
FT                   57631..57691,57783..57947,58040..58096,58194..58249,
FT                   58361..58496,58593..58811)
FT                   /codon_start=1
FT                   /product="pollen specific protein SF21"
FT                   /note="gene_id:MIK19.22"
FT                   /db_xref="GOA:Q9FJT7"
FT                   /db_xref="InterPro:IPR004142"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9FJT7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09893.1"
FT                   /translation="MTDSYGAVSVDVGTIYLGGKEHRVKTASGVVSVIVYGDREKPALI
FT                   TYPDLALNHMSCFQGLFFCPEAASLLLHNFCIYHISPPGHELGAAPICPNDSVPSAENL
FT                   ADQILEVLNFFGLGVVMCMGVTAGAYILTLFAMKHRERVLGLILVSPLCKAPSWSEWFY
FT                   NKVITNLLYYYGMCGVVKEFLLQRYFSKEVRGNVEIPESDIAQACRRLLDERQGINVLR
FT                   FLDAIDRRPDISSGLKKLKCRTLIFIGDQSPFYSEAVHMAATLDRGYCALVEVQACGSM
FT                   VTEEQPHAMLIPMEYFLMGYGLYRPSLFSESPRSPLSPSCISPELLSPESMGLKLKPIK
FT                   TRISAA"
FT   CDS_pept        complement(join(59703..60197,60344..60787))
FT                   /codon_start=1
FT                   /product="serine O-acetyltransferase (EC 2.3.1.30) Sat-52"
FT                   /note="gene_id:MIK19.23"
FT                   /note="pir||S71207"
FT                   /db_xref="GOA:Q42538"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q42538"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09894.1"
FT                   /translation="MPPAGELRHQSPSKEKLSSVTQSDEAEAASAAISAAAADAEAAGL
FT                   WTQIKAEARRDAEAEPALASYLYSTILSHSSLERSISFHLGNKLCSSTLLSTLLYDLFL
FT                   NTFSSDPSLRNATVADLRAARVRDPACISFSHCLLNYKGFLAIQAHRVSHKLWTQSRKP
FT                   LALALHSRISDVFAVDIHPAAKIGKGILLDHATGVVVGETAVIGNNVSILHHVTLGGTG
FT                   KACGDRHPKIGDGCLIGAGATILGNVKIGAGAKVGAGSVVLIDVPCRGTAVGNPARLVG
FT                   GKEKPTIHDEECPGESMDHTSFISEWSDYII"
FT   CDS_pept        complement(join(61199..61438,61558..61960,62073..62194))
FT                   /codon_start=1
FT                   /note="contains similarity to transcription repressor"
FT                   /note="gene_id:MIK19.24"
FT                   /db_xref="GOA:Q9FJT6"
FT                   /db_xref="InterPro:IPR038909"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9FJT6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09895.1"
FT                   /translation="MSFVLLSKMAKLKFNHIRHTIISTQKSTTIMPGISQLLNNRLIGK
FT                   EFSSAVPTMFKREDYKLTIHDIAFSKWRNLIRHNDWKDFNNRKERVRRYRHEDLPPQRC
FT                   TGLYELGVGVIGQDQGQNFDPDNNVLGVYVGQCVDVKSRLQDYGRRGGHLPSGLYEDIF
FT                   SEGYSVFYRWAPEAAATEGMLLSTFDYAWNTCSNGERRHLELQKLGDPEFMSKRKSQVL
FT                   VPSIRDQVVTIKVEKSNYTFLTSTLKVMRPFG"
FT   CDS_pept        complement(join(62589..63578,63660..64034,64345..64446))
FT                   /codon_start=1
FT                   /note="contains similarity to transcription repressor"
FT                   /note="gene_id:MIK19.25"
FT                   /db_xref="GOA:F4K933"
FT                   /db_xref="InterPro:IPR038909"
FT                   /db_xref="UniProtKB/Swiss-Prot:F4K933"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09896.1"
FT                   /translation="MEFGDGVSFAVVPTVFKREDYKRTKHDTVFSKWQFDAAQVLIGSN
FT                   DWEDFKNGKDGVGRYRVQNLPRKSCPGLYELGVAVIGQEQCRKLEPDIVLASYLGQAES
FT                   VRSRLQRYGRSGAHLRNVNNLNDCETIESPVKAVTGGLFEDIFSKGGSILYRWAPMGSK
FT                   REAEATEGMLLSTFDYAWNKGSNGERRQLDLLKKLGDREFMSKRKSGISRMLFPFLRNQ
FT                   VGIRIKGEKHVLKEERKLTCDVDEEKSNNFLTSILKLTRSRPQPVSDRFDEVDGSCSDI
FT                   VCGVLLEDGGCCIRSPVKGRKRCIEHKGQRVCRVSPEKQTPPKSEIFTGQDHHNHKDSD
FT                   VVCGVILPDMEPCNKRPVPGRKRCEDHKGMRINAFLFLLNQTDREKTVKDEKPDPESHT
FT                   ESIEEEALTRFCEATTKNGLPCTRSSPKGSKRCWQHKEKTSSDTSPVYFQPEAAKNVAC
FT                   GVKLGNGLICERSPVKGRKRCEEHKGMRIT"
FT   CDS_pept        join(66866..66986,67130..67284,67383..67477,67569..68575,
FT                   68641..68819,68903..68979,69063..69210,69296..69646)
FT                   /codon_start=1
FT                   /note="contains similarity to protein kinase"
FT                   /note="gene_id:MIK19.26"
FT                   /db_xref="GOA:Q9FJT4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FJT4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09897.1"
FT                   /translation="MVAVRASKEIPKAALLWTLTHVVQPGDRIRLLVVVPSNYTSKKIW
FT                   GFSRFTSDCASGYGRFLAGTNSDRKDDIHESCSQMMFQLHNVYDAEKINVRIKIVFASL
FT                   DGVIAAEAKKSNSNWVILDRGLKYEKKCCIEQLECNLVVIKKSQPKVLRLNLVKNADTE
FT                   HPEAISRLASKSVESRRSSRTGKKLREPFVTPASSPDQEVSSHTDIGTSSISSSDAGAS
FT                   PFLASRVFEGLKKENLWVNDGSKSFFESDSDSDGEKWSPLSMASSSSHPVTTADLLSPS
FT                   GDLSKAHTETPRKSRFAVLRLALSRKEPEAGKEIRKPDSCLNKSVREVVSLSRKPAPGP
FT                   PPLCTICQHKAPKFGNPPRWFTYSELETATKGFSKGSFLAEGGFGSVHLGTLPDGQIIA
FT                   VKQYKIASTQGDREFCSEVEVLSCAQHRNVVMLIGLCVEDGKRLLVYEYICNGSLHSHL
FT                   YDIKVSIGMGREPLGWSARQKIAVGAARGLRYLHEECRVGCIVHRDMRPNNILLTHDFE
FT                   PLVGDFGLARWQPEGDKGVETRVIGTFGYLAPEYAQSGQITEKADVYSFGVVLVELITG
FT                   RKAMDIKRPKGQQCLTEWARPLLQKQAINELLDPRLMNCYCEQEVYCMALCAYLCIRRD
FT                   PNSRPRMSQVCSHLKNTYKLITYNRNFLSVNISFCLWNLCLLIEGVADVRRRRCHESNI
FT                   EEASQGKFFLGSLYTI"
FT   CDS_pept        join(71194..71820,71911..72045,72141..72413)
FT                   /codon_start=1
FT                   /note="emb|CAB62440.1"
FT                   /note="gene_id:MIK19.27"
FT                   /note="similar to unknown protein"
FT                   /db_xref="GOA:Q9FJT3"
FT                   /db_xref="InterPro:IPR006566"
FT                   /db_xref="InterPro:IPR013101"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FJT3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09898.1"
FT                   /translation="MLTQKKSFGRLSAVINPLDYIINPLDNPWFDLSEVSIESCYGSQT
FT                   LPRSLRSRHWNLKTLKLKKLSFVDTDAYMWFESLKTLHLLSVRFSDDKSVQRLLSVCPK
FT                   LEDLVVKRTTYVNVRIFSINVPSLRSLSIDYSWAVSRPADVHGFVIDAPSLRFMNIKDH
FT                   FSNLLQFENMPKLVKANVEVDCDLSEKFIGSITSIQHISLCSKNSKIPYPSGTSFFYLE
FT                   HLELCTCSQDWWNLLNRILEDAPRLQVLKLKLGNCVQCSTELMDYWNEPCSVPKCLSSH
FT                   LEIFEWRHYKGTKQERKVAKYILAKASCLKVAIFSSVCIEKNLIFKKLENVDRGSKACE
FT                   LVFQ"
FT   CDS_pept        join(72725..73609,73694..73831,73913..74197)
FT                   /codon_start=1
FT                   /note="emb|CAB62008.1"
FT                   /note="gene_id:MIK19.28"
FT                   /note="similar to unknown protein"
FT                   /db_xref="GOA:Q9FJT2"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR006566"
FT                   /db_xref="InterPro:IPR013101"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9FJT2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09899.1"
FT                   /translation="MEAARSGIEDVTSPDRISQLPNDLLFRILSLIPVSDAMSTSLLSK
FT                   RWKSVWKMLPTLVYNENSCSNIGSLGFDQFCGRSLQLHEAPLLKTLTLELRKQTDSLDS
FT                   SIFPNIHSTLLEFSIKSTGYPVYYSTISFPNNLDVFQTLVVLKLQGNICLDVVDSPVCF
FT                   QSLKSLYLTCVNFENEESFSKLLSACPVLEDLFLQRLCSVGRFLFSISVPSLQRLTYTK
FT                   EQAYYSNDEAILEITAPSLKHLNIFDRVGVFSFIEDMPKLVEASVRVKLSKNEKLPKVL
FT                   TSVEHLSLDLYPSMVFHLDDRFISKQLLHLKLDIYDNFQSNLLLSLLKDLPNLQSLKLN
FT                   HSHPSYNVEDQPCSVSEPSSVPECLSFHLETFQWIGYAGTFEEIAAAVYVLKNARCLKN
FT                   ATISLYSRGTENGLMMIKELESMSKGSIMCQLLVKF"
FT   CDS_pept        join(74539..75384,75491..75643,75717..76043)
FT                   /codon_start=1
FT                   /note="gene_id:MIK19.29"
FT                   /note="pir||T01344"
FT                   /note="similar to unknown protein"
FT                   /db_xref="GOA:Q9FJT1"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR006566"
FT                   /db_xref="InterPro:IPR013101"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9FJT1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09900.1"
FT                   /translation="MKAPRLGSEEVSYSDRISYLPDDLLLRILSFIHTSDAISTSLLSK
FT                   RWKFVWKMMPTLDLDEDSCRNIGTLRFDEGCCMFLKSHEAPVLTSLNLKLMTPSHDIDR
FT                   LLSNIKPILHEITITSYRYSTIRFPRNLNVCQTLVVMKLQDKVLVDVSFPVCFRSLKSL
FT                   HLTRVKYSCRESFTTLLSACPVLEDLDLFIGRVHYDCLNSFTIWVPSLQRLSICDESYR
FT                   FRSTTFEISVPSLKYLKIACQDSCFKFVEDMPNLVEAHVEANQHETKNLLRFLTSVERL
FT                   KDPDLTDRIFHQLLYLELHLHKRLNGDRILSLLKHSPNLQTLKLNEVNQNVAKPLRSIK
FT                   DQPNISVRKPNSVPECLTFHLETLEWQGYAGRPEDKEIAVYILGNALRLNTATISRYFS
FT                   SSRFRHHQKKDLKIVEELKSITKASTSCQLVLQQFIEIKYSM"
FT   CDS_pept        76536..77264
FT                   /codon_start=1
FT                   /note="gene_id:MIK19.30"
FT                   /note="unknown protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FJT0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09901.1"
FT                   /translation="MGETMARMERCEWLSLIQSGLSTEIFSWIAYATSSKEAWEILMVR
FT                   SVGGPIFQARKLLDLKKEYNNTTMSDAETVHEFTGKLLELVFRMKSCGWKVEEKILVKK
FT                   ILSSLPPRFDKVLVEVAEKLSVNVIIDCLLVHEYNMRPDQESFQESVIQSVNVEESFEA
FT                   EAEILYSLNDITQSQVAMMERQSEVLSLVQKNQKMLMQMQKQMMMLMQQKDHVLAHSES
FT                   YEEEMTKVIESMEKHYLKKK"
FT   CDS_pept        join(78994..79261,79585..79784,80124..80357)
FT                   /codon_start=1
FT                   /note="contains similarity to Myb-related transcription
FT                   activator"
FT                   /note="gene_id:MIK19.31"
FT                   /db_xref="GOA:Q9FJS9"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="InterPro:IPR006447"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FJS9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09902.1"
FT                   /translation="MGRRCSHCGNVGHNSRTCSSYQTRVVRLFGVHLDTTSSSPPPPPP
FT                   PSILAAAIKKSFSMDCLPACSSSSSSFAGYLSDGLAHKTPDRKKGVPWTAEEHRTFLIG
FT                   LEKLGKGDWRGISRNFVVTKSPTQVASHAQKYFLRQTTTLHHKRRRTSLFDMVSAGNVE
FT                   ENSTTKRICNDHIGSSSKVVWKQGLLNPRLGYPDPKVSVSGSGNSGGLDLELKLASIQS
FT                   PESNIRPISVT"
FT   CDS_pept        complement(join(83637..83696,83772..83900,83984..84129,
FT                   AB020747.1:1..367,AB020747.1:457..894,
FT                   AB020747.1:986..1087))
FT                   /codon_start=1
FT                   /note="gene_id:MIK19.32"
FT                   /note="pir||T40314"
FT                   /note="similar to unknown protein"
FT                   /db_xref="UniProtKB/TrEMBL:Q9FJS8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAB09903.1"
FT                   /translation="MRDLSSLSSMQSRDIVAVASSKTNLGLSQETKLKTNADRDPVSSN
FT                   LIMWKPEVKDSVEKTNIQLSSSDVSSSKKVPEVKKLESVSLVKQEDKGLNKPSKKLIEA
FT                   ESVLLVKQEDKGLSKPRKKFTEAKTPESVSLVKQEETGLSKPERKPKRKSMRRSMSDSN
FT                   LNNVRKMISNFEVKVTQDTKIRTAKIQTDSCKDAEEKTKAQPPAESTVNLEKSEERKII
FT                   SFNNMEKSVCSDNTDRCDDLVIVSRDERTMDIEDKSLEHSTRRSDLLSTQRRSLVVEVR
FT                   DDEKKQNKSVWLKDSQLENARGSRLWIFPDEAKDLCCETDLGTRHLDLDLAEANLLQKR
FT                   IDESTRENIGERGSRCINIAKINSNNKWTNIERSKKQKSENSAESESSGRPVGQVMRAL
FT                   IVVGFAGLVFLTRQ"
XX
SQ   Sequence 84129 BP; 26721 A; 14919 C; 15080 G; 27409 T; 0 other;
     gatctttgaa tggagacaat atgaaggcac agagcaagag aggaatgtgg caggctacat        60
     tctagcaaac gctacatgtc taaagatggc gacgttctcg acaagatgca gaaacagaaa       120
     tcatcgcatg ttaaagaagt taaagtccat ggacagagtt tcaaaggcat gtcggcttgt       180
     gtttgactaa actctgatgt gtgttgtgtg tttctacaag acacaagatg ttttcttagt       240
     tatctttctt ccttttccct gacttttata tttggtgttc ttgagttttg ttttctaatc       300
     tccaaatctt ctttaacttg tgaaaacaga gcagtttttg tttacatatt tgaaaacttt       360
     atagtattta atatttatac taaaattcaa tctattttaa taatcaatat acttaagatt       420
     tcaaagttat tttcactatt aaaaagttaa ataattattt tttagtagga ttcggataat       480
     ttcagatcgg accctagtcc aagtaaaaat ggaaatgtag ttgaattagt ctctataaaa       540
     aaaataaaaa aaatcaatga atcaattaga aaattgaaaa ggaaaaagaa aaactagtaa       600
     taaaagtaag actttttcct cacgtcaaac aaaaattaag aaatatactt ttgttgattt       660
     gtttttcaat aataatatta ttttgcatca gataataata gcatgaatta ttctcatcga       720
     atcacaaaaa aaaataaaaa aaaaataaca agactaaatt ttaataattc cgtcttttct       780
     cttgtgataa ttatccagaa tattctcaca attaaattga tttttttgta accgtgaaac       840
     ctaatttacc taaggctctt tttgttagtt aaggatatat ttctcatata tggttgttag       900
     aatattcact gtatatcctc tgtataagtt acgaccatat atgagaaaac ttttcttctt       960
     cctttgcaca cacgtcccaa aacagagagc aaaattcacc agaatcatgg agagctgcca      1020
     gaagaaacaa aaattggaga caccaacaga gctcagtgat atgcctgatg acttaatctt      1080
     caaaatattc tcgttccttc cgttttttaa agaggattta gcaacacgtt tcatatcaga      1140
     atatgggaag ggtctttgga atccagaccc gaatgccata tttgatgatg aatcactcga      1200
     tatgacttgt atgagttttg tatatggatc tttgatgtcc aaggatgctc agattctaga      1260
     tagcttgcat ctcaagctta ggaaatacta tattgcttca gatatcaatt ttcttgttca      1320
     acttggggtt aatcgatcta tgagagagct gagaatcgac ttctttggaa aaaccctaga      1380
     attaccgtgt tgcttgagta cctgcacaac cctaaaagtt ttggtactcg atcatttaaa      1440
     tatcatgtct gtcccgggtt ggtttcgttt gccatcagtc gaaactctcc agctttcatc      1500
     ggttaccggg ggcagcaact atgttccaag tcttataaga ttatgctctg ttcatgaacg      1560
     tttggttgta gaccaaaaca gaaataaaga tctggttaat atcaatgtgc ctactttgag      1620
     gagcttatct atcgataaca agagaagggg acatgtgcca ctcggtagct tttggataaa      1680
     tgttccttct ttgatgtttt tgaacattaa ggatacattc caaacaatat ttgaatctat      1740
     gcctgcgatg atcaaagcga atatcgaggt tgctcatgac caatcgcaat ctgtgaagtt      1800
     catagaatct cttacctcaa cccgacatct ttgtctttgt tctccaactt cagaggtaaa      1860
     aactttctta ctccaataaa taatgtctcc atttatgttt tgttattctc atcactgatt      1920
     ataacataaa actttataac tgcagaatcc atatcctaat ggcacaaagt tctccaatct      1980
     tgtacatcta aagctatgta catgttctgc gggatggcag aatctacttg cgtgtatgct      2040
     caatgacgct cccaatcttc gttctcttac tcttaagttg gtaagtacta tgtagaatgc      2100
     aactttttac tagtatgaac cgtatgataa catgttcttg tgatattttt cctacgcatt      2160
     cactactagc aagactaaaa cttttatcaa tgttttgaat tgataaaaaa acactgcaga      2220
     atcttgttct ttaaacatag aaaagtagta taccatagca tcatctctgt gtgtccgttt      2280
     cttttttgac gatctataac actaacacac gtaatgtttc tttcattttt tcgtgtcaga      2340
     gacaaaaatc cgatgtcaat ccgaagaaag tctgggaaaa gccaacagtc gttcctgaat      2400
     gtttatctac gcgtcttgag atcttgaaat ggagagatta tgaaggcact gagcatgaga      2460
     aggatatggt tgggtacata ctagcaaacg ctacttttct acagagggca acattctcaa      2520
     cgaaagatag aaaccaatgt gattccaggt tcagcgagtt acagtctatg gagagagttt      2580
     cagagatatg tgagtttgtg tttgactaat gtgactctct tatgtgatgg tgtgtgtctc      2640
     tctagaagac gcaaagacgt tcttagcttt cttcttcctt tcccttagac ttttatattt      2700
     ggtgttttta ggttttatat ttggtgtttt tgagtttaat tcatgaaaac agagctgttc      2760
     atgtttgagt ttaattcatg aaaaaaatta ctctcatatg ttattctcct tatcttttga      2820
     tttggcctta atgaaatgtc atagtttggg agaaataagt tttttaactt gactaagtct      2880
     atttaatcac ataaaccaaa accttgtaca ttacataaaa aaggaagaac acaatgaaaa      2940
     ataaaatctc attcaacttt tatagtcaag taatagtctt tagagacaca ttacacaata      3000
     tcatgtatct tatcatatca tataccaaat gcaaatgcag aagaagaggg cttacttatc      3060
     taaggtagtt aacaggtggt tccagagtgc caacaagtat cccgagatcg atatccttgt      3120
     cctcaaactt ttttatgaat ggatgactct gagaacatga acaaacaaat cttagaatgt      3180
