(data stored in ACNUC8465 zone)

EMBL: AB015314

ID   AB015314; SV 1; linear; mRNA; STD; PLN; 1682 BP.
XX
AC   AB015314;
XX
DT   12-JUN-1998 (Rel. 56, Created)
DT   20-NOV-2004 (Rel. 81, Last updated, Version 6)
XX
DE   Arabidopsis thaliana ATMKK3 mRNA for MAP kinase kinase 3, complete cds.
XX
KW   MAP kinase kinase 3.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1682
RA   Shinozaki K., Ichimura K., Mizoguchi T.;
RT   ;
RL   Submitted (06-JUN-1998) to the INSDC.
RL   Kazuo Shinozaki, RIKEN, Plant Molecular Biology Laboratory; 3-1-1 Koyadai,
RL   Tsukuba, Ibaraki, 305-0074, Japan (E-mail:sinozaki@rtc.riken.jp,
RL   Tel:81-29-836-4359, Fax:81-29-836-9060)
XX
RN   [2]
RX   DOI; 10.1093/dnares/5.6.341.
RX   PUBMED; 10048483.
RA   Ichimura K., Mizoguchi T., Hayashida N., Seki M., Shinozaki K.;
RT   "Molecular cloning and characterization of three cDNAs encoding putative
RT   mitogen-activated protein kinase kinases (MAPKKs) in Arabidopsis thaliana";
RL   DNA Res. 5(6):341-348(1998).
XX
RN   [3]
RX   DOI; 10.1006/bbrc.1998.9796.
RX   PUBMED; 9878570.
RA   Ichimura K., Mizoguchi T., Irie K., Morris P., Giraudat J., Matsumoto K.,
RA   Shinozaki K.;
RT   "Isolation of ATMEKK1 (a MAP kinase kinase kinase)-interacting proteins and
RT   analysis of a MAP kinase cascade in Arabidopsis";
RL   Biochem. Biophys. Res. Commun. 253(2):532-543(1998).
XX
DR   MD5; 77fad4965edfaa538d2d6c54507ca6b8.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1682
FT                   /organism="Arabidopsis thaliana"
FT                   /ecotype="Columbia"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        31..1593
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="ATMKK3"
FT                   /product="MAP kinase kinase 3"
FT                   /db_xref="GOA:O80396"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR018222"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/Swiss-Prot:O80396"
FT                   /protein_id="BAA28829.1"
FT                   /translation="MAALEELKKKLSPLFDAEKGFSSSSSLDPNDSYLLSDGGTVNLLS
FT                   RSYGVYNFNELGLQKCTSSHVDESESSETTYQCASHEMRVFGAIGSGASSVVQRAIHIP
FT                   NHRILALKKINIFEREKRQQLLTEIRTLCEAPCHEGLVDFHGAFYSPDSGQISIALEYM
FT                   NGGSLADILKVTKKIPEPVLSSLFHKLLQGLSYLHGVRHLVHRDIKPANLLINLKGEPK
FT                   ITDFGISAGLENSMAMCATFVGTVTYMSPERIRNDSYSYPADIWSLGLALFECGTGEFP
FT                   YIANEGPVNLMLQILDDPSPTPPKQEFSPEFCSFIDACLQKDPDARPTADQLLSHPFIT
FT                   KHEKERVDLATFVQSIFDPTQRLKDLADMLTIHYYSLFDGFDDLWHHAKSLYTETSVFS
FT                   FSGKHNTGSTEIFSALSDIRNTLTGDLPSEKLVHVVEKLHCKPCGSGGVIIRAVGSFIV
FT                   GNQFLICGDGVQAEGLPSFKDLGFDVASRRVGRFQEQFVVESGDLIGKYFLAKQELYIT
FT                   NLD"
FT   polyA_site      1682
FT                   /note="18 a nucleotides"
XX
SQ   Sequence 1682 BP; 488 A; 301 C; 364 G; 529 T; 0 other;
     tttgagagta acaaagaaaa agtagttatc atggcggcat tggaggagct aaagaagaag        60
     ctgtctccat tgtttgatgc tgagaagggt ttttcttcat cttcatcttt ggatccaaac       120
     gattcatatt tattatctga tggtgggact gtgaatttac ttagtagatc atatggagtt       180
     tataatttta acgagctcgg gttacaaaaa tgtacatctt ctcatgtgga tgagtctgaa       240
     agttccgaga cgacgtatca atgtgcttct cacgaaatgc gggtttttgg agctatagga       300
     agcggagcta gcagcgttgt tcaacgagct attcatatcc ctaatcatag aattttagcg       360
     ttgaagaaga ttaatatctt tgaaagggag aaaaggcagc aattgcttac agagatacgg       420
     acattgtgtg aagctccttg tcatgaagga cttgtggatt ttcacggagc gttttatagt       480
     ccagactcgg gacaaatcag catagctctt gaatatatga atggaggatc tcttgctgat       540
     attttaaaag taacaaagaa gatacctgag ccggttcttt catcattgtt ccacaaactt       600
     ttgcaaggat tgagctactt gcatggagtg agacatcttg ttcatagaga cattaaacct       660
     gctaatttgc ttataaatct caaaggggaa ccgaagataa ccgattttgg cataagtgct       720
     ggccttgaga attcaatggc tatgtgtgct acttttgttg gaactgtcac ctacatgtca       780
     ccagagagga taaggaatga cagttattct tatccagctg atatatggag ccttggtctc       840
     gctctttttg aatgcggcac tggagagttt ccgtatatag ctaatgaagg gcctgttaat       900
     cttatgttgc agatattgga tgatccttca ccaacaccac caaaacaaga attctcacca       960
     gagttctgtt ccttcattga tgcttgcctc cagaaggatc cagatgctcg accaacagct      1020
     gaccagctct tgtcacaccc ttttattaca aaacacgaga aggaaagagt agatttggcg      1080
     acttttgttc aaagcatctt tgatccaact cagagattga aagatttagc tgatatgctc      1140
     accatacatt attactccct ctttgatgga tttgatgatc tttggcacca cgcaaaatcg      1200
     ctctacactg aaacttcagt tttcagtttc tctgggaaac ataacacagg atcaactgaa      1260
     atcttctcag cattatcaga cattcgtaac acattaacag gagatttacc gagtgagaaa      1320
     cttgttcatg tcgttgagaa gcttcattgc aaaccttgcg gcagtggtgg agtcataatt      1380
     cgtgctgttg gatcgtttat tgttggaaat cagtttctga tctgtggtga tggagtccaa      1440
     gcagaagggc ttccgagttt caaagatctt ggcttcgatg tcgcaagtag acgtgttggc      1500
     cgatttcaag aacagtttgt tgttgaatct ggtgatctta ttggaaagta ttttcttgct      1560
     aagcaagagc tttatattac aaacttagat tagataaaca cacatgagaa aacgtttgtt      1620
     ctctactgta ctataatgta actatgaact tgtttaatta ctaacatatg taattgtatt      1680
     tg                                                                     1682
//

If you have problems or comments...

PBIL Back to PBIL home page