     ttcatcagag atactaataa ccaagactga aagagggtgg tgagtaggaa ttacttacca      3240
     agaggtccaa agatgatgct cttgctggag gatctttttg tatgctgtta tgaatgtaaa      3300
     gaagaatcat ttaaccatta gttttaattc tttgtgtgcc aatgccaagt atatgaagat      3360
     gaaaataatg agttgccact taccaggctg atacaaagga gcagaattca ggtgagaatt      3420
     gatcagaagg agcagttggt ggtggattct ctactattgc tgccaagagt tcataaaagc      3480
     ttggcgggtt ttgctgatct tcagattcta aataaggaaa tcttcctatt gcacattcta      3540
     acactgacat ccccaaactc caaatgtcac tgctgtagtc atatgtgctt ccactaatcc      3600
     tctcaggctg tgaagtgaaa aaagagacaa gtcatgatta tgtatgtata caatacagaa      3660
     acatcaagaa atttgtaatg tagatgattt ttggaatgct ttcgtaccga catatagttg      3720
     taggttccaa caaatgtgtc cctctgtccc atggagctag caagacttgc acttacacca      3780
     aaatctgaga ttttcacttc ccctttatgg tttacaagaa ggtttgatgg cttaatgtct      3840
     ctgtgtatga catgtctttc gttgtgtagg tacacaagac ctagcaaaac ctgttcacaa      3900
     ggaataatat aagtaagagt gaccgataaa tcataagaat gctttgaata agctggtggt      3960
     gtatttgacc tgtttacaga caacagcaag gtaaggttca agaatagtct tgacttgtct      4020
     aatcacatcc gcaagagatc cacggtccat gtattcaagc acaagcgaaa aggctccatt      4080
     gtgatagaaa gaatggtagc aaactactac atgtggacat tgtgatgatg cttggtttat      4140
     tttaagctcc tgaacaattt gcttacggat ttcttcttgt atattcatct gtatgacctg      4200
     tgattcataa cataagcaaa ctcaaacccc aagtctactc aaaggcctta gtcactagca      4260
     taaaatcaaa agaaagaaaa acaagtagtt taccttcata gcaaagaatt tgccaaccca      4320
     tttatgacga actaattgaa caacaccacc actgcctttt ccgatgactt tgacagtctc      4380
     taagtcttca gcagtaattt cgaaatcaag ctccttgcta tcagattgct ataaatggaa      4440
     gataaaacac atacacaaga aatctccttt aattctctgg aacattgagg tctctcataa      4500
     aacaagattt agggttgaaa aatttaccct tgattgcttc tcatctgacg tcaaccttag      4560
     ccccttttga ttcagaagaa aatctccatc gtgaaatgtt ccactcgcag tcctgttttc      4620
     aaattcaatg aaatttcaca gaatcaattc aaacccagaa acaatggatc aaatctaatc      4680
     gattcttgtt tacaatctcg ccaaacaaaa cagatccaag taaagaaagg agaaatcgcg      4740
     aaacttacag gaaggaagag attggggatt cttgagctgg aacggagagc ttaagctgct      4800
     tcaagttcga tttgatcttc accatttttt ttctttggtt tcttccttgg gattatcgct      4860
     ctctttctag ggtttctatc taaataagca atttcaagaa agtgttagga agtggagaga      4920
     agacgacgaa gcaatcaata acggactaat ttattttgaa cgcgtaagac cgggaaaaga      4980
     aaaaattata cattaagaaa aacaagaatt aaatcatttg ggctgtaaga tttaaatggg      5040
     cttgaattga taaatataag atggtacggc ccattgctta tctctggtat atttgacagc      5100
     tggcgctaag aaaagtctta attgattttc tctttttttg gtatcggaaa acgttttgtg      5160
     taaattggat aaacgaatta tattactttt ttttttcgat ttgtcggttt gaaattaata      5220
     tttttcccac actttaaatg tataagcaaa ttaatgtatt tgatatcgaa tttattaaga      5280
     gcgtataaag ctcacaaatt caattcaatg ggaccagttt aatttaaatt atattggggt      5340
     agttttcgag aataggcata aataacgggg gagtaatgaa aaagttggaa atggtcacaa      5400
     agcttagcgg aatccagaca agtctatcaa atcgaattta ttgtactgcc tgaggcccgg      5460
     tttgtttccg accagtgttc aacttctgac aagaaaaaaa caatagccaa gaaaaaaaaa      5520
     ctaaattagt ttcccactct cgctgtagag agagagagag agagctttaa cgaagctttt      5580
     gttttttgta gagagagaaa aagcttcaaa cttttttcac taaaagagag aattaactcg      5640
     aagaagaaga agagctgcca gaagataata aagcttcctt ctttcgagta aaggaagcaa      5700
     aagcaaagtg tgtagttact cagcaatggc gagagacttc aagcttatct tctccatttc      5760
     aattctgctt ctgcttctag gtttgtctct ctctgtctct actactcact tcaagagctg      5820
     tctgagactt tgttctgaaa tagagcagca aaattaagaa cattcaatgg tttccaattt      5880
     caattcttgt tgaatagact ccattacctt cttctaattt actgtagagc tatcaaaaga      5940
     aaatttcgtc agaaaaaaag tcaattgatt ctgtcttttt tccccaaatt ttgtagactg      6000
     ttgttacggt ggcaaggtcg gagtttgtta cggaagaagc gccgacgatc ttccaacacc      6060
     gtcaaaagtt gttcaattga ttcaacagca caacatcaaa tacgttagaa tctacgatta      6120
     caattctcaa gtcctcaaag catttggaaa cacaagcatt gagctaatga ttggagttcc      6180
     aaactctgat cttaacgctt tctctcaatc ccaatcaaat gtggacacct ggcttaagaa      6240
     cagcgtctta ccatactatc caacgaccaa gatcacttac attaccgttg gagctgaatc      6300
     tactgatgat ccacacatca atgcttcgtc tttcgttgtc cccgcgatgc agaatgtctt      6360
     aaccgctctg agaaaagtcg gtttgagtag aagaatcaag gtttcgacta ctctttccct      6420
     cggaattctc tctagatctt tccctccttc tgctggagca ttcaacagca gctatgctta      6480
     tttcttgaga ccaatgttag agtttcttgc agagaataag tctcctttca tgatcgatct      6540
     ttatccgtac tacgcttaca gagactctcc gaacaatgtg tctttggatt atgtgttgtt      6600
     tgagtcttcc tctgaagtga ttgacccaaa cacgggtttg ctttacaaga acatgtttga      6660
     tgctcaagtt gatgctcttt attacgctct cacggcttta aacttcagga caatcaagat      6720
     tatggttact gagactggat ggccaaccaa aggttcaccg aaggagaaag ctgctgcgtc      6780
     ttctgacaac gcggagacat acaattcaaa cataatccgt catgtagtta ccaaccaagg      6840
     cacacctgca aagccaggag aggcaatgaa cgtttatata ttctcattgt tcaacgagaa      6900
     tcggaaagcg ggtttggatt cagagagaaa ctggggattg ttctaccctg accagacaag      6960
     tgtttatcag ttggatttca cgggaaagag caacgggttt cactctaatt cgagtggtac      7020
     aaactcaagt gggagtagta atagctggtg cattgcttct tctaaagctt cagagagaga      7080
     tctgaaaggt gctttggatt gggcttgtgg tcctggaaat gttgattgca cagctattca      7140
     gccaagccag ccttgttttc aaccagatac tttggtttct catgcttctt tcgtgttcaa      7200
     tagctatttc caacagaaca gagcaacaga cgttgcttgc agctttggag gagctggtgt      7260
     taaagtcaac aaggacccta gtaagtaaac aaaatctcca gcttttgctt ctccaaaatc      7320
     acaaatcaac agtcttgatc tttaccttaa tctgattcaa tgtcgttgtt acaggttatg      7380
     acaaatgcat atacattact gcaggagggt atgtcataaa gatagttgat tcatatgcaa      7440
     attgaagaac agtaaataca tattcttact gttttgttaa aatctttctg caggaacaaa      7500
     accaaggcga cgaatgcaac tgcattgacc tcctctgctt caactccacg tggaaacgaa      7560
     ctactccaat ggattttgaa actctgtctc atgatctcgt tgttcttcag tttgcaaact      7620
     atgaattcac aggcactgta accgaaatct gaaagaaatg tagcaatagc aagaaaaagc      7680
     aaaatttgtt cctgaatagt ttggtctaga aattgtgaca ccgtctaacg attttgtctt      7740
     tcttcctgca gtggaatcgt tgtacagaca ttctatctga aaacttgtct gatatcaatt      7800
     gtgtaaccac agtcttgtga tcttaatcat cctcactata atacacaaaa atctcaatct      7860
     gcataaccaa taatgaactc taaagctatg gtaccacact gccattcatt aaatatttca      7920
     actcgacaca aatgtagaca atactatatt gttttagaaa taatcataca accccaagat      7980
     ccatcacaag gtaggtaata cacagtcgga ttatcgaata gtttttctct cacgacacaa      8040
     ctagaagatt acataaagca atatgaatat agtagcagct taagtttcag agccccgatt      8100
     caatcaggta ctcaccgaga ttctccacaa ccatattgca ttgtccagga gtcattggtt      8160
     catcatagat accaaatacc aaagctaagg tggtcttctt gatggtaaca ccaccagctc      8220
     cctacaatgg aagcaaaatc aacaacagtt catcaaaaat caaacaatat tcaaacagtc      8280
     tagttacctt ctttcctcga atgacggcat taggctctcc ttggattacc atgtacttgt      8340
     taccaccaag gaacaatcct gttggggcaa gtgttccagg tgtagtaaaa tcgtctttga      8400
     tgccctgaat ttcctcaggc ttcacctaaa acaacaacaa tacaaaaact ataagagaaa      8460
     caaattcagt ctctcttaaa catctcatga aagcaactta ataacttatg aacaacataa      8520
     ccagtacaaa gaacttgtct atttccaaag gtcaaaactt tcttcttaaa agagctttaa      8580
     acttgtgatt cgaacttctt ctaatgcatc ttttgcactc tataacctca agaacatatg      8640
     aatcagaaaa tcaaaaccaa acattgaaaa ttgctgaatt ttggtggttt agtagctaaa      8700
     caaaaccaaa ggttgcagat ttcaacatag aaccaaacca gaaacagcaa gatgataaga      8760
     attgagtagt cggtatagaa ataaacccta acctgaggaa aattgttgct ctgagcccag      8820
     acgctaccgt cttggccgag aattgcggcg gcggtgaggc ggttgcctgc aacatcgcac      8880
     attaagtgat cgtcgacgta agtctgccac gacatgtttg ttttcttctt cttctttact      8940
     tttgctctgc ttcttctttg tggtttatcg gaatgttcta gagatagcgt cgaaactacg      9000
     agtgagtgag tgtgtggcaa tggcatttac gcaaatatat tgttttatac atgattgaca      9060
     cgtgccagac acagctcttt ttaatagttt ctaaagagga aaattgtatt agaaaatcaa      9120
     ccagttataa tgaaaaggga ggaaataaat aaaaaaatag aaaacttatt taaggaaaac      9180
     caaaacattt aattaaatat ggtcttttcc taaaaaaaaa caaatgtttc gattttcatt      9240
     ataattgatt tttgttatga ataaagatgg atgtccatta taaggccctc atctaaaccc      9300
     atcatctaga tgtttttagg gttttatctt ttttttgtac tcctatataa agaaccattt      9360
     atctcaatgg aataacacac tcatttcttt tatctctttc tctggttata acacgttatc      9420
     agcacgttct aaaaggtaga tatagagatt cttacatttt ttttaagaac catgtttact      9480
     tatcgactca tggttcatag tacttatttt ctattattga aacaaaacaa tatgagccga      9540
     tcgatgatta tagtatagat cggtaaaagc atgttttcaa tgattcaata aagaagagaa      9600
     taatgcttat catttgtttc tataattact atcgcatgat tcaatgattc tacaaagaaa      9660
     atcgttaaag aagagaatca tgcttgttaa ttgttaattt ttgtgattta ctattacaat      9720
     attgaatata taaattacca attttataat tatataacta actttgtaac tattcataac      9780
     ccggtggtgg gtgatgcaag catgtattaa tgttttagca ttccagtttt gaatagttgc      9840
     atctatattc aatatcattt tataaatatt atattgtcta aaatccattt atgattgata      9900
     tgatatccct tatttaactc ctttgattaa aacgttatac atatcttatc acttttagat      9960
     attgactttt ccatattaaa tatttgattt tcatatattt gattgtgtta ttattatttt     10020
     tactaaaaac atttcaagat aatttttctt tttataagat tccatatatc taaatctttg     10080
     tgttattatt atctaaatct ttttataaga tttccatata tttgattgtg ttattattat     10140
     ttttactaaa aacgttgcaa gataattttt ctttttataa gattcttttc tctaaatctt     10200
     tgtggtatct aaaaaaaaat tgttcatggt tttgtcgtaa ttttgcacga aatcatttta     10260
     cccaaatctt gcacgaattc atattaccct aaataaaagt tttgtcaaga tatatgtaaa     10320
     atccagattt tgcacaaagt agttttattc tgattggttt tacaatattg cattaaaatt     10380
     atattaatat ataatatttg attattttat gaaataaatt gattgataaa taacttaatt     10440
     taaaggtata atcacttata gaaattttta tgaatgacta ttttaatgta tcttaaaaag     10500
     atatcatatt tttgatggtc aaagtttttt caagaactta aattatcacc agaaattgag     10560
     aaaataaata tggtaaaaaa aaaaaaaaat aagaaaaatt tctaacgatg aaataatcta     10620
     gtatatcaag tagtataaat cttattaaaa gactctagaa gagcatatac attgctttct     10680
     atgggaatac aaaattaaaa tcatcgatgg ggtataattc tccaaatctt aaagttaata     10740
     tgatgagata taaaatacat tatgattcta gagtggaatt aaaaacgaga tagatgaact     10800
     tgaagtttca tcatttcgag gaggagaaat aatgaatctc acatcgataa taagtgacat     10860
     atccagaaga ttatgttcaa tctttgacta ctaaagatct aaaagttgta taaagcaatt     10920
     cttatacgaa tgtgttatca gataaaataa gatataatta gttattactg aaacttcaag     10980
     acttgaagtc tctttgtgaa tataactcac attgttaaga gaatatctat gatgcagaga     11040
     tggtaaaaca gacgcttaaa cttttacgca agtattgttg tcctgtagac acaatatttt     11100
     gaaagaaatt ttgagaacta ttataaactt aaatcgagtg tttttcaaag gctaagaaaa     11160
     tatatgagtt atcgatgata ggtaatactc atattctgaa gtgaatataa gatcttacat     11220
     agttagtcaa atttaatatc gtttatacta gaatataaaa ttttaattat tatctcgtta     11280
     ttgttttatt aacatatgat tgattattaa aatacatgga cgtaattttg attataagat     11340
     ctcattaagg gagtaactga taagcaatga aaaataaatt agaagttttg aaagaactag     11400
     aagtttcaaa tgaattaaaa atttcaaaag tatatttatc ttaaccggat tggtcatcct     11460
     ggtttaatga tgatgtgaaa gtattgagaa ttatgtggac attaggtgaa aaaccataaa     11520
     attctcccta atgatttatc aaatgttact tgctcaaaaa gcaatatgat aatgtgattt     11580
     ttaccagtgt aagtaatttg gactttatct attcgtaagt atatacaagg agataattat     11640
     gggttgatca cccactatat gacatttaga tacctaatgg ttataaaaga tgcatcgatt     11700
     caatggacgc attgactcga ttgttgcatc gacaaaaagg tcatatttat ccttgttata     11760
     aacccgcaac atagagtttg cgagattact ttcttgatta aagtacaaga gtatttcagt     11820
     gtttatttat aataaccatt attggatatt cgttgggata agtgtttaac attttgaaat     11880
     tcatgttcat acacaaaatg gtttagtaac atcgatacgc atcaagccaa tgaataatta     11940
     atagttttcc ccattattat tggttttggg tcagaaacca aatagttttc atctaaaagc     12000
     tttgaatgtg aaaagtgctc caccacagca cgcagagatg aaccctcaaa ggaggataag     12060
     aatacatgtt ggatatgaat gataactaag ccatcctaga aggatttata taccgctcgt     12120
     tttgaaaact atcatattat atagtcagct attccaacat aagggggaga atgtatacag     12180
     ctggtgaaaa agataaatag aaatgaatta tcaatgatcc tcggaggaaa gaatgtatat     12240
     taagagtcca aaaaataatt caattacaga atttagcgtt gtaattgcca gacgcatttg     12300
     ctgacctaaa taaagtgatg aagtcaccta taccagttat aaattaaatg ctccagaata     12360
     gaatgaatgt cctgtaagga ccaatttcaa actgctattg agtcttaaga tcacattaaa     12420
     cataatagac cttggttcca aatagaaata tcctcgtaaa agagaaggag cacaaaatta     12480
     aaaatgacca aattgaggaa ataaatattt tgatgatctc tcgaagagag tgaatgatct     12540
     ctagaagaca cataaacatg acaaatgaaa cattcaagta cttgacaatg aagagatcta     12600
     gctagctatg tcatgtcaaa atataatgga atcaaaagca aatcgacgtc gtaatgtatt     12660
     tgcatgctat gagcagttga tattatggac aaaaaggagg atcatgaaag aaagtctatt     12720
     gaaaagtgta cacaaagtag tgattagcca aaaatggaaa agaagaaata gacatataat     12780
     tataatctct agtagagata tttggactag tagactatgc acatgatgtg taaaaacagt     12840
     ggaagataaa tgagtcttta tgtgaaagaa tagtgaaatt aatgagattt tcagaaacat     12900
     aagaaatgta ttatgaagag atatattctc ttgtggtgga tgtaatattt ttaagtatct     12960
     aaagtctggc aataagagac ggaacactgg atatgacatt tatatgaaat tcttgaaaga     13020
     tataatctct gaaggattaa ttatatgaga attatgttct ctagaactct actcgatcga     13080
     ataaaaagaa atatgtaaca tgacatataa tcatataaat gtatatttac gttgagtttg     13140
     tcaaaatata ttgatcaaac taatatttat tttgaaaatc attaaaactc ctacagagtt     13200
     atcataagta atacgatgcc aataatctat gataaaatat cactagataa tgatatttat     13260
     aagtctatat gaaacccata taattttgat cattaagatt atggttatta attccaacga     13320
     gatattgtat ttgattgaaa atcatctcct gaagaagatg tttccgaggg ggagattgaa     13380
     tgatatgcgt ggatgtaccc tttttcctta tcatagtttt tatcccacac gatttttcta     13440
     tgacaaggtt tttaacgaga cattaaagaa cacacaaata atacacttga tgaatattaa     13500
     gaaattctat caatcatcca aatgaatatt atacactaat gatatttaga gaaataaata     13560
     agatggtcaa gatgaatcat ctaaaagatt catgagcaga agaatgacgt tgtactttat     13620
     ccagaaattt gttcaagaga agatttggca gacttatttt caaatactgt ttattctctg     13680
     ccacatcttc taatcatgca gagattttac taattcatga agctagccgc gagtgtgtat     13740
     ggctaagatc catagttcac catatacaag aagactgtgg tatgtatgca gggaaaaaga     13800
     ctccaacaat tatgtacgaa gaaaatgcag catacatcgc acaactcaaa gacggataca     13860
     tcaaaggcga tagaacaaag cacatcctac caaaattctt ctacacacac gatctacaaa     13920
     agagcggcga tgtacgagtt ctacagatcc gtttgaatga taatctggct gacttattca     13980
     ccaaggcgct acctactgct actttcaaga agttagtcta tcgtatcgga ttacgctgtc     14040
     tcaaaaatct cgacgaatat actcataagg gagagtaatt gtatgttgca ctctttttct     14100
     cttaaccatg gtttttccca ttgggttttc ctggtaggat ttttaatgag gcagcatttc     14160
     aaatatttta cgagttatgg tactataatg gtcatcaggg ggagtgttat gaataaagat     14220
     ggatgcccat tataaggccc atcatctaag tccatcatct agatgtttat agggttttac     14280
     cctttccttg tactcctata taaaatagca tttatctcaa tggaataaca cactcatttc     14340
     ttctatctct ttctttgatt ataacaattt tgtaattttg ttgatttttt tttactctta     14400
     acattaaata aatttgtata aatttaaaca ataaaatgaa tggatgttaa taaatagtta     14460
     agaaccatca atctttctat attaattgaa agactgtttt tactatgata atttttacaa     14520
     cataagtgtg aaagcacatt attacatgaa atcttggggg atgtaggtgt aagaatctaa     14580
     aaataacaac aatatccaaa gttattgaat aaaagttcat actaaatgtc attttagtac     14640
     ttaatttatt tatttacaaa gaaaacttca cactttttgt gaaacacaaa tatgaagttg     14700
     tttaatgaga tttattatga aatgatgaat attttagaaa gaaaatgaaa aaagagaaga     14760
     ttttgaaggt agaaaagaag aacacaaaga tcttagtagg ccttatgtaa tgggccttaa     14820
     tatgtttttc ctgtaatgga gggtaatttt gtaaatatgt ctaatattgt tgaagaaaac     14880
     gttttttggt gaaattcgtt gaccaacaac tctcactctt tgaagttgtt ttcttcccgg     14940
     cgatgaccga tgaaacggag gaagatgaca cgacgcagca gcgatcatca cgaaacgacg     15000
     gcgtttcaaa gaataagggt aagggtttta agggagataa agcaaagagg gctctaatcg     15060
     gagctggtgg tcggatcctt ttttacccaa ctcttttgta caacctcgtc cgctttaaac     15120
     tccagtctca attccgatgg tgggatcaaa tcgatgaggt ttcttactta tttgttattt     15180
     attcctgtta acttagtgct aatgggattt aaaggagata actttttagc attaggaatc     15240
     tgaattttga ctagaatgtt ttgatccgaa agtggaggca atgtgatgtt taaagatcag     15300
     ttttttcaga ctctttaaag tcagaatttt ttctgtctgt atagttatgc agtagactat     15360
     cgaaattttg agctctttac taaaatctct gagtatcaat ttggtagtga ttttgagtct     15420
     atgcagaaag tctgatacag aaagtctcta tcttttcagt atcttttgat gggagcggtt     15480
     ccatttcgta aggatgttcc gagactaaaa aagttaggtg ttggtggggt aatcactctt     15540
     aatgaacctt atgagacttt ggtaccatct tctttgtaca gtgtaggttc aatgccacca     15600
     aacttgtgtt tctaattttg ttgtctactt gtggagtagt ttgatgattg taagttgttt     15660
     ttaggcttac gaaatggagc atctagtgat accaacacgg gattacttgt ttgctccttc     15720
     aattgtcgat ataaccttag ctgtaaactt cattcacagt gagtgatggt gtgcttgctt     15780
     tttaccttca tttgcattta ctctttctgt tacttattat gcagtccttt tatgttacag     15840
     agaatgcttt acttggtaaa acaacatatg tccattgcaa agctggtcga ggaaggagta     15900
     ctactgttgt tctctgttat ctggtaagtt cattgatcaa atcatatcgg ttaaattaca     15960
     tttgcagttg gtcctttgtt gaacttcctt ctcactaacg ttttctctct ctttgttttt     16020
     cagattgaac ataagagtat gactgtggct gcagctttcg aacacgtgcg ctcgataaga     16080
     ccccgggttt tgttgcatcc ttcgcagagg aaggtaagtc ttgatcggtt tatcgatatg     16140
     cttcaccaaa gagacaatcg tataacgaag atgaaaacat gatctttttg tgtgtttgat     16200
     tctttaatac agagtctagt ttgtttctga atgctttgtg atttcattta tatgtattta     16260
     ggttgttgag gaatttagca gattacaatc tcctttgagc gaatcaacat tcatcgcaac     16320
     ctctggtgat attgtaagtt aaatggcaga gactagtcag tcatagctca gcatttccgg     16380
     cattgatcaa cagctaagca ggagcttttt gcaagatttc tctgcttcct tttggttctg     16440
     ttaaaatctt cggttttgat catctgattc ggcttggttc ctgagtataa caaaatgact     16500
     tgttgattaa caattgtgta taataaaaat tctcttaatg atgtatttta tttgattttt     16560
     tggtcctacc agaattgtgg aaacgttaac cactctgcat ttcgctgagg gtttgcttct     16620
     gaatgctcct gcgaatttaa tcatttgtga ttattctttt gttttacgcg aaagattgac     16680
     caataaccac ataacttatg ttagaacaat cataaatttc attaattaaa tacacaaatt     16740
     cgttagaaac ttacgtcttc tgtacacgta gctgtggtac aacccataat taggtcttct     16800
     aatcccgaac cagacgaccg accccttaat tgctgccgct gtcatttaaa agaaaatcaa     16860
     aatgcgaata ctaattgttt atgacaaata ttgagaagga attgaattta tgatatagta     16920
     tgaattactt tttttgcatg agcctgtaga tccaaaatca ttagtcttta tttaaatgag     16980
     tggttatgat taaatgtcca agtagacaag aaacataata tcactactat ctagctagct     17040
     atatccatgc atgcacgttc gcgtgcattg actttagatt tgagcttgaa tatatttgtt     17100
     taagtgaaat taattaatga aaacattacc tgaaagggca tagtacttgt aacatggaag     17160
     attgactcat gttgtgatgt gatagtaggg gtcatgggat atgatgatga catgtgaaat     17220
     tctcttctat ctccgatttg atgatgttga ttatgatgat catgaatcat atgatgagat     17280
     gacattgatg atgttatgat cccatcatgt acttcctcgc acgtgccaga cacatgctgg     17340
     ttctctcttc cctttgaagc ttcggctgtc cccttgatta cgtacaagtt gattaccaca     17400
     caaaaaaatg ttggttacca aaaaggaaaa atgtttgtaa aacaaactct cattgttgca     17460
     attagacgac accacaatag taagactttt tcacgtaaaa attgagcaat agagaagaaa     17520
     tatatcgtaa aattagagaa aaagtatttt atatccacca tttaaaatga acgtatatac     17580
     ccacgataaa aacaaataat tatatacata gagacaacaa caaaaaacta tgaatgtaat     17640
     agatagtaac actatcataa aatcagctga aaagaaactt aattagctga caaaaagcag     17700
     aacaaaaaaa gttgtagatt tttaagaatg aaaatgacca aaatagttat atgttttgaa     17760
     gatatttata ctatattcat aactatattt tagttgtgag gaaaaataaa gtgtatatac     17820
     ctcatcaaag gatcttgtat ggggatgcat attaacccta gaaacgacgt caccggagcc     17880
     aagactctgc aacgtggcag ctacgctgga aatctcatct ccgacaccaa ttccgatcac     17940
     gtccttggaa ccatggtgat cagaccaatt agtattacta acacactgtc ttggttgtgt     18000
     ctgataaaat atcttggaga ccacaagttc tccttctctc tcttcctcat taatccctaa     18060
     atgatattga tgcatcaccc aatttgtttt ctccggtcga cgattcttgc cgaagtttgt     18120
     gtagagtact aatatcttct tgcatcctct ttgttgaccg ttgatcataa ccggtcttgt     18180
     tttgcccgtt ttgtgccacc tggtttctga tgatccggtt aactcagagt cgtgatcggt     18240
     ttgaattatt ttacgtcgtt ttcttgttcc ggttgtgtaa gctcttgatg gtttgtggaa     18300
     gaagtgtttg ctcaagccat ctcttgtcac cccttaattg caagataaag aaatataatt     18360
     ttgaattgaa tttctagaaa tttagtctat gaggaacaag ttattattta tgaggaaact     18420
     tgtttttcaa agttgggtca ccaaacatta tccaagatcc gaatatcact atacttgcat     18480
     gcacagtttg gtacaatggt acatattcat aaatatataa taactaagaa gagtttaaga     18540
     ggttattcaa taaaaagaaa ttaagctgca gataatcgat taattaaaat gcatcgcatt     18600
     ttttttttcg tagtaaattt cgttgaaaag ttttttcatt tttgttacac taaaatatcg     18660
     attcaatgta ggatgtttta aaagaaattt ctttctcctt ttaattgatg acttaagtat     18720
     tctatcaata tacgggagct agtggtgatt tctaaattgc ctatataaaa agtactgtac     18780
     aaaatatttt catctcctta acttatattt ggactatcgt tccatgcaga tgatatagat     18840
     caaactacaa gagtttattg tacttgtatc aaaaaaaatt gaaattaacc tggaagcttc     18900
     tgaggatgag tgtaacatat tccatcttct ccatcaatgg tgggaataaa ttcatctata     18960
     agtggatgag acgacgacca tttcttattt tcttcttttc ccttcacttt tgcttctaaa     19020
     tgttctataa gttcttgatc tgtcggatcg aatttcactc ctgccggcaa tccaacccaa     19080
     ttcttaaaaa gaaaaaagaa gaaggctgat taacaatgaa taataatttc aaagatataa     19140
     agaaaaaagt gacaagatga tatctttaat tatttttatt cttgggggtt gattagatta     19200
     tatatgtcaa ggtgtataat ggaatattac tggtttagta gcagcttgaa tcatgcgacc     19260
     acatccagga caatgttttg atccgcaaag atgatgatgt tcttcgagct ttgaatctat     19320
     gaggttacat ttactattct tcatagtttt cttttgatct ctaaatgatt tgatgagaaa     19380
     ttgatctgca gtttatgaac aacaaaaagt aattttttaa aagatattga tcgatgcata     19440
     tatacacgat tcaaagcata taataaaaaa gaagacaaaa atagttagta aatataaaga     19500
     ttaccagatt tgtatgacaa tacgagatct accaaaatta ataaaaggta aaagaatgaa     19560
     attgataaga tgagttgatg tcattaatat gcatatatgc gtgataaaag aacacataga     19620
     caatttcaaa acatgacaat aataaagaag aagtacaaac aaatatcaag attaccagat     19680
     ctgcgtgaga tcgattggat agggaaaatg taagaggaag aagaatttga taaagacggg     19740
     agtgatctca atatatatag tagagaaaaa taataacttg tgatttatgc tttttaagta     19800
     ttataattat tgttattaat atctctcttt gtttccagaa gagacacaga aacacatgta     19860
     gatacgactt taagtactga aaaatctatg tcaagtagat aaagaaatga agaagaaatg     19920
     aggaagacga agagtaaagg aaataaaagg agttgagact gaaaaggtta aaaaccctaa     19980
     ttttactctc tcttgtcttg tgcgactcat cttcagtcta tcgaccaaac cttttattta     20040
     tttccttttt gttttatcta tctattttat ttattattat tagtgtattc gtattctaag     20100
     gtggtatgta ttaatattat aataggcttt gtacatacaa aattagtatt actcagctaa     20160
     atgagacata tcagaccatg tcaacttttt ttgagcaata taaggaaatt acgaattgtg     20220
     agatatttat aagttttagt tggagtcaag ctgtaaaaaa tgtaaggctt tctttttatc     20280
     aaaaagataa aaatctaatt ttaaagattt tatttaataa tcttgtgctt taattaactg     20340
     ttgaatctcg ctcttttgtt tgaaataaat atttgtttgt acatccattt taatagtata     20400
     aaacctggta ccttctctga ccttctgaat gtttttgaac ataattacgg attaatttag     20460
     gagaagatta tcaatatttt taaaataaag aacgcaggaa aagaacatag gaaacaaagc     20520
     atttaaggat aatctctttg gattataggg caaacacatg tttttaagaa tctttttctt     20580
     ttttgctttc tttcacatta tttgaaatat gtaacatatt cttgtgggat ttgaacccaa     20640
     tggtcctaca ctggtgtggg tccaatgatg atgtcgggag atggggccta gccgcagatt     20700
     tgtttgaaca acagatcaaa cggtcatcat ttatttgatc taaatgatta tattaggttt     20760
     tgcatttttt cttctccttt gaaaagatga aaaacgaaaa aaggtcagaa atctactgga     20820
     gataagagta ccgtctgaga ctagaataaa catagatatc agctgaaaaa attgataaga     20880
     gtatgataat gtgcttattc agttttatta ttaaaaaaat aaaaaaatta gtctgctacg     20940
     aaaacacaag tatacatact atagttgata agagcattat ccatggtgtg tagtaagtaa     21000
     gtaaacaaac cattatattt ggattaatcg agtattcagc aaatattcat attgtcttgt     21060
     taatgattaa gagcctagaa gtctttaaaa tatccatcaa gattcaaaca ttatgactca     21120
     aactagtgtg gtgttgtcca ttatactcga aacgaaatgg tattttttca acttttgctt     21180
     gtaaaactta gccagtgcat ggcctttatt aaatcaacta ttgggtcact gcatgaccca     21240
     tttatcaacc tgtaactgaa tattgggctt tggcaaagat ccaattagct tcattcgtat     21300
     ttcagaaatt tgattttata tccgactgag taggtacgta tatgcaatac gttatgtcct     21360
     attagcctta tgggactcac gggtacttat gcaggagatg gattaatttc atatccatct     21420
     gcaaactaaa tacatttatt ttcttatggc aaaaagccaa aaactatgta acgtttaatt     21480
     tacgaaaaaa aaaatattta atatttgggt tatatggatt tttttttatt tttttttttt     21540
     ttttcgggac attagcgaga gtcatagtat taaagaaaca gtaaaaacaa cgaccagatt     21600
     taatgcaact ttattactac tttaattcag attcgagaat tgacaggcaa atacgcatta     21660
     ttttagtaca ttatgaagaa tcatacagtt acatatttca catatatatt gttttaaaga     21720
     tgtaaaacga ctaagcaagt atgtcatctg atagcattat gaactaataa ctttttgtca     21780
     actctgattt tcatttttaa aattattata tcttgttacc tctttgtaac cagcaatagt     21840
     ttcttgacaa caaaagaatc ggcaaatcaa tgaaaactta ttaaactaac acacaaaaca     21900
     taaaaaatag tgattagccg acacaacaaa attggatttg tctttctctc tttaaaagat     21960
     tttcacccga atattcctaa agatctgaaa tactgaaaat atcacacaaa aaaatccaaa     22020
     aagaaaaaaa atcattttaa aatttagaac ttgtttttca aggcccaaaa ttaatcgttg     22080
     tcaataattg gaaacttaaa aataaagtct tgttctagaa gaatgtgaat catcttctcc     22140
     aagtttcaaa cgttggtttt tttccccact gtgatcgtca gctttatata ttatatacac     22200
     gagaatcttg tacccaatta acatatacat acatgtaaat gtgtgtatgt atataatata     22260
     aaattattct ccttttcact aatttttctt caaatacttt aatgcccacc acctgttcga     22320
     tcaaattccc catctcgaaa agctagaact ttcttcgtct ctattggtct ctcactctct     22380
     ctcttacctc ttctcatttg ttctttctcc ttctaaattg ggttatcaag tatattggat     22440
     caacgggttt gattcacgat ttgtcatttc atcttcgtgg agagagtttg atctgatttg     22500
     ttgatcgtca gcgttatgtc tagtccgaga agtaacaagc cgaagattgt caacggtcct     22560
     ggtggttata ttctacaaga cgttcctcat ctcattgatt accttcctga tcttcctgta     22620
     tgtttcactt gatctctgat tggttctaaa ttgatttgaa aatttctcga tttgcacaaa     22680
     gagatcgaat ctgatatcgt ctagttaaca aaggaggaat ctttagcttt gggtttcaat     22740
     gttctgatct gtttctggtt tactcttaat aaaatggtga taattcgtgg ttttgatgtt     22800
     attgcagact tatccaaatc cattgcaaga caatccagct tactcagtgg ttaagtaagt     22860
     atcttcacct atttcagacg tttccattgc ttaaagttca tagtttttgt tctcatttgg     22920
     atgtttttta tcaggcaata ctttgttcat gctgatgata gtgtccctga gaaggtaatt     22980
     tatcaagcat aatccttttt tacctgtaat tgtctgaaga atggtgttag atgatcatgt     23040
     cttgttgaaa gtgagatttt taaaagtaaa aggctcactt tttctatcct ctgttttatt     23100
     ttcgtgttat ttaggttgtt gttcacaagg atggtccaag aggagtccat ttcaggcgtg     23160
     ctggtccacg tcaaaaggtt tactttgagt ctgacgaagt gcatgcttgt atagttacat     23220
     gtggaggtct ctgtcccggt ctcaataccg tgattagaga agttgtgagc agcttatcat     23280
     acatgtatgg agtaaagaga attcttggaa tcgatgtaag tttggtgaat cataattaat     23340
     ctcttcggtt tcattttgga tttcataact attgtccaaa cgattctcat ttgttgaaat     23400
     cttatagggt ggatacagag gattttacgc caagaatact atccccttaa actctaaagt     23460
     cgtgaatgat atccataaac gcggaggaac aatcattggg acctcaagag gtggacatga     23520
     taccaacaag atagttgata gcattcaaga tcgaggaatc aatcaggtta gggaataaac     23580
     acagccactg ctttttacgt tgtatgtgaa aaagtttgtc aaccttttct tgatgtagta     23640
     tctgttatca tttaggttta cattattgga ggagatggaa cccagcgagg tgcttcagta     23700
     atatttgagg taattccatt gtgatatttc agaataacag ttgtaagttt taagttttaa     23760
     caatcaacaa ctgaacttag attgtatata accatgtagg aaattagaag acgtcgacta     23820
     aaagttgctg tggttggaat tccaaaaact attgataatg atattccggt gatagataaa     23880
     tcttttgggt ttgacactgc tgtggaggaa gctcaacgag cgattaacgc agcacatgtt     23940
     gaagccgaga gtaatgagaa tggtatcggt tttgtcaagc ttatgggtcg ttacagcggt     24000
     aagtctttgt tttgaaacat acaacttaaa agaccttttc gatttgttac tgactaatgc     24060
     taggcgggtg ttgtactaca gggtacatag cgatgtatgc tacattagcc agcagagatg     24120
     ttgactgttg cttgattccc gagtcaccat tttacctcga aggagaaggt ggactctttg     24180
     agttcataga gagacggctg aaggatcatg gtcacatggt gattgttctt gctgagggtg     24240
     caggacagga tttgatgtgc aaaagcatgg aatctactcc tatggatgct tctgggaaca     24300
     aacttcttaa agatgtcggc ttgtggctat cacaaagcat caaggtaaga gttaaaaact     24360
     ttcaagatca tgagattctt atgcctttta cagaaaattt cctcataggg tttatttcct     24420
     cttgttgtag gatcatttta agaagaataa gatggtgatg aatctcaaat acattgatcc     24480
     tacatacatg atccgggctg ttccaagtaa tgcatcagac aatgtttact gtacacttct     24540
     tgctcagagc gcggttcatg gtgcaatggc tggttacact ggctacacca gtggtcttgt     24600
     caatggaaga caaacataca tccctttcta cgtaagttac taatacagat ctaatgtgtg     24660
     cgggatggtc ctgaattgaa tctgatcgtg tacttgtgag caattctgaa tcgtgtcatt     24720
     gtttttttgt ttgtcttgca gaggataaca gagacccaga acaatgtagt gattacggat     24780
     agaatgtggg cgaggctatt gtcttctacg aaccagccaa gtttcttggg gcctaaggat     24840
     acatctgaag agaagaaaga gttgccggaa acaccgcttc ttgacgacgg agctgtcgat     24900
     attcctcctg tgactaaaga ggtcactaag tgaagaagtt gcagggcata ataatggcat     24960
     atgtatactc agagggttct gtaaccgatg ccgtttcagg cgaaagtgaa ataattgtta     25020
     ttttaacgaa tttgcccttt tgtgtatgtg catacacaac acaaacacaa attttagttt     25080
     tcttctagat gtttagtttt gtaatccttt ttgcattttc cacaactgaa taaatgaatg     25140
     aagtaataat cttcgttact ttgatcctat atttgttctt gtatatgttt tttcacactc     25200
     aaaatgaaga gaataggatg caagagagct aaattgtttt cacacataga tacttcaaaa     25260
     agtttctttt tggtaactga tcttttaaag aatgagaaag ctaaatctga atgatttaat     25320
     gcagtcaaaa gtgttttttt tttcttgaag gtttctatta ttgataattg agaatttgat     25380
     aacttgtttg gatcaaatct tggtctaata atgatttgtc tgatactgaa tttgcaaaaa     25440
     aatctcagta atagtgtaat actttttttt ggttaaaaaa gtaatagtgt aatacgacag     25500
     accataataa ataaattttt taaagcagaa gatgaaagaa gaaaatatca ttttagttta     25560
     taataggaca gacgagatac aattaccgtt tgtatcaaca ttagcattaa cattagctaa     25620
     tgtaacaata caactttatt aactgggcaa taatatgctt aaacgacaag taatcaaaca     25680
     cacacaccat tttatctttc taatagtaga ctttttttgg acggcctcga tgccgttttc     25740
     accacctcag attttccggg aaatactgaa aaaaatccca aacaaaaatt atatcacaat     25800
     gctgtaaaaa ttaagtacat atcctatttt tcaaaagcag aatatggtaa agatcctcac     25860
     tttcttgata agagacatgt agtacggctt aaccttctcg acattgacgt gtactttgct     25920
     cttgctgtat aagtcatact tgctatataa taaaacatac aatataagta ttaaaaatct     25980
     gatcatcggg aaaaaaaaat cgggtttaat taattaagaa agacttttat ttagagaaat     26040
     aaattactta aaaacatgaa gccatttgag attctccttg tcttcctcgt tcataaggtg     26100
     agtgtaagct ccagccttgt gcaatgctac aatacattaa tgttaattca tcaatcaaat     26160
     tatgttacta attaagtgtt tagttagtta atagttttat tgtgcttacg ataaaaggaa     26220
     tggtatcgga tgatgaatag tcccggggat ggtaaggtgc ttccattctc cttggccacc     26280
     tatttaacca tataataatc gttttgtgaa tcatgtaatc ataattaatg attatagttg     26340
     ataaactata gaaaggaatt aaagaattta ccagatacat gtagtcatca tgtccccatg     26400
     acataagaac attttcaagt ccacagcctt cagaataaat tccagctttg gtattgtact     26460
     tagggttgtt aaaatcaggg ttttccataa aatactacaa tcatggttga aaaggaaaaa     26520
     aatatattat agaaatcact tgtttggtaa atattaatca actaggttct aactatcaat     26580
     attttgagga tgtcaaaaaa agaactatca atactttgag taactagcaa aatatattga     26640
     gttatatgta ccttgtggtg tacgttagat tcatcaaatg cacacccaac aggaaatgtg     26700
     tcacctaaac ggatagagaa ttcataaatc acttacttaa aattgataag tttactactt     26760
     agtaaatcag gattaattaa tgaaagaaat caaagattaa acttaccaac aacagcccat     26820
     tgaggaagcc ctccaaactg tggtagggta agaaccttcc caagatctgg aagttcagtc     26880
     atttttagta tttttaggat tcttataata tgataatttt gattcttata agcatgagtt     26940
     tttgtcataa ataacaatta attaccatgg ataagcgcag tgagatgaag ccaatcttcg     27000
     ttaggataat ctttacggat tgcttccgca gattgaagca aatgttgaat ttgtggttcg     27060
     tcgaggtcgg gatcactctc gtccaccact tcttttgaaa gttcacaaca ttcccaaatg     27120
     ttcatcacca tcttgtccaa ttttccatac tcacttctca ttttctgtac ctgcaaacgt     27180
     atcataagtt agtaacaata tattttataa cagatgagaa acaacaatat gtatcgtatg     27240
     ttcatttcgg ctaacatcgt taggaaagat ttttattttc attagtaatt cataaatcac     27300
     gtccatgcaa aaataatagg actcaactat aatgttgatc acacaatcta ataaacccta     27360
     aaccatataa gatatataag agatcttaca aagtctaaag tttggttagt gtgttgtgtt     27420
     gcatagaaat gttcgacgct cttttgcctc tcgctgtttg tatccgtgta gtctctgcaa     27480
     taatttacat caataaaatc ttaaatgttt tggaaaacat tttagaaatc gtctaaatta     27540
     tttcttgaga aaaaaggaac ctgaattgac gaccaaatgc gttcatctca ggagccaaaa     27600
     acacttcatc atcggatgat atcttcgaca ttggtatgtc gctgtccaat cgtaactctc     27660
     cggtcttctg cgttgtcgag tcctcatgta cttaaacaaa acaaaaaaga aacaaaaaaa     27720
     cttctatttt tacgaaatct caagataaaa tttatagaag aaaaaaaact acaaagaaaa     27780
     gaataacaaa ggaagataga tagatgtttt accaaaaaca gggttttcga cggagatatt     27840
     catcttccaa aaaaaaacaa agtaaaaaag aagatgagtt atgaaaacta aagatcgaga     27900
     gagaatgtct acgaaaagat gtaatttgat ggagacacaa aaagggtatt tgtagtggtg     27960
     atggtttagg agacgatagg tactttcctc tatatttaga gagaaatcca aatcttttga     28020
     ccacgaaaaa taaactttgt ccaagaaaat aaaaactgtg gcatgataaa gatctcttaa     28080
     catttatata caagagttaa tttttttgtt ttcgtttttt ttagtttatt tactctactg     28140
     cgtttgttta tgttttgaaa tataccaaac atcctaaatc cttaaattta ctctcttctt     28200
     gattggtcaa ctttttggca tattttcttc cttttaagat ttaggaagac atgtgtcatg     28260
     ttctaaaata gatatagtag actattaaca tctatgtgat attcttatga attatcatag     28320
     acacatatgt ccaagagagt taattatact tagattctcc attttcttat tcaaaaaaaa     28380
     aaagattctc cattttctta cctttttatc agtgtttttc actttccccc catttttcat     28440
     atttataaca ttcacactta ttagtttctc ccccatttat gctatttaca gtatattctc     28500
     cttcaaattt tggagtattg tggattttga acatgtgtaa attgtaataa attggttgtc     28560
     tttttacgtt ttttttcttt ttcttttgat tatgttcgta actaattgac taactaactt     28620
     tagagccaag tggagaagac aattcgtgtg agtttccacg gcccatgctt tcgacttttg     28680
     agtgaaaaca aatatttttg cattgttaaa agacaactca aaaatatctc gttgttatta     28740
     gtttgttaca aatactacaa tggcataaca gttttcgtaa tataagtttt ccttcgacat     28800
     cattttctta tttcctttaa attatgatgg aagaagatta cgacatcaaa agctagagaa     28860
     aaacattatg agatgatgaa gtttgttgca acggctaaaa acagaacatt acaacttagg     28920
     cctttcataa aacatatggg cttttatggc ccattaaaaa tcgggcttag tggacttatt     28980
     tcagtctcat atatatattt tgagtggcgc atcagtctca tcttcctcca tggctctaaa     29040
     caactttttg actttccaac tactccttct tctacttcgt gtttcatcgg aatctccatg     29100
     gatcgtcgcc ggagatgtgt ctcgaatccc gatcaatttc ctcgaattag caaagagccc     29160
     ggaggttttc gattcaatgg tgagaatcag aaggaaaatc cacgagaatc ctgagctggg     29220
     atacgaggaa ttcgaaacta gtaagttcat taggtcggag cttgacctta tcggagttaa     29280
     gtataggttt ccggtagcta tcaccggtat tatcggatat atcggtaccg gagaaccacc     29340
     attcgtcgct ctaagagcag atatggatgc tttgcctatt caggtctagt accaattcac     29400
     agaactctca tcgattagtt acatttaggt ctatggttca gaaatttgga ttaaggatta     29460
     gaacataatt tgatttgata attgaattca ggaagctgtt gagtgggagc acaagagcaa     29520
     aaatcctgga aaaatgcatg cttgtggaca tgatggtcat gttgctatgc ttcttggtgc     29580
     tgctaagata cttcaacaac atcgccaaca tttgcaggtc tatgcatatt tcccttttat     29640
     actactttca tcagtaacat tggtctaaca catttttttg tttttgttta gggaactgtg     29700
     gtgcttatct ttcagccagc tgaggaaggt ttgagtggag caaagatgat gagagaagaa     29760
     ggagcgttga agaacgttga agctattttt ggtatacatc tttccccccg gactcccttt     29820
     gggaaagctg cttcacttgc aggttcattt atggctggag ctggagcttt cgaggctgta     29880
     atcactggga aaggaggtca tgctgccatc cctcagcata caatagatcc tgttgttgca     29940
     gcttcaagca ttgtcctcag tcttcaacac ttggtttcac gtgaaactga cccttcggat     30000
     tcaaaggttt cattttttac tctttgatga tttctctcct ggtctatgct taatttgtag     30060
     tataacttat taaggtttct tctgtaggtg gtcacagtta ctaaggttaa tggaggcaac     30120
     gcgttcaatg tcatccctga ttcaatcacc ataggaggaa ctcttcgagc ctttaccggg     30180
     tttactcagc ttcaggagag aatcaaagag gtgatctgat cctttttgat ttttttctct     30240
     gtatgttatt ttaccataga atcaacaaac cctggtttca acttttgatt ctagattatt     30300
     acaaagcaag cagccgttca ccgatgcaat gcgtccgtga atctagcacc caatggtaac     30360
     caaccgatgc caccaactgt gaacaacatg gacttataca agaaattcaa gaaggtggtt     30420
     agggatttgt tgggtcaaga agcttttgtg gaagcagtgc ctgaaatggg atccgaggac     30480
     ttctcatact ttgcagaaac aatcccgggc catttctccc tcttgggaat gcaagatgag     30540
     acccaaggtt atgcgtcgtc tcattcacca cactatagaa tcaacgagga tgttcttcct     30600
     tacggagctg ctatccatgc aacgatggca gtacagtacc tcaaagataa ggcttctaaa     30660
     ggttctgtct caggctttca tgacgaactc taatccctgt caaccttggt acagtttcct     30720
     catcggtcat tggttcgaat tcagaagtac caaatttaca ctccattgtt gatagaattc     30780
     catttaaatg atgaaaagcc ttaattcgta gaacaatttc aattgggaaa ttctcaactt     30840
     ttatgatatg tttgtgtaac tgtaacatac tggcataatc ttagaacatg aattataatt     30900
     aataggctag tcttgttgta atgcattggc aaaaccacac cttttatgtt tatattgatc     30960
     agaatcggag attttaagca tcaatttaca ttctttggaa ggaaagaaac tcaagattgc     31020
     ataatgcttc atcaagacca gcctctgctt taatacttta aatcatgaac ttcattcggt     31080
     gtcgccttga cccgctatcg agagaccaac gaattgtgcc tccaaacgtc tcctatctag     31140
     ctacttagtt tggagtgttc caaccttaat gtgttctagt tgtattctcc ttttgttgtt     31200
     gttgttatag ttgtcctttg acgtcgtcat ttgcttgttt cctttaatct tgatggaaga     31260
     agattacgac atcaaagcta gagaaacaaa aaaaaactca aaagaaaaca aaacattatg     31320
     tgatgatgaa gtttgttgca acggctaaac agagcatata ctgtttagac ctttcatcaa     31380
     caatatgggc tttttggccc attaaaaatc gggctttgtg gacttgtttc agtctcatat     31440
     atatatatga gttaaatcag aaattggttg tcatcttcct ccatggctct aaacaagctc     31500
     ctcagtttga ctttccaact actccttttt ctacttagtg tttcatcgga atctccatgg     31560
     atcgccgaag atacgtctca aatccagacg aagctcctcg aattcgcgaa gagtccggag     31620
     gtcttcgatt ggatggtgaa aatcagaagg aaaatccacg agaatccgga gcttggttac     31680
     gaagaactcg agaccagtaa actcattagg tcggagctgg aacttatcgg aatcaagtat     31740
     aggtatcctg tagctatcac cggtgttatc ggatatatcg gcaccggaga accgccattc     31800
     gtcgccctga gagctgatat ggatgctttg cctattcagg tgtattacca attcacataa     31860
     ttctcatcga ttagagacat ttaggtattt tttgtatgaa acttgatcat aggtttaatt     31920
     atacataggc caatacaaat gtctcttagg taatgacgat aatggaatta aggattagaa     31980
     cataatttga ctgattctaa aattcaggaa ggtgttgagt gggagcacaa gagcaaaatc     32040
     gctggtaaaa tgcatgcttg cggacatgat ggtcatgtta ctatgcttct tggggctgca     32100
     aagatacttc atgaacatcg ccaccatttg caggtctatg catttttccc ttttgaacta     32160
     ctttcatcag taacatttgg cctaacacat tttgttttgt tttgtttagg gaactgtggt     32220
     gcttatcttt caaccagctg aggaaggttt gagtggagca aagaagatga gagaagaagg     32280
     agcgttgaag aacgtcgaag ctattttcgg gatacatctt tctgcccgga ttccctttgg     32340
     gaaagccgct tcacgtgcag gttcattttt ggctggagct ggagtcttcg aggctgtaat     32400
     cactgggaaa ggaggtcatg ctgccatccc tcagcatact atagatcctg ttgttgcagc     32460
     ctcaagcatc gtcctcagtc ttcaacaatt ggtttcacgt gaaactgacc ctttggattc     32520
     aaaggtttcg ttttttactc tttgatgatc ttcacacctg gtctatacat tatagaacag     32580
     aactcattga ggtttcttct gcaggtggtc acagtttcta aggttaatgg aggcaatgct     32640
     tttaatgtca tccctgattc aatcaccata ggaggaactc ttcgagcctt taccggattt     32700
     actcagcttc aacagagagt caaagaggtg atgcgaccca agattgcgcc tataatattt     32760
     cccggtattg ttgctttacc catagaacca atctccggtt tcaacttttg attctaggtg     32820
     attaccaagc aagcagccgt tcaccgatgc aatgcgtccg ttaatctaac accaaacggt     32880
     agagaaccaa tgccaccaac agtgaacaac aaggacttgt acaagcaatt caagaaggtg     32940
     gttagagatt tgttgggtca agaagctttt gtggaagcag cacctgtaat gggatccgaa     33000
     gacttctcat actttgcaga aacaatcccg ggccatttct ctctactggg aatgcaagat     33060
     gagaccaacg ggtatgcatc gtctcattca ccactctata gaatcaacga ggatgtgctt     33120
     ccgtacggtg ctgcaatcca tgcatcgatg gcagtacagt acctcaaaga gaaggcttct     33180
     aaaggttctg tctcaggctt tcatgaagaa ctctaaacct tggttgtaga caggttgttc     33240
     atcggttatt ggttcagatt cagaagcaca aacctaacac tccattgaat taatcaagtg     33300
     ttatcgtaca agatccttgc aagtgttata gaatgatgaa aatgtattta atagctaatt     33360
     ttcaattggc aaattatcaa cttttaatag tctgtgtaaa agtattgaca gaaacttaga     33420
     acacgaatta tgatcattgg tcttgttgta atgtattggc aaaaatcata tcttatgttt     33480
     aattgaccaa aatcataagt gaaaaaacag tatttcatag catagaatca aaacataata     33540
     gttcggtgcc aaagaaaaca aaaagttaca aatgaccttg agaagtttca cgacaacatc     33600
     tttctctcta acttcttcta tttctcagaa gagttgggtc ctctcttctt tccgaaacca     33660
     acaactgcac aaatcaatga accattacta accaataata gatacgcaac gtaataagca     33720
     tttgagtcaa aaccaaatga taaattcaga agctctagtc taaaacatcg aaccacaagt     33780
     gttccaatat aacacatttc tcgagtattc acaattctta ttcaaattca caatattatt     33840
     aaccacattc aacaatgcag tagtatcgct ttataaaaat cgaattcaac aatgaacact     33900
     aacacactgt aaaggaatca acaaagaaac tagatcggaa aaattacctg cggtgacaaa     33960
     acgacggttg tgctgcagac gcttgtgagc acgacctctg ggcttctttt tcttatcttg     34020
     cttcgcaacc tttggagttt gtcctctaac cttaccggca cgagccaaag atccgtgaac     34080
     ctttcctgaa atcgttaaaa cacacttaac gtcaacagat ccacatcaga agaaaaatca     34140
     aaagctaatc tataaatttc aagaagtttc caaggatttt acccatgatt gattagcttc     34200
     tctgcttttt gttcctccgt tccgccggct gcaagaagct gaaatgagtt cgtgcgaaat     34260
     ctcagaatta gggttttcga gatgatgata cgtatttaaa cccgataccg aaatatattg     34320
     ggctttatgg gcccatacta actacttaat tactattggg ctttattagc tcgaatatgg     34380
     acatctgtaa aactggacct ataagcaaca caagtttgac aatataggaa tacaaaataa     34440
     ttcgaattca gagaaaaatt atctctactt taataggtct ataacgtttg cataatctaa     34500
     aacccaagat attttggaaa catatttcta ttttaatacc attttccact aatacttttc     34560
     aataacagta gttgtttcca taaataacgt ctccactaat tgaataaaat gaaatattta     34620
     acgaattatt aattgcgata attagatacg aatcaaaaag attccaccgg cttcgttgga     34680
     aactttaaga tatttccgat tttaccccat ataaagggaa gatccaacgg ttattcttac     34740
     atctctcaat acgcagccaa atacactctc tctgaaacct ctcctctttt agggtttaat     34800
     atcaacgcct ccaaaatttc cgtgcttttg ttttcgtaga taacgaacaa tggctgatga     34860
     gattgtgccg ccggcgactc aattagccgc cgtatcctta gaaaacgatg gatctacggt     34920
     gcaaagagct caattctcta accgggtttt gattcgaacg attttggatc gacctgacgg     34980
     cggagctgga ctcgccggtc aaacggttcg aatcggtggt tgggtaaaat ccggaagaga     35040
     tcaagggaaa agaacgtttt ctttccttgc ggttaacgat ggatcttgtc cagcgaatct     35100
     tcaggttatg gtggatccgt ctctctatga tgtctctaac ttggttgcta cgggaacttg     35160
     tgtgactgtt gatggagttt tgaaggttcc accgaaaggt aaaggtacgc agcagcagat     35220
     tgagcttaac gttgtgaagg tgattgatgt tggaacggtg gatgcgtcta agtatccact     35280
     tcctaagact aagttgactc ttgagacttt gagagatgtg cttcatcttc gttctagaac     35340
     taactcggta ttacttctta tctctttcac tgagttgtgt tttgattgtt cctaggtttg     35400
     aatcaaagaa tagttgattt atggtgatat ttgcctgtga tttcagatct cagctgttgc     35460
     aagaattcgt aatgctcttg cttttgcgac tcacagtttc tttcaagagc atagtttcct     35520
     ttacattcac actcctatca tcacgacaag tgattgtgaa ggtgctggtg aaatgttcca     35580
     agcaacaact ttgatcaatt acactgagag gttggagcag gatctcattg ataaccctcc     35640
     gcctactgag gctgatgttg aagctgcgag gctcattgtc attgagagag gtaatgttgt     35700
     agcggaactg aaagctgcca aagcaagcaa ggaagcgatc actgctgctg ttgctgaact     35760
     taaaatagca aaggagactt ttgctcatat tgatgagagg tcgaggctta gacctggact     35820
     acctaagaaa gatggaaaca ttgattattc caaggatttc tttggtcgtc aagctttctt     35880
     gacagtttcc ggtcaattac aagtggagac ctatgcttgt gctcttagca atgtgtatac     35940
     atttggcccg actttccggg cagagaactc tcacacttca aggcatcttg ctgaattctg     36000
     gatggttgag cctgagattg cttttgcaga tctagaggta ataaacatac gatattcttt     36060
     ggttttcttc tttatcgtta atgtagactc agtatcttaa aaaccttctt ttaaatttgt     36120
     gcaggacgac atgaactgtg cagaggcgta tgtgaaatac atgtgcaact ggttgcttga     36180
     gaaatgttac gctgacatgg aacttatggc taagaatttc gactcaggat gcattgacag     36240
     gctaaaattg gttgcctcta ctccgtttgg gcgtataaca tacactaaag caatagagct     36300
     acttgaggaa gctgtggcta aaggaaagga atttgataac aatgtggagt ggggaatcga     36360
     cttagcctcg gagcatgaaa ggtttgtgat aacccttaag aaccattcct cagctttaaa     36420
     cagttttaag aaatggttgc taatgaaaca tgtcttgcaa ttacagatac ttgacagagg     36480
     ttctgtttca aaagccactt attgtctata actacccgaa aggaatcaaa gctttttaca     36540
     tgagacttaa cgatgatgag aagacagttg ctgccatgga tgtcctcgtt ccaaaggtaa     36600
     tattaaaact caaagttgaa tgcatttcct ttatttgtgt gtgattaatc atcgaagaaa     36660
     cacaacaacg gcctctttcc ttacccttat ctctgtataa attaggttgg agaactcatt     36720
     ggtggaagcc aaagggaaga acgatatgat gtcatcaaaa agaggtgtgt gaaagtgaaa     36780
     ccaatattca atttttggct taattttttt ttgttttggt tcttttgtga accttatgaa     36840
     gcaaaatctt gtgtttgaac aggattgagg agatgggtct tccaatagag ccatatgagt     36900
     ggtacctaga cttgcgccgt tatggaacag tgaagcattg tgggtttgga cttggcttcg     36960
     aacgtatgat tctcttcgct actggacttg ataacatcag agacgttatt cctttccctc     37020
     gctatcctgg aaaagctgat ctttgattcc tcttctttac accatttaca tacacaattt     37080
     cgcttttatt agctggtctg gtttccataa ccgacttggt ttagtttact ttttaagttg     37140
     gttaaaggaa aattgtattg acttttgatt ttttatctct atggatctgg ttttgttcgg     37200
     ttatcccgat ttggctattg aatgatagga gaaccaattt gagatatacc acaaacatat     37260
     aggagaacca atttgagata taccacaaac atataggaga accaatttga ggtataccac     37320
     taaccgttgt tagttgttac tgttcacatt tttatccgga tttggataaa tctctttggc     37380
     ttgttggaag ttctttttga aaaatgcata ttattacata ccttcgaagt tcgaaactga     37440
     cttcaaaact gcagctagaa ctttagtatc ccttgaaacc aaaatgcaat gaaaaaaaaa     37500
     actgaagaac gctaagaatg tgtaatcgaa acatagagat taacaacaat gtaccttgag     37560
     cccaaatagc agagccatga agacgatgaa gaatgttacg agaacaagca agtgatctca     37620
     gctgattcgt tgaattctac aattttctct atcgatctcc attgtagcaa attaattact     37680
     ttctccagag taagtgtttt aggaattaag cgtcttcttc tctctctcta tcttagcttc     37740
     aaatctctaa agactaaaac cctgattcgg ctcggcctaa tataaacggg tcgttaattt     37800
     caataatggg ttgaactatt tgaagtctga cttaggcccg gcccactaga gatattgata     37860
     gttacttgcg ttttaggatt tgctagggtt atttaggggt ttgtctttgt tgctcttttt     37920
     gaaagctatg gctgaaatca gcgggctgcc tgatgacttg ctggtgaaga tactagcgtt     37980
     tcttccaaca aaagttgcta tatcaactag cgttttgtca aaacaatggc ggtttctttg     38040
     gatgtggttg cctaaactta agtacgatga ttacgatgac attactgatg gtttcaattc     38100
     cgtgtctgca ttccagacat atcgggattt tattgccaag aatttgccat tacacagagc     38160
     tcccatcata gaaagtttga gcctcggatt tcgttgtgga acacttcaac ctgaggattt     38220
     gaaatcgtgg gttgaagttg cagtttctcg tagtgtgcgt gagctaagta tccttgcata     38280
     ttataggaat aattatgcat tatcgtcgtc tagtttgtat acctgcaaat cgctcgtgac     38340
     tttgaaaggc tttaacattc gtgtggatgt tcctccaaca gtttgtctcc tgccttcctt     38400
     gagaactttg gaacttaaac gtgtgagata cttaaacgaa gattctcttc gaatgctcct     38460
     atccttttgc cctgttctgg aatatctaag tatagaacga cacgataatg acaatttgag     38520
     agggttagtt gttgatgtcc cgtccttgcg gcgtttatct ttaacttcat atactggatg     38580
     ttcttctgac gattatgtaa tagttacacc ttctttgaag tatttcaaag cttttgatta     38640
     cagaagtgaa atttcctcct ataagattga gaaaattcca gagcttgaag aggcagatat     38700
     cagtattgag cgaaatcccg agaagctttt cgtatatttc aaatctatca aatgtctttc     38760
     attacaagta gacttcaaca gcaaggaaga ggtaatcttt ttgcatctat aaactatcca     38820
     gttttcaaat ttgcattata tttacttata acactaaatt tgttgcattt tcacgtgtat     38880
     agcccgggta tgattctggt attgtcttca atcatcttga agaactgacg ccatatataa     38940
     acgacgctaa ttggtccaag ttacttttcc ggttgctcaa tgattcacct aaactccgag     39000
     tcctcgaaat cagcaactcc aagtcatttg taagtttttt tttgcaagat ctgatatatg     39060
     gtgtgatctc aactctgttt tttcattttt tttaatttaa tttcagtata aagaaaaaat     39120
     tggggagtat ctaccggtta gctggagcaa aaatcaggga tccgttccta aatgtttctt     39180
     gaatagtcta gaaactttca gggttaaatg gtactacagc gaggagcaag aagataggga     39240
     tttcttgagt cttatcttca aacatgctcg atgtctgaaa tctacatcaa tcctgcacag     39300
     atgatgttat gttctccaca actgaaactt gaaaatgatc tatgagtcgt cgtatttgtt     39360
     ttgttatcca agaacacttg ggtttttatt tgaatgtggt acttgtttaa gaactgaact     39420
     tgcatgtttt agatcattcg tctcctccat ataatagacg acatcttgta tcatttaata     39480
     ctcagattca gcttgatcat cccaagattc aatcattaag aagaaaatgg tctcttcaat     39540
     aaaatagggt ttttagtccc catagccttc cctgcaaact tcctgatctt agctccttaa     39600
     aaggcatttg gtgcattctt cttaaaggtg ccattacaat ttacaagttc attatgcata     39660
     agtaggttct tttttttttc cataagtagg ttcttaatct cattgaacca aacccacctg     39720
     aaaatacatt ccaaaactga acctaatctt aatttgtatt tggagtttac aaaagtacac     39780
     taattcagaa gtttgctgtg tatggatttt acaaaaaaat ctcaactaca ataaggacct     39840
     taaaatatac acatgcactc aaaaagagtt tgacatgacg actggcccag tagcaggccc     39900
     ctcagatatt tatgtttatt aaaccatttg atgggcctat aagtggaagc caaacggtct     39960
     gatgagtggt ggtgactggt gactggttcc cgagcagaag tcgagattcc acacgaaaaa     40020
     ctcatcacct gaaatttcta ggtttgttat tctgttcctt acttcattat cttcacttgt     40080
     tttgtaattt gttgagttgg attcagacaa atcatttagt cttaggtttt gtttcatgtg     40140
     attctttttt tccagggtcg gaaaacccca aatttgtctt gagtcttcga gtgatatggc     40200
     taaaatcagt gacttgtctg atgaattact ggtgaagata ttatcgtttc ttccaacaaa     40260
     agaagcagta tcaactagtg tttgtcgaaa caatgggagt ttctttggat gtggttgtcc     40320
     aaactcgagt tctactttag tgatggttca gagtctgcat gcctgaggga ttttattgcc     40380
     aagaatctgc cattacacaa agctccaatc atagaaagcc tgcgtttttg ctcttttttt     40440
     ggatcacttc aacctaagga tttgaaatcg tgggttagaa ttgcagtttc tcgctgtgtg     40500
     cgtgagctaa gcatcagttt acatgatacg acagctgctg tatcattgcc cagtagtttg     40560
     tatacctgca aatcgctcgt gactttgaaa ctttacggta agaaggttct tttggatgtt     40620
     cctcgaacgg tattcctccc ttccttgaaa actttgcaac ttgaacgttt gagatactca     40680
     gatgaagatt ctcttcgcct gcttctatcc tactgccctg ttctggaaga tctgagtatt     40740
     gtacgagaag actatgacaa tttgagagcg ttagttgtta ttgtcccatc cttgcagcgt     40800
     ttatccttag agatacctgg taattgttct tctgatgggt atgtgatagt tactccttct     40860
     ttgaagtatt tcaaagttgt ggattataga gaaagtatgt cctatttgat tgagcaaatg     40920
     ccagagctgg aagaggcaga tattgttgtt ctgcagtatc ccgagaagct tctcgaatca     40980
     gttacatttt tcaaacgcct ttctatacgc gtaatattca acacttatac agaggtcatc     41040
     tgctttcatg tcatgtttcc tacctcatat tttttactta aagacacaaa atcggatttc     41100
     ttgagcttga atcctttttt attgtgttgt catgtgtgca gactgtgtat cgtgatggaa     41160
     tagtcttcaa tcggcttgaa aatttgaagc tatgtatatg caatggtgat tggtccaagt     41220
     tacttatcca gtttctcaaa gactcaccta acctgcgagt cctcaatctc ctcgttgatg     41280
     atgtaagttt cttcgtcgac tattttgtag tctaaattca cactatagtg tagtattcta     41340
     acctttactt tttcttttta atcttagtat ccgtcaagtt tgggggatta tgaaccggtt     41400
     cgctggaaaa ataataagag ctccgtcccg aaatgtttgt tggagagtct tgaaactttt     41460
     gagtttgcag gttacatagg aacacctgaa gagagggatt tcttgagtta tatcttcaaa     41520
     catgctcgtt gcttgaaatc ttcatcaatc ttaagcagac cagaacggta tcatggaatt     41580
     tgagttttat gagatatgct tcacaataga aacttgaaaa tgatctaaga gtatggtttt     41640
     ttgtatttct tcttcgaatg tgggaacttg ttttcgaaca atctatcgtc tggcttttat     41700
     gtggtaaact acaatctgta tgtctctgcc ttatggcctt gtaaactact agttcggaag     41760
     ctcagtcaaa tagtctcatg cctgtttaag aagctacgat tacacagatc cgagcatgaa     41820
     agtagcgaag gtgaacacag ctgtacttct cagcgcaaga catcttatca acagctcttg     41880
     attcaaagtt aaacctagtt gatttatttt ttttgtcaaa aaaaagtaaa aaataaaaaa     41940
     taatttggac gacatctagc ataattttat acacagatca ttcctacgat ctactttgtg     42000
     taaatgtgag attcgacaat taacaagcat aaagaaaatt ccaaagcaaa acaagagtca     42060
     atcatgaaga agaaaatggg tctcttcaat aaactgcata agtaaattca agatgcacta     42120
     caatgaagaa agtgaaaggt caagactttt aattgaaaca cagcaacaaa agtaaaaaac     42180
     caaacaaaac ttgttctact gattctctta atcctcctct tcgatgacct ttgtgccaag     42240
     accactgagt ccttctgcag ggatttcagc aacagtgaca agggagaaga actcttcctt     42300
     cgcatcttca tcgtcgtttc tcttacgtgc aacacgaacc ctgatcctcc ttggtggacc     42360
     tctgattccc ttgctccaga tttgcttgtt caatttcacg tctaccctaa cgtccttagt     42420
     ccccatagct ttctctgcga acttcctgat ttccttgatg gctttcggtg ccttcttctt     42480
     aaaggtgctg ttacaaacca ataatacata agtagagata cttaatcaca taaaaccaaa     42540
     cccaccaaaa aaccacattc cacaaaccaa actctaatct taattctctt ttacaagata     42600
     tatcaaatga actataccct ttcatttcaa gactaatttc gatagtaaat ccaaaaaaca     42660
     atcagtacaa atttttactt taagtaacaa aacacacttg atacgatttt tcaaaacaat     42720
     agataccatt tccccatgaa ttcaataaca ccatgaattt caaaagatca gattctctgg     42780
     actaaacgtc tgattacatt tagaaaaaga ttagctaact taatttcatt acaaccctat     42840
     gatattaacc aacaagcagc tcaaaacatg aacacaaaga gtgaaatctt accatttgtg     42900
     aaggcgtctg tggaggttaa tggtgtactc tctggtaatc acttcctctt tccttccctt     42960
     tttctcagac atcttctctt tctctgtgac ttacttcttc aaactcttta cctgcgatta     43020
     cccattacaa aaaaccactt caaaatcgat tcttttcacc ggaaatcaaa cagatctgtt     43080
     caaagctagg tcaaggacac agaattgagc tagattgaga aagagagaga gagagtagta     43140
     cctttcgatt gaagaacgcc gagagacaga aaggggacga aggaagagaa ctaagcatat     43200
     atatgcggca ctttgagtta accctaaaat aaataaatga ttgggcttta atgggcctat     43260
     tttttgtgct attatgcttg gcatttccct cttacgcttt cttattttag tagcccattt     43320
     acggcccaaa tacatatgaa gtaaatgttt tactcgaatt taaactgatt ggttcgatta     43380
     attaatcacc catgttaacc aacaaaaata aaagtttgag gatctttatt tggctacatt     43440
     tctttttata gattccttgt ttttgttgca tgacttagat tttttgtaag acgaagtttt     43500
     gttaagtatc aggttatgtc ctcttagaag cttttcatag attccttatg tcttcttgat     43560
     tatttttttt ggttttataa attgaacttt ggaatgcatg acattcattc gttgctttat     43620
     tatctttttt acttggaaaa caatggagtt cgttggagaa gaaattaatt atacttttgt     43680
     gattcagaaa gttttggttc tactgttttg tgttggtttg tcatggaaaa tgataatata     43740
     catgtgtaat ttgttaaaca ttgagaaaga tcctataagg gttttgatta ccggtgcagc     43800
     aggtaagaac tcaaacaaaa aacgatccgg tttatgtttt gatttataat tctatcaatt     43860
     tatttggttt ggttcagtgt ttttttattg gagtctttta tctactactc cctaccttta     43920
     tggtcgtttg ttcttaattt aattgagaac tttctattga acaggaaaca taggatatgc     43980
     aattgctcca atgattgcaa gaggtattat gctaggtcca gatcaaccca tgattctgca     44040
     tttacttgat atagagccag cttcaagttc actagaagct gtgaaaatgg agcttcaaga     44100
     ttcagctttc cctcttctca aaggcgttat cgcgacaaca aatgttgttg aagcatgtaa     44160
     agatgtgaat atcgtgataa tgatcggcgg attcccaagg atagcaggca tggaaagaaa     44220
     agatgtgatg tcgaaaaatg ttgtgatata taaagctcaa gcttcggctt tagagcgtta     44280
     tgcatcagat gattgcaagg ttcttgttgt cgcaaaccct gcaaacacta atgctctgat     44340
     cttaaaagag tttgcgccat caatcccgga agaaaatatc acttgcctga cacgactcga     44400
     ccataatcga gctctagctc agcttgcaga taagctaagt gttcccgtga gcagtgtaaa     44460
     gaacgtgatc gtttggggta accattcttc aactcaatat cccgacacca atcacgcaac     44520
     agtctctaca aaaactggag acagaccgtt aaaagaacta gtcacagatc acaactggct     44580
     gaagaacgag tttatcgtgg aagttcagca acgcggtgca gctgttttaa gagcacggaa     44640
     acagtcgagt gctttttccg ctgctggtgc agcttgtgac catatccgtg attggtttct     44700
     tggaacccct aaaggaactt gggtttctat gggtgtttgt tctgacggct catatggtat     44760
     accacctggt ttggtttact cgtttccggt tatctgtgag aaagggagtt ggaagatcgt     44820
     acaaggactc agtatagacg agttttcgag ggagaaaatg gatgactctg cacgagagct     44880
     agctgaagag aaggatttag cttattcctg tctcaatgta tagaccaaaa gttgaaaact     44940
     atgatagtca tggcacaaac aatgtagcaa acaaataagt ttgtgtttct atattcatga     45000
     aaaataatgg gaacttacat aataaacgct gaggttcaca gatacattta aaaactctga     45060
     aatcttgggg ttaaataatc agaaaattga aagaaagaga gttcatactt ctacttgcga     45120
     gagtatctcc agatgccaaa aacaacaaca cccaatcccg caatgccagc caaaatctag     45180
     taaccaaaga tccaaattca tatcttagtg attgcaatgt tacatttacg gagacaagac     45240
     aaagaacaga tgaacactga ccttggtatc acggatataa gggccctcgg atcgtgaact     45300
     aaagatagat gaaagaaatc caaaacgaga tctctgcggc atgagaataa cagcagtgta     45360
     ctgtttcttg cacgggtgag gaaggattcg ctgtaatgca gcttgtgctg tttgtggtgc     45420
     aagtgactct ctcattcgca aacgcccttc ttctaaaatc taaaaaccac agagaagttt     45480
     cttccctttt cgtaagactg tgtttataaa aaatgatcaa agtattgaca aaaaatgttt     45540
     tctaaactga ccttgcaaga ggcgcccaaa tcgccagcgt aaacccttga ttgatatcca     45600
     cgtataatcc tgtctaacca gtaatagttt tcctgacaag aacaaaatta aatcagtttt     45660
     gtttctgcag caaattatgg ttttttggct gtgatggatt tgtgatgatt atggcaataa     45720
     aaaatacctg catgccattt tcatgagctc tttgttcgat ttcaaggata gctgaaatgt     45780
     cttcctgtga agggccttcc ttttgaagcc gtacaatttc ttctaaagct aaatcaacct     45840
     gaaggacaca gaggtggctt tggtgaccaa caggcagcca aagatataga gaaacccgtc     45900
     agatagtgtt agaagatgga cataccagtt tagaggagat ttctggatca catgaaaaat     45960
     taacactgat gtcaccacgt aaatccgcag ttctagaagg tttattcccg ccaagaaaca     46020
     cagagacttc agcagaataa atctgtttaa taggaaagta aggtcattaa aggtttggta     46080
     tgatcatcat agaaactgac acaaagagca gaatatacct gcccgtgctc gaacctgaga     46140
     aactggatta tcttggtctc taggagtttg cctaaaaagc cgatacagtg gatttcttcg     46200
     atctatcata agtttaatgg tatgaagcaa attcatttag acatcttcgt agtaatgaaa     46260
     agaagaaaat atcattagtc tgtaagttat ggttcagatg atgaagcaga gtcacttacc     46320
     attgttccat ttgttaactg gacaggaaag cataactgga ctgaacactg ggcttccacc     46380
     attggacttc gtacaaattc tctgcaatat tgcgcattta gagtcattat gtaataatca     46440
     agggaagtac acagtatcac agtctctgat tggtcgctgt acgaacattt ctatcagaat     46500
     tctgaaactt ctaaccaggg ccaatatttt cagaatttaa cttttacatt tggattttga     46560
     tttaactgca acagtttgcc aaacttttac tcaatagttt ggaaaaccat ataaatttat     46620
     acagtgatga tactgaagcc aaacgaaaat caactatgtt gttgaactta gataatgaca     46680
     agatcagtat acagcttact ttgttatctt tgtagggaaa gtgaatggta agcccttgag     46740
     gtcatcacgg ttgaagttga gaactggttg aggaggctta ggtattccgc cctgcataaa     46800
     gcgaacgcaa gaatgtagtc aattattccg agcttacttt tttgtatcac cagtgatgtg     46860
     atctaactta ccagatactg aagaattaga ggaagcgcga tagtaggatc aaggttccct     46920
     acaatcacaa ctgtgaaagt tgatggatcc ctaaagcaac tgttgaagta ttcgcatgcc     46980
     ttcaacgggt caacttttct gagttcacta atccgaatag gctacacatc agagactagg     47040
     ggttagaatc agctgggcgt tcaccaagaa ataattagtc attttgaaga tagatatcat     47100
     taccctaaag aaatatgaat ttccataatt cagttctttc actctgttag caaagacagt     47160
     ataagggtct ctttctcgag cacggactga ttcttcagcc atttgcatca ctattccaac     47220
     ctcttcttct tgtggcatca cgtttgtagt gaaaagttga tatacaagct ggaaagaacg     47280
     tataataagg ttcagttata aggacaggat aatgaaagtt ccatctaaag agagtcaaaa     47340
     cattattaga tgaaaaggag aaaaaatgca aaacagttta tggatgcaca cggaatgttt     47400
     gtcaatacat tcaatctcca tcattaagat gttagcaaat acgttaatga agtctactgc     47460
     ttggtttcag ccaaatacac tatggttaat gaaatgtact gaagaacaaa ccagagaggt     47520
     tatgattaat gaagtctact gctaggtttc agctatatat gtcagaaaaa gcccgagatc     47580
     aacctagaag aacttaggaa atgaacgtgt aattgcagta ggaagaaggc gaacctgcaa     47640
     agcagtttca aggtctgtgg gtgaacaatc acaagaaaac gttctcatat aaggtccaag     47700
     tcttgcacta acttcgactc tcttaccagc aagcatatcc ataagtactg atggcttata     47760
     accaaacata ccaatttcac cagcaattgt tgatcccatt gaacatgaaa tgtaatcact     47820
     ctcggggagt tcagatagtc ctccatatga gaacccggta aaaagaacct gtcagagaaa     47880
     aaggacaatc atgaagtgac gagctttaat ccattgccct atatagaagc ttatacacaa     47940
     gcatatcaaa ttattgtagc tctcagttaa tattgcacct gatcgtccaa gaagtctgtg     48000
     gacttgtagc aaacttgcat tccatttgat aatgtcaatt ctgtaactcc aacttctgga     48060
     tattcaagct ggtgcgtaat atcccttcat tgaacattag taacagatga gaaataagaa     48120
     atgtaaaaac atacgcacgt cagttgagct ctgcctactt ttagttttta aaaagagcca     48180
     ttttagttca ctaaaagact tcctaactag tcagtttcta taagaaatag ataataaaac     48240
     aaaggtattt acttttgaag atctatactc ggcccagagc cccagacaat ctctgaaacc     48300
     taaagtcaat agaaccaata tctaaaagta atgaggctat taagagtggg tgaccttggc     48360
     ctttgcttgt cagtgaacct atagttacag ttcggggctt accctggagt tggcttctca     48420
     ctgacaattt cttctggaat gttttcctca tcccatggag caatcatctt ttcttcttcc     48480
     agactattaa cctttgagac aacatttctc atatgatcaa tagtagcagc agatttaggt     48540
     tccattgatt ttatcacaca gccgcatgat gttcttaact tttcagagta tctggacaca     48600
     tctgacgccg atatttctgc atcagagaga acccaatata atttatacga gtttaatagt     48660
     gaaaatggaa ctcgactaca ttataagaag cgtatgcatg ttctcacggg gtagaagagt     48720
     cttctgaagt tgtgcttcgt attcaatccc aataacaggt tccttgtgaa ggaaatgctg     48780
     caagatgaaa cacatatata aacaagattt tggtagaggg ggaagacaaa aagctggata     48840
     ttaaagttca tcacatattt tacctgtata tattcatccc gcaagctagt tgattggacc     48900
     tgatcgcgtt ccagataagc agattcaatc tcggacatca tgagagcccg aacaacagat     48960
     atttcacgct ctgagaaccc atgaaggcgt accctagcaa cctaaaacac gagaaccaat     49020
     gaaggggcgg gacaagggag tgacaaagac ttggacaaga gggaaaggag aagagacctc     49080
     gagaagcata gactctaggg atgcaagagt tcctttctct ttacaagacg aactcattat     49140
     ataggccttc aaagggctca ccaggacatc agcagcaaca gaacacgcaa aaaatggagg     49200
     gtccttccta cgagatattt tgaagagtct ctggtttaga gcatgtagaa acattgattc     49260
     tgcaagcata tccctataat ctttcactgt cttcagatca cttacaggca tcttatagct     49320
     gatcattact gcagactaca agaaaaaaaa acacaaaaga agcttaggag ttgacatcgg     49380
     gataatacag gaagacgttt ggagagttaa atttgactta ccccagctgc ctctgactca     49440
     acaaagcaag aaaaccgcgt ctcttcatga gaaggaacag gaaacactgg tatctgtgga     49500
     ggctcgctac ttgatctttt atcctcaaaa tgtgtcttta tcaaatcaac tacagtctag     49560
     aaacaaggat tatcaacaaa ctctaacagt acaacataat catagtcata aactaaaata     49620
     gtagtacctt tgtatctgga aaatctccaa cagccacaac tgccatattg cataaatgat     49680
     accacttctg gtaaaattgc ttcacagttg cagcaggaac agatcgaatc actttctcca     49740
     acccaatggg taaacgttca gcatactgca gttaaatgaa agtctttttt aagaaaacat     49800
     tggcctctct cttaaactag acaactgatt aacaaaagac ctcacatacc tttgaacctt     49860
     ccatcatcag ctgccaatgt gaatcttgca tccttccagt agcattccga ttccctcggt     49920
     attcttccat aacagcccct ctttctttct ctaaatcttc ctttgagact cgaatctaaa     49980
     aacaccgtgt aactaatttc ttatggaaag aaaaaaataa agtaacaaaa aggaggagac     50040
     agagtcacag agacattacc tcggagctaa actctgctaa aatggaaata gcctgagata     50100
     acaattcagg cttatcaaca gggacaaaca attcataaat agtctcatcc gctgtagtca     50160
     ttgcgttttg acagggccca aactctgctc caatgctctc taagaacttg acaatatcat     50220
     gatttgtata tctcgttgta gcactaaatg caagatgctc tactatatga gcaactccac     50280
     gctgatcctc ctcttccaaa actgaactgc caataaacca aaaggtgtgt cagcatcatt     50340
     tatagcgcac aattctgtat tatcgaatat atcaatgcat gtcacaaatc tattcataaa     50400
     agataacaag aagaatcatt aatcaaatca aagttggatc aacactgaag agtgaccaaa     50460
     taaatcaaca ttcgactcaa tttccagtaa tttcaattca taagttcaat tcaattcaaa     50520
     ttgaaaccaa atgtggccaa aataaaaaaa gaagaagaag acatacccga ctttaacggc     50580
     gagagctaga gcggctctca ttcttggttt ggagttccgg cgaacatagt agatgagacc     50640
     attatcgagt cttccataat cagccccgaa tggctcaagc tcgttaccga gttcttgttc     50700
     catgtccaca ctcatcagtt tcagcgacct gaaaccttgt ttcctcaaca ccttcgagct     50760
     ctctcccgct atcaaatcca tctctcactc tctctctctc tctctctgcc tcactctgtc     50820
     aaaatcaaat tcgtttatca atagaacacg aaaacaaatt cttctcccta tagagacggc     50880
     acaaaagtcc cacccttcga gatttgttct tcttatgttt gtttttttgc cttgactagt     50940
     atctttctcg gtttgcccgg tatatttggt tcaaccagcg tcggtttata tcaagttttt     51000
     gctaaaattc aatcggaata ttccaattta tggttctgga tgtgacaaca aacatcataa     51060
     ccggaactac attagtttac tcaacttcca taacatagcg ctacaaacag atttgtcctt     51120
     actccttaca gaagatcaac aaagtttgag atttctagtt tgatcattca acaaaaaact     51180
     tccgataaaa gactcacaaa gttttgattc caatcagact tttagcgttt gaccactctt     51240
     ggagactttc tcagcaacca acttgatctc acgaatcctt tcctcaacaa gttgcttcag     51300
     ctgctgctct tgatccggtt tgttttcatc aacttgaaca ttggtattag cctcttctcc     51360
     gtttacagac ttgaaaacca caaacgatgc ttctggctcg aaagagcttg gaacatcaac     51420
     gacttgtttc tttggagttt ctatatcttt tcccagaatg tcggttctca catggttcgt     51480
     gatgactgat gtgtaatctt ccatgtactt gtcaatagga tcaagagcaa ggtatatcaa     51540
     aatctcccag catttgagga actgtttctt gttgatcttc agagattcgc ggactttctc     51600
     aatggcgttc agaggcgggg tgaatcgagg tatctgagct ttctttgata gctttccttt     51660
     tgtgagagtc tgaacagctg aatcaatgtc tggtttgatt ggatcgaaac tgcgcaagcg     51720
     gtttatgtct atgcaagtgc ggatgtgttg gaacttttca gatggctcct caactgtcaa     51780
     atcgtaaacg ttttctgtta tggccacgtt gtttactacc tccataagat agcttccgag     51840
     tccttttcct tggaaggatg gtaagaccaa gatctgaaat caaaacaacg aatcagcaaa     51900
     aacagtcaga tcaaaaagat tgtaagtagg attgagatct ctgaggaata tatttaatac     51960
     ctggctgagt cgcatccgca gcctgtcagg ataacgatag aacttataaa ttgcggtaaa     52020
     gcccacaatt cgatacaaag gatcttcttt ttcctctttc ttctggatta agagatataa     52080
     atgccagtca ggatcagtga catcaatcgg attgctgcct gatcaaaaga atgagccggc     52140
     atctcgttag tactaagtta ctaacaagag aaataaaata ttcaagatga cttaaagggt     52200
     aggtgggtta ttaccatcga caaaaagaag aacaaggggt accaatcggc tatagaggag     52260
     tccagcattt ggagaaccaa tttccatccg tataacctga ggataatcaa cctttataag     52320
     ttctatttga agctgaaaac atctcaaact aatttgctca aacttattaa gactatagga     52380
     tacatgaatc atattaagca aaaactacct ggggatcaga aggaaccact tcagcattct     52440
     tgctgcttcc atctgttgct ccagcatgca ttacctctcc attcgagacc atatttctag     52500
     aacaacaatc aatgacaaag ttcaacatta tattcagaga ctacaaagag atctatcgta     52560
     attaagttgg gaacaaattt gagatggtat gaaagcaacc agaaggtatg cagttatgca     52620
     cctgataaaa tctctctgtg tcgaaaaggt ttgcagaaac tcatccttgg tatcaacaat     52680
     ggtctcagca aatatgttct gggtgggtga aatgaaacag acaatcagaa taatataatg     52740
     agagcaaaag aagcatgtgt ccaagttgat tggtacctgt aaagcagatt tgaggtccgt     52800
     gatgcctttg tctcccttca aacacacaac agaaagtaac aggatagtga tgattagtcc     52860
     ctttaaaagc cgtataaaac caatccaacg aatagcaaat acaatcaaca cttacgttaa     52920
     tggtgctctg gtatgtgata tcagcatatg aatgtaatga gatgctattg atccatacat     52980
     ttatctgaca tcaataaatt gtggacaaga atatgtcaga acagaaccac aacaatgcga     53040
     aaccagaaat ttaagaaaga gcaaaataat ctaatggtag gaggccacat taccttcaaa     53100
     ccttggtaac cataaatctt gccatctcca tcaaagaaat cattcaagtc aactggcttc     53160
     acgctggaaa tatcagagga atcaacttcc tctttgcttg aaactagaac atcacccatc     53220
     acgattacca aaacagaaaa caaaattatg tcacagcaac ctaagacact tcacacagaa     53280
     aatactttta caactcattg aacaaatatc aattggaaga aagataaaac acataaatca     53340
     acagaaactc agtatacaga tctgctctac atgttcaata actgaaaact accttttgaa     53400
     agcaataaag ttcgccggaa aagccaaaaa ctagaaaaat tgaagtaagg ccaactaatt     53460
     tcaccaaaaa ggtcgaaagc aggaaacgta accctaattt tcgtacgaaa ctatatcccc     53520
     aaaatcaact tcaaatgatt taaatcaaat acgcaccgag ataaattttg atgcactcgt     53580
     tagcctcgac accagtatct gcacataaga aaaatcaacg gattaaagaa aaatacgaaa     53640
     tcggagctgg gaaagtggta atcgcgagta aaggaaaaca aacaagaaga agaaatgact     53700
     caccggcggg agaaaatccg acacggcgac gcttcttagg ctcggtaccc ggaccggcgg     53760
     aggcttgctg cttctgaacc atggagtccc cggcgagtgc aaggcgggaa gagagtgaga     53820
     caaaggcggg aaaattggag ggttaatgga aatgcggaga gagcgataca caagagagtc     53880
     agtaagcttg tggctctctt tatgtaattt ttactgagat caatagcaga tggagaaata     53940
     cacaccacat atgacttagc aaggcctgtt aacggcccaa atgcaagacc aattcaagtt     54000
     tgtattatta ggtattattt atctaattaa cgaaatatca aatgagggcg tttggtctag     54060
     tggtatgatt ctcgctttgg gtgcgagagg tcccgagttc gattctcgga acgccccatt     54120
     tgtatttttt atgttcacac tctttttgcc actctttttg ccaaatagtc catttttccc     54180
     aaaagatcca taactttaag aacatgtaat cattaaccaa agttagttat tcttggtgaa     54240
     tctagttgac tttgggagag gagaaagaac cgattttagt tattcttccc cattattgaa     54300
     gtctagttct cggccaaata ttcaacaaca aaaaattgac tattgtgaaa attaggcttg     54360
     ttttgaaata ggtctaactt aagatattaa ccataaattc ggttattgta ttgttgtttg     54420
     gtacaatgta aaccggttac taaaccggaa cactctacat ataaagagtg tttcatgtaa     54480
     cagaacaatt aagaagaata acaaattttt ctcatcttct tcatttctct gaattcgttc     54540
     atcaactatt atggtatcag agtgatggat ctcgaagatt catccgattc aacctaaact     54600
     ctgagtatct tcgagctctt ggatcttcca aactcgttga ttctttgttt cttcaatttt     54660
     ctacgttttc tggaaaattt cagttgttta gagcttcgtt gatcttgcga tggtttccgt     54720
     agagaaattg cggcgtcgta ctagaagatc gagcaaaact tcagctgaga aaactccaga     54780
     tcgtgttcaa gcttcaccga ttccaccgat tccaccaatt tcgaatccgt ttcaacaaaa     54840
     tttcaattca aaaccatcga tctatccttt accacagttc gacttctcgg atgctcatta     54900
     ttcgccattc gcgctctcaa atggtgagtc ctgggaatac acttgtttct gaggtacttg     54960
     atggatctaa tttctcttct tggaagattg cgatgtttgt ttctttgaac gttaagaata     55020
     agattgcttt tgttgatgga actttaccaa gacctcctga atctgatcct agctttagag     55080
     tgtggtcacg atgcaacagt atggttaaat ctaggatcct taattctgtt acaaagcaga     55140
     tctataagag tatacttcgt ttcaatgatg ctgcagagat ctggaaagac ttggatacta     55200
     gatttcacat tacgaatttg ccaaggtctt atcagctaac tcagcagatt tggtcacttc     55260
     aaagttttgc tttcaatgat atctctttct caccttcgac tttatggtta ctatgttctc     55320
     taacgtcctc tagacaagtg ttatcacaaa atacatggat catagatagt ggtgttactc     55380
     atcatgtttc ttatgatagg aatatgtttg aaagcctatc tgatggttta agattagtcc     55440
     atttctaatt ttctactaag atatattttt tccaactcaa agtgaaaaaa ttgcgaatag     55500
     tataaatata caattgttta ttaaatattg atgttcttaa tattattaca taaaaataat     55560
     tttttatatg taatagtatt tttagaaaat ttggtttctc tttttttttt taataataaa     55620
     actaaacagt ctctaaaaat ttatattcgg tttgcttaat gttaattttg ttgttaacca     55680
     aaacttcgca cctcccttac ttatccaatt atcaacattt aatatttgtt tacatttata     55740
     caattatcca atttatttac agcaattttt ccgaattagt attcgactgt tattggtgaa     55800
     attcgagctg gttaataata tttatcaaaa ataagtttct ataaataaat caaattaaaa     55860
     atgtttctta ttttaagttt tttgaccgtt cgcgtgtcat gttacgacta ccggcgtcta     55920
     tggagaaatc accgcaaaat ttatagagag agtaaaacga aagagaagaa aaaaaggaaa     55980
     acgaaaaaaa aacgtttctt tttccagaga ggtcttaaga gagaggagag agaaaaggca     56040
     tcgctttgta tataagctaa agaaaagcca aaaaacaatc tagaggttgg gagaagaaga     56100
     agaagaaaag agaagaagct cttgttatcc cggcgttctt aaaacaacga cggcgacggt     56160
     gacggctaag cggaagagct tttgttgcca atgacggact cttacggcgc cgtctccgtc     56220
     gacgttggaa caatctatct tggtggcaag gtttcattct ttaacctttg aactcggatc     56280
     cgaataaagc tttgattttt gtttctgggt ttatcttaaa cttgcttaaa tctaatcttt     56340
     ctgttgattt ggggaagaac agacatgtgg gcattgttag attcatttgt ttttgtaaaa     56400
     aaaagactca tcttttgttt gaatcaaatg ttcttggaga aattctttgc ttgtggattt     56460
     gtgaaacttc ttttattatt atgattcatt tccagatggg attattcttg ggatcttctt     56520
     cttctctcta ttcaaagata tcttcttctt attattattt tgtattcctt attctttgtc     56580
     ttattgcctt ttgatttttt tatcttatag aaaaaagaaa agaaaatgcc agctgttttt     56640
     gtctaccatt aaccttttgt ttaataagac taatgcttct ttattatctc attaagactc     56700
     atattagctc atctttttta aactgtcatt ccctttttat taaaaaaaaa ccacaatgat     56760
     tagaattagg ccatttctct ttggttgttg atgatcaagt ttttggtttt gtttttttgc     56820
     ccttaaaagt agtaaagctg cacatggaaa agctttaaca gagatgtttt cttttttgtg     56880
     tgtgtgttaa tcaaagcatt tcttttccac ctaaagtcag ttgtcatatt cctatcttta     56940
     gtatacattt actaacgaga aaatagattc attgtttaca aacacatgtt ttatgaatat     57000
     ggagtagaca aatggtatgg ttaaaagttt agtttttttc tgttggtttc atgatccgtt     57060
     acttttgtta taacttgttg gtttcttgtg ttcaggagca tcgtgttaaa actgctagtg     57120
     gtgttgtgtc tgtcattgtc tatggagaca gagaaaagcc agcattgatt acttatcctg     57180
     atttagccct aaaccgtaag gctaaagaat ctctataggc actaatgtaa tggctaaatt     57240
     tattaatgtt tttgttgttt cttcttcaga tatgtcatgc ttccaagggt tattcttctg     57300
     tcctgaagca gcttcattgc tgcttcataa cttctgcatt taccatatca gtccacctgg     57360
     gcatgaggtc caatatttta gtttctcttt ttttaacttg ccgtatgctt tgcttgacgt     57420
     gattacttac tcacatgact tctctgtttt cttgcagtta ggagctgctc caatttgtcc     57480
     taatgattca gtcccttctg ctgaaaactt ggcagatcag atccttgaag ttctcaactt     57540
     tttcgggtaa cgatggaatc ccttattttt ggcttattga agttctcaac ttttgttttt     57600
     cgggtaacaa tgtataagct ttttgttcag ccttggtgtt gtgatgtgta tgggagtgac     57660
     tgcaggtgct tatatcctca ccttattcgc ggtatgttcc tatttatttt tctcttctca     57720
     ttgcccattg cttcagaaga atactgtgtt tatcatctct tctatgtttt aaaacttttc     57780
     agatgaaaca tagagaacgg gttcttggtt tgattcttgt ctcaccgtta tgcaaggcgc     57840
     cgtcttggtc tgaatggttt tacaacaagg ttatcacaaa cttgttatat tattacggaa     57900
     tgtgtggagt ggtaaaggaa tttttgcttc agagatattt tagtaaggtg tgttcactgc     57960
     agttaccatt gctctctctc tgcacttgtt gcatttccag acttctctta tttaaaccgg     58020
     ttgcaactgc ttgctacagg aagtccgtgg taacgttgag attccagagt cagatatagc     58080
     acaagcttgc agaagagtca gtgtttatct cttctgttgt ttttctgttt catcaataga     58140
     ttgattttac tgtatcagtg attcacacct tgcacttttg gtgattgtct cagctgcttg     58200
     atgaaagaca aggcataaac gttttgcgat ttcttgacgc cattgaccgg taacacaaca     58260
     aacacctcga aatcctttac cttagaagca ttcattcatt catggtgtca aatattgact     58320
     tttctttaac tttatgcaaa ccaaaccttt gctcttgcag gagacctgac atctcaagtg     58380
     gattgaagaa actaaaatgc aggacactta tcttcatcgg agatcaatct cctttctact     58440
     cagaagctgt tcacatggca gcaactttgg atagaggata ctgtgctttg gttgaggttt     58500
     gagaaaacga atcctcatcc tttgtacttt acatataaac acatgtttgg ttttcttgct     58560
     actaatagat gttttcttgg aaatattatc aggttcaggc ttgtggttca atggtaacag     58620
     aggagcaacc acatgcaatg ttgatcccaa tggaatattt cttgatgggt tacggattat     58680
     acagaccatc tcttttctcc gagagcccta gaagtccact tagcccttct tgtatttcac     58740
     ctgagcttct ctctcctgaa agcatgggat taaagcttaa gcctatcaaa accagaattt     58800
     cggcggctta agtgtgtgtg cactactgat tcattggttc taattttgct gaggagaaga     58860
     aatcttaggg cttttgtaga tatagaacaa tactagggag atttgagaag aagaagacga     58920
     agaagaaaaa ttcaagccac catcatataa cacattcttt tgtagtcagc cgacacgaca     58980
     gttctcttgt taagatgcca caaaatgttg tttattattt cattttttta tacatatgta     59040
     aaatgttctg ttcttgtgac attgtaacaa ttgttttgtg acgaactctg cagaagcaag     59100
     taataaaatt cattttgcat tttgtttttg gttctctaat tggccttaca agcacattga     59160
     tttcaccaag ttagaatctg gtttttgctt aatattgata tttaatggtt taacagtctt     59220
     gatcctgaac tatttggatc atcagattga aactttttag tctgaattga attgtaaatg     59280
     gaaatggaga ccaatccttc tttgcagaag ccgtaagtta tatactgata taagatacgc     59340
     ataaggatta gttgcggttg acgaaaacat agtccctcat gaaccggggt aaaggcgaag     59400
     aatgcttcac ttagtctgaa caagttcaat gctcctcgat gtttgtcaag cccgtaaaat     59460
     ggatgcagac aagtgtaaat ccgagccaaa cccgaataca aagtagaaga agtgtataaa     59520
     ctcttggata actaatgatt gaataataac atcaaattaa ggccatttct tgtattgaac     59580
     atcgtaagat gttttgtaaa ttacaaatac aacaaagctc acttacctca gcacctctct     59640
     ataagcgaat ggtcagaaag tttttcactt tcaaaaccac agaaacaatt ataacaacaa     59700
     ctttatatga tgtaatctga ccattccgag atgaatgaag tatgatccat cgattctcca     59760
     ggacattcct catcatgaat cgttggcttc tctttccctc cgacaagtct cgccggattc     59820
     ccaaccgcag tacctcgaca aggcacgtca atcagcacaa cagaaccagc tcctacttta     59880
     gcacctgcac caatcttcac atttccaaga atagtcgctc cagctccaat caaacaaccg     59940
     tcaccgatct tcggatgtct atctccacaa gctttacctg ttccacctag tgtcacatgg     60000
     tgaaggattg aaacattgtt cccaatcacc gctgtttctc cgactacaac tccggttgcg     60060
     tggtctagaa gtatcccttt tccgatcttc gctgctggat ggatatcaac agcgaataca     60120
     tcggagattc ttgagtgtag agctaatgct aatggcttcc gtgattgtgt ccatagcttg     60180
     tgtgatacac gatgcgccta attcaaattc aacaaagcca aatcatgatc cgaaattcgc     60240
     ataactgaag aatcaaccta acctaaccta aaacaatatt cataaatcaa atcgcaagat     60300
     atagaaattg tggattcatc agatcaaatg atgaagattt cacctgaata gctaagaagc     60360
     ctttgtaatt gaggagacaa tgagagaacg agatacaagc aggatcacga acacgagcag     60420
     cgcgtagatc tgcgacggtg gcgttacgaa gagaaggatc ggaggaaaaa gtgtttaaga     60480
     acagatcgta taaaagtgtg gataaaagcg ttgaggaaca aagcttgttt cctagatgaa     60540
     acgagataga tcgttcaaga gacgaatgag aaagaatcgt cgaatataga tagctagcta     60600
     aagctggctc cgcctcagca tcacggcgag cttccgcctt gatctgtgtc cataatccgg     60660
     cagcttccgc atctgcagct gccgcagata tcgctgctga cgctgcttct gcttcatcgg     60720
     attgggtaac ggaagatagt ttctcctttg atggagattg atgtcggagt tctccggccg     60780
     gtggcatatt aacgcggcga taagattcga tttctatctc ctcctaccta taaaagttaa     60840
     ttttcgagac gctctttaat cgtgcggaaa tttttaaatc catagattaa agacaatgat     60900
     agtccacctg gtgcgtgatt aacgtgattt ttagaaaata aaatcggagc cgtcagtttt     60960
     atgctttatc aataaccgtt agattagatt tatctttccg ttaatcgacg gtggtgattc     61020
     tgccgacatt cttaccaaac tttttccgta acaaattttt gatcaaaaaa aaaaagaaac     61080
     tatacaaatt aactactaac actacaaatt tgaaacgtga ataagtgggt tacaatccaa     61140
     ttaatttagg agaaacaaaa gccatatctt tgacctagtc gatgtaggtt tactccggtt     61200
     aaccaaatgg tctcatcact ttgagtgttg aagtgaggaa agtataatta ctcttctcta     61260
     ctttgatggt aacaacttgg tctcgaatag aaggaactag cacttgtgac tttctcttgc     61320
     tcataaactc ggggtcaccg agcttctgta actcaagatg gcgtcgttcc ccattactgc     61380
     atgtgttcca tgcataatca aaagtgctca aaagcatccc ttctgttgca gcagcttcct     61440
     acttaattag atcccatctg ataaatcacg gtaaagcaga gaaacaatca catgagttag     61500
     gatcaaaggt gtatacgtag cagaccaact agagaagata agaagacatg tatttactgg     61560
     tgcccatcta taaaaaactg agtatccttc cgagaatatg tcctcatata aacccgaggg     61620
     caaatgacca ccgcgtcttc cataatcctg gagtcttgat tttacgtcta cacattgtcc     61680
     gacatataca ccaagaacat tattatcagg atcaaagttt tggccttggt cttgaccgat     61740
     gacgcctaca ccgagctcat acagacccgt acaacgttga gggggtaagt cctcatgtct     61800
     gtatctacgg accctttctt ttctattatt gaaatctttc caatcattgt gtcttataag     61860
     attccgccat ttggagaatg cgatgtcgtg tatagtcagc ttgtagtctt ctctcttgaa     61920
     catagtgggg acggcggaac tgaattcctt tccgatcaat ctggtgatac attatgacca     61980
     ttaatttaaa gcctgaagga ccaataatag taagaaaaaa aacagaggat aaaaatgcaa     62040
     caacattgtg aatagatgag atgataagag acctattgtt caagagctga cttatccccg     62100
     gcataatggt tgtgcttttt tgcgtgctaa tgattgtgtg tcgtatatgg ttaaacttca     62160
     acttcgccat cttcgataat agaacaaacg acattgtcaa acaaaataaa acagaacaaa     62220
     acggttctgc tacagaaaaa taatgaaaga aggcagctct gatatattac gatcgtagat     62280
     atatggaaga agcgaaggga agttgaaaaa gaaatgggtc gtttacagtt tttcgcatca     62340
     tggacaagta acaaagtgga ggcatggcgg gaaacgggtc tatgtatttt taaatctaaa     62400
     aacatctaat gtaatgcaaa gatgcaagtc aacgatgtta atcaaaactg attttaaatt     62460
     tataaaaaat gagattgtga gtcatccagt acagatgatt gttcagcaaa ccaataccga     62520
     aaccaaaacg gttttggtac aaacaattct ggttaggtaa caaataacat aaacaagtga     62580
     tgcagaggtt aggtgattct cattccctta tgctcttcac atctcttacg tccttttacc     62640
     ggagatctct cacagatcaa tccattgcct aatttaactc cacaagctac gttttttgct     62700
     gcctctggct gaaaatatac cggcgaagta tcgctggaag ttttctcctt atgttgccaa     62760
     caccttttgc ttcctttagg agaacttctt gtgcaaggta acccattctt tgttgtagct     62820
     tcacagaagc gagtcaaagc ttcttcttcg attgactcgg tatgcgattc gggatcaggt     62880
     ttctcgtctt tgacggtttt ctcacggtca gtttggttaa gaagaaaaag aaaagcattg     62940
     atcctcatgc ctttatgatc ctcacatcgt tttcttccag gaacaggtct cttattgcaa     63000
     ggttccatgt caggtaagat cactccacac acaacatcag agtctttatg attgtgatga     63060
     tcttgtccag tgaaaatctc ggactttggc ggtgtctgtt tttcgggtga aacacggcaa     63120
     actctctgtc ctttatgctc tatgcatctc tttctccctt tgactggact tctaatgcaa     63180
     cagccaccat cttcaagtaa gactccacaa acaatatcag aacaagaacc atcaacctca     63240
     tcaaatctgt ctgaaaccgg ttgaggtcta gaccgggtga gtttgagtat tgaagtgagg     63300
     aaattattac tcttctcttc atcaacatca caggttagct tcctctcttc tttaagcaca     63360
     tgcttctctc cttttattct gataccaact tggttccgaa gaaaaggaaa cagcattcga     63420
     gatataccgg actttctctt gctcataaac tcgcgatcac cgagcttctt aagcaaatca     63480
     agctgccttc gctccccgtt acttcctttg ttccaagcat agtcaaatgt gctcaagagc     63540
     atcccttctg ttgcctcagc ttctctctta gatcccatct gatacaatca catgagttag     63600
     atcaaagttg tatacttagc aaaccaatat agaagaaaag aagaaatgta tttactaacc     63660
     ggagcccatc tgtataaaat cgagcctcct ttcgaaaata tgtcttcaaa taaacctcca     63720
     gtaacagcct taactggaga ttcaatagtt tcacagtcgt taaggttgtt aacattgcgc     63780
     aaatgagcac cggatcttcc ataacgctga agtctagacc taacactttc agcttgtcct     63840
     agatatgaag caagaacaat atctggttca agctttcgac attgttcttg accgatgacc     63900
     gctacaccga gctcatacag acccggacaa gatttacgag gtaagttctg gactctgtat     63960
     ctacctacac catcttttcc gtttttgaaa tcttcccaat cgttggatcc tataagtacc     64020
     tgtgcagcat caaactttac acaatcagat aaaactaaga tctaaaacca accacttcaa     64080
     gtagcaaatg aaacagaatt aggctaatta gatatacata tagttagcga ccaattctaa     64140
     cagaaatcca gagaaaatgc atttgggaca aagcagacac actaggcatt caaaatggga     64200
     tctttacact gaaatcctgg aaatggaaga tcagattttt cgattcaact gaaaatctga     64260
     gaattccgaa atgggtttca gagaaaacac aagatcgagc gaaaattctc aatctacaaa     64320
     tcgagaaaga gaaagacaga ggacctgcca cttggagaag acggtgtcgt gtttagttcg     64380
     tttgtagtct tctcttttga agacagtggg gacgacggcg aaggaaacgc cgtcgccgaa     64440
     ttccatttcg ataaaaccga tgatatagtg tgaccgttaa attaaagcgg acttggtctt     64500
     ttttctcagt gctcgttaat ttagagacac caccgttaaa aatgagaaaa gtttttctcc     64560
     cctccaaaaa tggatgttta tccttccaaa atggatgatt tttgttttat tctgtccgaa     64620
     ggaaaagttt caagttaccg ttggaacggt gaagcttctt ctgtacggtt tattagttac     64680
     cgttggattt ttttttttta atctacatta gtcaatgttg acaaccgtaa ttagcataag     64740
     ggagggaatc tacattcttt aatgagaata cttaactttt caattggtca aattttcttc     64800
     tatctttggg atttttttat tacactttta cttgatttgg caaatgttat taccaaatat     64860
     attgatgaga accagaaatt ggtcatgtga tattcgtttt caaccaatct tgtctatcct     64920
     ttgttaatca ttagtatttt agaataaatt gaatatttac aaaatatgcg taaaataact     64980
     cttttttaaa aaagtaatgt caaagacaca aatacttatc aaattaatat ttgtcatgtt     65040
     ttataagaaa acacatttaa tttatgttgt tgaatatgta aatctgttca tcgggtattt     65100
     ctacccaccg gattgtggca tttggttgtc gacgatccgc gtcaaatttc actttggaag     65160
     ttctccaacc gttatatata gggagaacta atgttccaca acatctcaca aatgtggtca     65220
     ttatcttaac acttaactca tgagatatac ttgttttaat ttgatggctt gccctaagga     65280
     tgctaaccgc gttgaagcta taagccaatc aatgtgtcta tggaatgtcg acaagcggct     65340
     cacctatccc ctaccatcta aggaccccgt ttccgaagcc gaaaaaaaaa gtaaaactta     65400
     aagataacaa ttctgatacc actttattaa aaaaagaaaa aaaaaaactg attagtgtca     65460
     ctttccatgc tgccattaag tccaaaatgt tgttttcacc cttttcactt aagtaacagt     65520
     atatatttac taaatcataa gatctcaaaa ttgtttaatt tctaagataa cataagatat     65580
     attcgattgc atcactagac tttgatttat tgaagcacct tttatgcttt aataaagtac     65640
     aaatcatctt ttctcaactt ttgtttttca ctttctccac tgaaatatat aaaaagcaac     65700
     atgaaaagca tgcaagtgca acgttcaact ccttcattat aaccattcta agctaatttt     65760
     tactcttttt cttttgaaat gaattatgag aaccaattct ataatggttc ttttgttata     65820
     aaagaagaaa gttggccata acttgtccat gaagaaagaa aacagtctta ttctttcact     65880
     aattctaaaa aattaaaatc aacaaatttg aaccaaaaaa agaatcaagt atcatccttt     65940
     gacacaactc tcttggtttc tttttgctct ctttagaata aagcagagta ctttgtgaat     66000
     atttctttat tctttttatt attcttggaa tttatttaaa atacaaaaaa aaatacagag     66060
     acaaatagag agaaagaaga agaagaaaga aactccacca atcatataat aataataaca     66120
     caccattgtc tcttccttca aacagagcta caaatccaaa atacttctta tttgtcatct     66180
     ttctctgttt atattttaat tgtttggata tttgctttta tcttctacca aattcctctg     66240
     attttgtcga agaaattagt agctgaaaat ccaaaaatcg gacttacttc atcagctttt     66300
     tggccccact ttacaaagta tgagcaagtt tttcttgttt tctacagcaa agcaatgctc     66360
     acaccatttt cgtggagctt aaagtcttca aacccaaact aaaagctttg aaatttctct     66420
     gcaagaaaca gagagagaga tctagggatt ggctattaag agagagagag tagagtacta     66480
     cactattggt tcctgtgctg ttgtgttttg tgcatctgtt cttgtgtttc tcagataaaa     66540
     tattagtttc agtctttcaa agacattgaa tctcacacac ttactaacac acactcacac     66600
     acgcgttaat ttctcaactt tttttctatt tatttctttt agcttctagg gtcacttgag     66660
     aaagcatctt ggattgcgtg atacttccac tttctcattt cagaagaaaa atgggtttag     66720
     attgagtgaa gtgttaaaag tatatgtaag caagggttga agaagaagtt ctttcaattt     66780
     ctgtatttgt gatttcctta atcttagcta gagaatgaag cagaagggtt ttaaagagag     66840
     aggtgttgta gtggggaaga aagtaatggt tgctgttaga gcttcaaagg agatcccaaa     66900
     agcagctctt ttatggactt taactcatgt tgttcaacct ggagatcgaa ttagacttct     66960
     tgttgttgtt ccttctaatt acacaagtac acatcttttt cctcttctct tctttttcga     67020
     tttggctact tattggtgtt gagtggtgat aaatttggtc tctttggtgc tgaatgattt     67080
     agttagaatg gtgtaaagat ttaatcttta tgtctttggt ttctttcagg taaaaagatt     67140
     tggggatttt cgaggttcac tagtgactgt gcatcaggtt atggaagatt tcttgctgga     67200
     acgaattcgg ataggaaaga tgatattcat gagtcatgtt ctcagatgat gtttcagtta     67260
     cacaatgttt atgatgcaga gaaggtagag aaactcactt ttattcatgt agatttaaaa     67320
     agaaacagct tttttggtta atgagattat aaagagtttt gtttgctttg ataataatgc     67380
     agataaatgt cagaatcaaa attgtttttg cttcacttga tggagttatt gctgctgaag     67440
     ctaagaaatc caactcaaac tgggtgattt tagacaggta aatactatgc agatatacac     67500
     gtgtgtgtgt gtgtgttttg aaaatgcata gtttagtgat tcttgacctt ttgataattt     67560
     taaaacaggg gactgaagta tgagaagaaa tgctgtattg agcaattgga gtgcaatctt     67620
     gtagtaatca agaagtcaca gccaaaggtt cttcgtctca atttggtgaa aaatgcagat     67680
     acagagcatc cagaagctat atcaaggtta gcttcaaagt ctgtcgagtc tcggagaagc     67740
     tcaagaactg gaaaaaagtt gagggaaccg tttgtgactc cagctagcag tccagaccaa     67800
     gaagtttctt cacatactga tatagggact tcatcaatat ctagctctga tgctggagcc     67860
     tcaccgtttt tagcttctcg agtctttgag ggtctcaaga aagagaattt gtgggtcaat     67920
     gatggaagca agagtttctt tgaatccgat tctgactcgg atggtgaaaa gtggagtcct     67980
     ttatcaatgg catcctcatc ttctcatcct gtgacaacag ctgatcttct gagtcctagt     68040
     ggggatttat cgaaagctca taccgaaact ccgagaaaat caagatttgc ggttcttagg     68100
     ctcgctttat cgaggaaaga acctgaagca ggaaaggaaa tacgtaaacc tgattcatgc     68160
     ttaaacaaaa gcgtgaggga agtggtttct ttatctagaa agccagctcc tggaccgcct     68220
     ccactatgta ctatatgtca acacaaggca cctaaatttg gaaaccctcc aagatggttc     68280
     acttacagcg aactggagac cgcaacaaaa ggtttttcta aagggagttt cttggctgaa     68340
     ggtggttttg gttcggttca cctaggaact ttaccagatg gtcaaattat tgctgtcaaa     68400
     caatataaaa ttgctagtac acaaggagac cgagaattct gctctgaagt tgaagtcttg     68460
     agctgtgcac agcatcgaaa tgttgttatg cttattgggc tatgtgttga ggatgggaaa     68520
     agattgcttg tttatgagta tatctgcaat ggatcattgc attctcatct ttatggtaaa     68580
     gtttctacta atggtataca aagaagaaca ttcttgtttt ttgttgaaaa aatgttatag     68640
     atataaaagt ttccataggt atggggagag agccattggg atggtcagca cgacaaaaga     68700
     ttgcggtagg agcagctcgt gggttgagat accttcatga agaatgcaga gtcggttgca     68760
     tcgtgcatag ggatatgcgt cctaacaata ttctcctcac tcatgatttt gagcctttgg     68820
     taaaaagaat gttaaatctt tgctcaagct ctctctctgt ctttccggtt tgtgctaagc     68880
     ttgaaacttt tgaacattct aggttggaga tttcggacta gcgagatggc aaccagaagg     68940
     agataaagga gtggaaaccc gagtgattgg aactttcggg taatcttacg ccatgatctt     69000
     gagagatata ttcttcttga tttacatgta gaacacaata accaatttct gtttaacttc     69060
     aggtacttgg cacctgaata cgcacaaagc ggacagatta cagagaaagc agatgtttac     69120
     tcatttgggg tagtcttagt tgagcttatc acaggaagaa aagctatgga cataaaacgt     69180
     cctaaaggtc aacaatgtct caccgaatgg gtaaaaccaa aaccaactac agtataacaa     69240
     agttttagtc tttaaagctc tgaatgcttt actaagaaga aacatttttc tgcaggcaag     69300
     accattgttg cagaaacaag ccattaacga acttcttgat ccgcgtctaa tgaattgcta     69360
     ctgtgagcaa gaagtttatt gtatggcact atgtgcttac ctctgcattc gccgtgaccc     69420
     taactcaagg ccacgaatgt ctcaggtttg ctcacatctc aaaaacactt acaagttaat     69480
     aacttacaat cgaaattttc tgagtgttaa tatttctttt tgtctatgga atctgtgtct     69540
     tctcattgaa ggtgttgcgg atgttagaag gagacgttgt catgaatcca atatagaaga     69600
     agcttcacaa ggaaaattct tcttagggag tttgtacact atttagggtt actattacag     69660
     ctttttaaat gagttttgct tttgtatatg taaaaatttg ttaatgagac aaagattcaa     69720
     ctaaagtttg ttgagatttt tacatttcat agattcatgg ccggttaaag tctgaataat     69780
     tgaggttatt ggttgaaccg attggttgac tggtcaaaat tcaaaccttt cagcggggca     69840
     agagggtttc agacagcatt ttgccccatc caccaaaaaa tcttagaaaa tatactatac     69900
     tatagagatg tcatgtctgt tattttacaa atattatccc tatctttgaa agaaatagaa     69960
     ttggtaaacg caagagctga tgggtctggt taatgggcca gtttgagaaa accagttcgt     70020
     aattagggtt tatatcaatt ctcaaatgac gaattggtga gagtgggact tgttcgaatg     70080
     tgaagagacg ttacaagggt atgtatgcct cagctttgat acaaagctgg gaaaagtcaa     70140
     aagcttaaga gagttgatac gcaacacaac ggtcacgtct ttattccaac aacacacaca     70200
     tctcttagca taaaacacat attttcccca atttttctgc catatatatg attttagacc     70260
     ataataattt catcaaaagt tacagtttga cccacagcta cagttgtcgc actccttgtt     70320
     gtagttcttc tcgcaactat accacacaca aattaatcaa acaaacaaaa aaattagtaa     70380
     ttaatatgat gagattaaag attagtcaac cacatgcatc tgattctgat cagcatatat     70440
     gcagaacagg ccaaaatgtt tttgtgtcta ctcactaaca caattgtaaa cgtaagtcat     70500
     aagaagagtt tattgaattt tgtaccatga agccattaaa ggtaaagacg agagagagga     70560
     tcaagggggt tacctgcaag agtcaccaca tttgcaggag gagccacatc cacaattaga     70620
     atcatcctgg ttagaatcag tcccatttct cttacttgtc tttgattgat taacttctgt     70680
     agtttcttct tcttcttatg atgcttttgt gatttcaacc aatgggaatg gccactattt     70740
     atagaagaag agagagattc ggatcacttt atacataatc caaataaatt tacgaataac     70800
     atcaacttgc ccatcatttt ctttttatgt tagatttgtt ccagcttcat tcaagaaagt     70860
     aatttaatgt tagagtttta gcaagacaac agagtatcaa acaaactaat agaaaacgtc     70920
     aaattattgg cgaatatgta aaaaacaaaa aaagtcgtac acgcaagaag ataactatcg     70980
     caattgccaa tagtaaacgg cagccgaccc aaaaaagagg caggaaaact tatttaatga     71040
     gaaatatttt cctctgtttt gaaatcttct tgtggtcatt tggacgacga cccaggacat     71100
     ggtctacgct cttctactac ttattaatat tatatatgag tttcttacga tccatatatt     71160
     acatcagata tccgttttaa gattttttta aaaatgttga cacaaaaaaa aagttttgga     71220
     cgactaagtg ccgtcatcaa tccattggat tacatcatca atccattgga taacccttgg     71280
     tttgatctct ctgaggtgag tatcgagtcg tgttatggat cccaaacatt gccgcgtagc     71340
     ttgcgtagta ggcattggaa tctcaaaaca ttgaaactta aaaaactaag tttcgtggat     71400
     actgatgctt atatgtggtt tgaatcactc aaaacactgc atcttctctc tgtgaggttc     71460
     tctgacgaca aatctgttca gaggctttta agtgtttgtc cgaaacttga agatttagtt     71520
     gtgaaacgaa caacatatgt caatgtgaga atattcagta tcaatgtgcc tagtttgagg     71580
     agtttatcta tcgattattc gtgggcggta tctcgacccg cggatgtaca tggatttgtg     71640
     atagatgctc cttctttgag gttcatgaac attaaagatc acttcagtaa cttattacag     71700
     ttcgaaaata tgcctaagct agtcaaggcg aatgttgagg ttgattgtga tctatctgag     71760
     aagtttattg gatctattac ctcaatccaa catatctctt tatgttctaa aaattcaaag     71820
     gtaactaacc cctctttaat aatctgaacc aatgtcaaag attcaatcaa ataaagtttt     71880
     taattacctt gttttttgct tttattgcag attccttatc ctagtggcac ttccttcttc     71940
     tatcttgaac atcttgagct atgtacatgt tctcaagatt ggtggaattt acttaaccgt     72000
     atactcgaag acgctccaag acttcaagtt ctcaagctca aattggtatg tatatggagt     72060
     ctccttactt tgtctttcca gtttttgaac cgccttactt ctaagttgta acaagcaata     72120
     tgctttcttc tatttcacag ggaaactgtg ttcaatgtag tactgagctg atggattact     72180
     ggaacgaacc gtgctctgtt cccaaatgtt tatcgtctca tctagagata ttcgagtgga     72240
     gacattacaa ggggacaaag caagaaagaa aagtggcaaa gtacatacta gcaaaagcga     72300
     gttgtctaaa ggtggcaata ttctcttcag tatgtataga gaagaatctg attttcaaga     72360
     agttagaaaa tgtggacaga ggttcaaaag catgtgagct tgtgtttcaa taacatgttt     72420
     tcttttttgc tatcttcaac aacatttttc attgttaaca tcttctgaaa caatgatttg     72480
     actatatata ttaagttttc gatatgtctt tacaaaaata ttgtggctgt acaaccaatc     72540
     aacaccgaag aaagaaatat tcctcataat aaatttaaac ttatctttat gtaaaaaaaa     72600
     aacataaaaa aaaatcagag tttcatatct ctccttcttc taatctaatg agccgcctat     72660
     tcctcaactc ttcagccaaa aattagggtt ttcatattcc tccttcagat ctaacgactt     72720
     ggcgatggaa gctgcaagat ctggaatcga agatgttaca tctcctgata ggatcagcca     72780
     gttacctaac gatttacttt ttcgaatact ctcattaatc ccggtaagcg atgcaatgtc     72840
     cacaagttta ttgtctaaac gttggaaatc tgtgtggaag atgttgccaa cgcttgtata     72900
     caatgaaaac tcttgttcca atattggttc tcttggattt gaccaatttt gtggtaggtc     72960
     cttgcaatta catgaagctc cacttctcaa aaccctaacc ctagaactta ggaagcaaac     73020
     tgattcctta gattcttcca tatttccaaa cattcattct actctccttg aattctcaat     73080
     caaatctact ggttatcctg tttattacag tactatcagt ttcccaaaca accttgatgt     73140
     cttccaaaca ctagttgtct tgaaactcca aggcaatatt tgtcttgatg ttgttgattc     73200
     tccggtttgt ttccagtcct tgaagagttt gtacctcaca tgtgtgaatt tcgagaatga     73260
     agaatctttt tccaaacttt tatctgcttg tcctgttctt gaagacctct tcctccaaag     73320
     actttgtagt gtggggcgtt ttttgttttc catatcagtc ccttctctac agagattaac     73380
     ctacactaaa gaacaagcct attattctaa cgatgaagca atactcgaga ttaccgctcc     73440
     ttctttgaag cacttaaaca tcttcgatcg cgtaggtgtt ttcagtttta ttgaggatat     73500
     gcctaaattg gtggaagcaa gtgttagagt taaactgtca aagaatgaga agcttccgaa     73560
     agttcttact tcagttgagc atctttcgct agatctatat ccttcaatgg taacatcttt     73620
     cttctctcgc aagctaggtt ttgtttatct ttgaagatag catttgcttt aaactttgag     73680
     tttttgcgtg caggtttttc accttgatga tagattcatc tccaagcagc ttcttcatct     73740
     gaaattagac atttacgaca actttcagtc gaatcttctt ctgagtttgt tgaaagattt     73800
     acctaatcta caatctctca agctcaacca tgtaaactca caatttccat tgatattaat     73860
     ctgttttgag agttatgaat tgatctaacc caatgtcttt tatgtttctc agtcacatcc     73920
     cagctataat gtcgaagatc aaccgtgttc agtctctgaa ccaagctctg ttcctgaatg     73980
     cttgagcttc catctcgaga cttttcaatg gataggctac gcaggaacat ttgaagagat     74040
     agcagctgcg gtttacgttc tgaaaaacgc tcgttgttta aagaatgcta caatctctct     74100
     gtattcaagg ggcacagaga atggtttgat gatgattaag gagttggaat ctatgtctaa     74160
     aggttcaatc atgtgtcagc ttttagttaa attttaaaat tctctccatg aaatacatct     74220
     tggatttgaa ccttgataat taaagtctca aacctttagg tgtttacaga gaaacagagt     74280
     cgatggaaca gagttcttat gagtttcctt tttaacatac tgtttcctat tttactctct     74340
     ctgttttctc tattttatta attaaaatat caagaaaata tttatattaa tgttaactag     74400
     cagatcttat ataagagtcg aggattaaag gaaaagcaaa actagggttt tacttctctg     74460
     acgaagcttt tctttttcta ctagtcagct gaaaaattag ggtttttttc ccctcctttc     74520
     gtatcttacg attgggcgat gaaagctcca agattgggaa gtgaagaggt ttcatattcg     74580
     gataggatta gttacttacc tgatgatttg cttttacgaa tactctcatt cattcataca     74640
     agcgatgcta tctccacaag cttattatct aaacgatgga agtttgtgtg gaagatgatg     74700
     ccaacacttg atcttgatga agattcttgt cgcaatattg gcacccttcg atttgacgaa     74760
     ggttgttgca tgttcttgaa atcacatgaa gctccggttc ttacaagttt gaatctcaaa     74820
     cttatgacac cttctcatga tatagatcgt cttttatcaa atattaaacc cattcttcat     74880
     gagatcacaa tcacttctta taggtacagt actatcagat tcccaaggaa tcttaacgtc     74940
     tgccaaacac ttgtcgtgat gaaactccaa gacaaggttc ttgtggatgt ttctttcccg     75000
     gtttgtttcc ggtccttgaa aagtttgcac ctcacacgcg tgaaatactc ttgccgagaa     75060
     tctttcacca cacttttatc agcttgtcct gttcttgaag atttagatct cttcattggc     75120
     agagttcact atgactgtct taactcgttt actatatggg tgccgtcctt acagagatta     75180
     tctatatgtg acgagtcata ccgctttcgt agcacgacgt ttgaaataag tgttccttct     75240
     ttgaaatact taaaaatcgc gtgtcaggac agttgcttta agtttgttga ggacatgcct     75300
     aacttagttg aggcacatgt tgaagctaat caacatgaaa ctaagaacct cttgagattt     75360
     ctcacctcag ttgaacgtct taaggttcac tctctttaat ggtatactct tagtttttat     75420
     ctttctttcc taatcattta gttattctgt ggctctgttt gatgatggtt tttctttctc     75480
     cggcatgcag gatccagatc ttaccgatag aatcttccac cagcttcttt atcttgagct     75540
     gcatttgcac aaaagactca atggggatcg aattctgagt ttgctcaaac attctcctaa     75600
     tctacaaact ctcaagctca acgaggtaaa tcaaaatgtc gcggtttttt atattagctt     75660
     aaatagctct cttttgtatg ttctttacct aactcagatg ccttatgttt ccagagaaac     75720
     ctttacgttc tatcaaggat caaccgaata tatctgttcg taaaccgaat tctgttcctg     75780
     agtgcttaac cttccatctt gaaactcttg agtggcaagg ctatgcagga agaccggaag     75840
     ataaagaaat cgctgtttac attttgggaa acgctcttcg tctcaacacg gctacgatct     75900
     ctcgatattt cagctccagc cgcttccgtc accaccagaa gaaggatcta aaaattgtgg     75960
     aggagttaaa atctataact aaggcctcaa cttcatgtca gcttgtactt caacagttca     76020
     ttgaaattaa atattcaatg tagtttaaca tgaatgtaaa tcattattag gttgaatgtg     76080
     ttattagcat aagcctattg aagttttatt ttactctgca tctgaaacag aggaatctct     76140
     ttgatgacaa gaaataaaca tagaagttaa cttgatagat gtgtttgtaa tagtagacga     76200
     cgtaccttgc tactcaagtt ttgttagttt tagggtatgt gaaatccaag aaaatcaata     76260
     tagaaataat aaagagaacg agcaacaaaa gtaaagtgat attttaaaat atcttttgtt     76320
     ttattgggat atattttaaa ataaagtgct aattataagt ttaatattca ttcttcttaa     76380
     aatacgtaaa ccaatcaaaa caaaatatat ttctatgtat aaatattatt aggattagga     76440
     taagaaccgt tgcagctacc ttcatcgaca ttttacttat tcgatggaat aagttatgat     76500
     gcatcatctg ctgcggccgc agaaaactat ttgatatggg agaaacaatg gctcgaatgg     76560
     aaagatgtga atggctttct ctaatccaaa gtggattaag cactgagatt ttttcatgga     76620
     tagcttatgc tacatcatca aaagaagcat gggaaatttt gatggtgaga tcagtaggtg     76680
     gtcctatatt tcaagctaga aagcttcttg atctcaagaa agagtacaac aacacgacaa     76740
     tgagcgatgc ggaaacggtt catgagttta ctggaaaatt attggagcta gtgtttcgta     76800
     tgaagtcttg cgggtggaag gtcgaagaaa aaatattggt gaagaagatt ctttcctctt     76860
     tgcctccaag attcgataaa gtcttagtgg aggttgcaga aaaactttct gttaatgtca     76920
     ttatcgattg cttgttggtt catgaataca atatgagacc ggatcaagag tcttttcaag     76980
     aatctgtcat tcagagtgtt aatgtggaag aaagttttga agcagaagct gaaatattat     77040
     actctttgaa tgacattact cagagccaag tggcaatgat ggagagacaa agtgaagtgt     77100
     tgtcgttggt gcaaaagaat caaaagatgc taatgcagat gcaaaaacaa atgatgatgt     77160
     taatgcagca gaaagatcat gtgttagcac actccgaatc ttatgaggag gagatgacaa     77220
     aagtgatcga gtctatggag aaacactact tgaagaaaaa gtagttttgt ttatttttgt     77280
     ttggttttgg ttttttcttt gtttggtgtt cctgaaagtt gattaattac tgatcatgga     77340
     ttcattcata aaattcgtct ttgcataaat tgtggacttc aacttttggt aattgtgaga     77400
     cttcttactc gaaacagaga cttattatat tttgtcacct cttaaaacag agaaaaacag     77460
     agaagtatcg atttagagat caaaagaatg tgatgtgtgc tgttattgtg gatgaagagc     77520
     atttgcataa tgttctaatt tggtagtttt tttccttcaa taatatatga tatagtgagc     77580
     aacatcttta gaatatgttt agtaaatttt tgtaaaacaa attgacctac ctcaccaaaa     77640
     acaaacttca ttggaccaga attaagtagc cattaggatc aaatcaacaa taatatacta     77700
     tttatgtgat gaaatatgaa tccccatcat tgtcctatat gaatcaacat ttaatatatt     77760
     ttaattagtc gaatcttaaa aatgaatccc agtcatatta tctttatgta tgtagaagaa     77820
     gatataatca acattaaata gattattata gtacatcaac atgaataccc catcttgtca     77880
     tattatatgt atgtgggata gaatcaacat gaatccacat tcagtattca aattagaaat     77940
     gatcgtaggc tatgactcta aagttaattt taatttatat gatgaatgcg agtaccccca     78000
     ttatagattc atactataca ttattttata tgatcaaata tgaatcatca tcattgttct     78060
     cctatacttg ctcttcattc cgaatgtagc aatagaatct ccatattgct ttttaccaat     78120
     tctaaccata aacaattcat agataaatgc atgttgggta gtgctttgtc tactagtaat     78180
     taataacatt atcgattaca atatttgagc aaatcaggca atctttaaat aaaaatatgt     78240
     atacgatgac tcttccgtcc aactaatata ttgaaaatat tataagatcc aaattatttc     78300
     attatttata tcaaacaaaa acaagaaata aataagactt gtctttgttc atgtaaacaa     78360
     gaccactttg ttgtttgttt ctctatttta caaatttgta aattatattt ttgttatgtt     78420
     tctttccaca tttttattag gtcatccaac tacccacctc cccaaaacta ttggaggatc     78480
     caagtcctct ctctctcaac catatatctt atatttcctt tgcaaaagga tagcctttat     78540
     tatttaatac acatagattc cattattgtt atggctacct cattctattc tataaagcat     78600
     acatatgaga agaagaagca aaatatagac tatgtgaaag ataaatgaat atttcatatt     78660
     tgtgagacaa attaattaga ttagaattaa cattttgtag ctagtccata ttagtgataa     78720
     atttccactt ataaagacat attttcctct tttgtttttt atacgtaagc ttgtcttctt     78780
     attggctaaa agtagaaaac accaacttgg acaacatcat ttaaattata aaaccctcca     78840
     ataaataaaa cttggtttat ccaatcatct tatttctctg tgctctccac cattttacat     78900
     aaaccccaaa atctctcttc atcatcatca ttcatcaaca tcatctctct ttctctatct     78960
     cgctgtccct ccttctcttt ctcattcatt gcaatgggca gaagatgctc acactgtgga     79020
     aacgtaggac ataactcaag aacatgttct tcttaccaaa caagagtagt taggctcttt     79080
     ggtgttcatc tagacaccac aagctcttct ccgccgcctc ctcctcctcc ctcgattttg     79140
     gccgctgcaa taaagaaaag tttcagcatg gattgcttgc cggcatgttc ctcctcttcc     79200
     tcttcctttg ctggttatct ctccgatggt ctcgcccata aaacacctga ccgcaaaaaa     79260
     ggttacaact ttgacatatt atgccacttt ccgagttttt ttttacaata ggatagtgac     79320
     gtttttttat taatccaaaa gttccgggta ttaggcccat aatcgatttg tatcggagat     79380
     caaaacatgt taaactggtc atcggtggga ttggttttgc cataaagatt ttgtacgtat     79440
     atccaagtcg gaccatttcc taaagcatgc aaccgctata tatataagag tagtcaagaa     79500
     aatgatgtgt ctataacgcg atctttagcc taggattttg ttaaaagttt ttccaaaaat     79560
     aataatttgt gtttccgtaa ttaggggttc catggacggc ggaagagcac cggacgtttc     79620
     taattggatt agaaaagctt ggaaaaggag attggagagg aatctctaga aacttcgtcg     79680
     tcacaaaatc cccgacacaa gtggcaagtc atgctcaaaa atactttctc cggcaaacta     79740
     ccactctcca tcacaagaga cgccgcacca gcctctttga tatggcaagt aattccaatc     79800
     ttttctctat acatgcatga caaaagaatt taaactcttt gtatcaaact tttatgtatt     79860
     aaatcaaaat gtttctgtat ccaacaaaag tcacatcttc aaaagttcaa acagaatttt     79920
     tatgttgttt taaaagtttt ctttccaagt ttttttttcc cacttaaaat atcggaattt     79980
     tctaaaccaa aaattagtca agattttaag tttaatctaa gctttatttt aataccaagt     80040
     atatatgaac atataatttc ttgtagaatc cgaagaaaaa aatagaaaat aatcttgaat     80100
     tgacaaattt ttatattcaa caggtttcgg ccggcaatgt tgaagaaaat agtactacta     80160
     agaggatatg taatgatcat attgggtcga gctcaaaggt tgtttggaaa caaggattac     80220
     tcaatcctcg tcttggatat ccagatccga aagtatcagt atccggctcg ggtaactccg     80280
     gtggactcga tcttgagctg aagcttgcgt ccattcaatc tcctgaatcg aatattagac     80340
     ctattagcgt tacgtgaatc tatataacac gttatgatca gtttcattag aataattcaa     80400
     atgtttacat atataatatc ttatcgatcc tatctaattt gattttgatt taacgttagt     80460
     tactttgata atttcgtcga tattgttttt ttggtttttt cattgtgaga ttttttgtct     80520
     tggaagttgg atccatacat atttctgtaa aactttatat ttaaggtata tatatctagc     80580
     gctcataaaa gtttcaatat tcctattata cttttaataa gaaagtttct tacgatagaa     80640
     ttagaacgga taagacaatt ttgtacatag tacaacttgt ttgaagtttc ttgttttcta     80700
     gttcattaaa tatttcaaga ttcgttttta aaaaaaatat tcttttcgaa atgtgtttca     80760
     aaaatttaga atacttttaa catatctaaa aatttagaat acttttaaaa tttcgttttt     80820
     aacagaatac tttcacattg ttagttttct gttaataaaa caataaacac gagtttcaaa     80880
     cataatgtaa agataacttt aagaactgat attgagtcca caagagctca ataatattta     80940
     acactgaatc cactttaaca caaaaccaag ggtctttctc agaattgtta taattttgtt     81000
     gttggcgaaa aagaaaaaag aaacaaaaag gtcacatttt ttacatttct atatttagtg     81060
     caagttgttt aatagtgaca ctactattgg aaatgaccca aagtgactgg acgacaagat     81120
     attatattat ttatgatttt gatatatact tcctcttttc acacaaaatt tggtttaaaa     81180
     cattattttg taagaaaata tgatcatttt atatttccaa tattttttat ctaattttaa     81240
     ttttaattct aatattttaa tttattattt acgaagagaa atctatttaa aataacgaac     81300
     gatatgtaat agagatttat atatttttaa tatgtatgaa aaatgctaga ataacatttt     81360
     tgtgaagaga atttaaaata gtcaaatagt tttttttttt tttgtcgatt aaatagtcaa     81420
     atagttaaat gacaaaattc tgtgagagaa attaggtgaa tggttattat gcccagacaa     81480
     attaagcaaa tgggcagtac ggcaatcaaa atttatttat tatgattttc aattaaactt     81540
     tgatctttgt gtaaatatat tatgttacgg aaaatatcat tcctctcaat ctctcataaa     81600
     tcaaattaat attttgttag gtctattttc acatcaaaaa tgtggtataa tacctaaaat     81660
     aaataagaaa catgaatatt cactagggaa gttcatttgg tctaatggtt aacgatcaaa     81720
     ttatgcggcg tttcctcttg aagttcgaca acaataaatt ttgttacccg cacagtaaag     81780
     attatgctat gagttttaaa aaaaaatgat tatgctatga gtttagtctt gtcacaaatg     81840
     atataagaac aaaaatctat tcataactaa ttattttaaa attagaaact tatgatttca     81900
     caaatatcac ccccaaaaaa atggaagttg aaaaatcctc tcctaaaacc accaaaatgg     81960
     cagtccaata tatgaacgtg aatcgcatga tcttaggtaa atatatcaat gtatttcgta     82020
     gttactttaa aataggtata tttgtttctt tatggggaac cattggctaa tattgaagaa     82080
     ggattgggaa caaattagta aatttttatt ggtgtgagtg gtcccttgtt atcatgtcaa     82140
     tacaccaata atcactttta agttacaaag acatttcacc caaccctttt ggcgggtcct     82200
     atgcttatca atgactaaaa tatatgaggc ttcaaattat ttcattttta ctcaaaaata     82260
     aaccaaaagt ctattatatc tttcaaagat ccaaatcatg tggtcgataa aatgaatgtc     82320
     aataaaatat cctatctaga ttttgtttcg acatatgttt ggtttctatt atacaagtta     82380
     tctaataaat cattttgttt atattataag ctatttattt cctatatgta gtagttttgt     82440
     agggaataat tttctacaca aactgttttt actgtcgcac aaaaaatttg ataagttgaa     82500
     gagctagatt tttatagatt tgtagattat atgaaatatt tgttaagtta taatatggta     82560
     gaaaattgcg aatgagactt tttgtaaatt aaaaaaaaaa tcgtggaatg agactccaac     82620
     atgtgacgta gatcgagaga gagaaggatg attatggttc ctgtctctta ggagaatgta     82680
     ttaatttacc tttcggacga gttagttgtt gaattcatca ttttcaagtt atcatttctt     82740
     tagaaactat ttctagcatt gaatttttag ttctaagttc taacaaccgc cagatatgac     82800
     taagttttat tctctctgtg tatgtatcag tataaatgtt attttcatat atacataaaa     82860
     gatagtatta gactgcaagt aaacctgaac aaaattgata tatcctcctt agcattatag     82920
     tatttaatgt attagactat attctttggc tcttttgctt tgactgtttc tttatgactc     82980
     atagcataat atttatacac tattgttttc tgaatcttct ctcatattaa taaatttaat     83040
     aaattccaca ttgcaaaagc tcaagagcat acttcataaa atgaaaataa aatttatgat     83100
     atagatgaaa taatgtacaa attatcccga caagattaaa aaaatgatgt ggatcagcta     83160
     acccgtttat agcaaagttt taatgggcct atttagtagt atggaccaac cttatgtacg     83220
     gatttgggct cataaccaga ccgattaaat ttactttttt ctaggactcc tcttcaatgg     83280
     tactaatttt gaaataaccc ctttatatat gcgtgtatct cacatttaac caaatatttc     83340
     tgtttgatca attggcacct gaagaattgg aaacttgaaa ttttatttaa cgcctgaaag     83400
     cgtgttattg aaaactataa atatgtgcaa taatacaagt ataagtttaa aagaactgat     83460
     ccaatcctct caaacgcagt attggctcat ctgcagaaag cattatcgaa ggaaggaaat     83520
     atcagggaaa gcttataaca caagaaccct actttacttt aactttcgtc cgtaacaaga     83580
     aacaaaacag agttcaaaac ggcttcattt ttaagcggac agaaacctgt ttaagttcat     83640
     tgtcgtgtca aaaacaccaa tcctgcaaaa cccaccacga tcaacgcacg catcacctga     83700
     aagttacaac aatatgatga aaagattttg gtttgtcaat aagccctaaa catgtcggtt     83760
     gataaactca cttgcccaac aggtcgtcct gaactttctg actctgcaga gttctcagac     83820
     ttttgtttct ttgatcgctc aatgttcgtc cacttgttgt tgctatttat tttcgcgatg     83880
     tttatgcaac ggcttcccct ctgaaaatgt ttcagataaa cgcaaattta agatatatca     83940
     tacaaaagat tgtaacaacc actaacgacc actgcttttg tacctcaccg atgttttccc     84000
     tagtagactc gtctatcctt ttttgtaaca aatttgcttc tgctaaatcc aaatccaaat     84060
     gtcttgttcc taaatctgtt tcgcaacaca aatcttttgc ctcatctgga aatatccaga     84120
     gacgagatc                                                             84129
//

If you have problems or comments...

PBIL Back to PBIL home page