(data stored in ACNUC8465 zone)

EMBL: AB015315

ID   AB015315; SV 1; linear; mRNA; STD; PLN; 1608 BP.
XX
AC   AB015315;
XX
DT   12-JUN-1998 (Rel. 56, Created)
DT   14-APR-2005 (Rel. 83, Last updated, Version 7)
XX
DE   Arabidopsis thaliana ATMKK4 mRNA for MAP kinase kinase 4, complete cds.
XX
KW   MAP kinase kinase 4.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1608
RA   Shinozaki K., Ichimura K., Mizoguchi T.;
RT   ;
RL   Submitted (06-JUN-1998) to the INSDC.
RL   Kazuo Shinozaki, RIKEN, Plant Molecular Biology Laboratory; 3-1-1 Koyadai,
RL   Tsukuba, Ibaraki, 305-0074, Japan (E-mail:sinozaki@rtc.riken.jp,
RL   Tel:81-29-836-4359, Fax:81-29-836-9060)
XX
RN   [2]
RX   DOI; 10.1093/dnares/5.6.341.
RX   PUBMED; 10048483.
RA   Ichimura K., Mizoguchi T., Hayashida N., Seki M., Shinozaki K.;
RT   "Molecular cloning and characterization of three cDNAs encoding putative
RT   mitogen-activated protein kinase kinases (MAPKKs) in Arabidopsis thaliana";
RL   DNA Res. 5(6):341-348(1998).
XX
RN   [3]
RX   DOI; 10.1006/bbrc.1998.9796.
RX   PUBMED; 9878570.
RA   Ichimura K., Mizoguchi T., Irie K., Morris P., Giraudat J., Matsumoto K.,
RA   Shinozaki K.;
RT   "Isolation of ATMEKK1 (a MAP kinase kinase kinase)-interacting proteins and
RT   analysis of a MAP kinase cascade in Arabidopsis";
RL   Biochem. Biophys. Res. Commun. 253(2):532-543(1998).
XX
DR   MD5; 06244cd44c211b8ace40901306053ec8.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1608
FT                   /organism="Arabidopsis thaliana"
FT                   /ecotype="Columbia"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        253..1353
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="ATMKK4"
FT                   /product="MAP kinase kinase 4"
FT                   /db_xref="GOA:O80397"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/Swiss-Prot:O80397"
FT                   /protein_id="BAA28830.1"
FT                   /translation="MRPIQSPPGVSVPVKSRPRRRPDLTLPLPQRDVSLAVPLPLPPTS
FT                   GGSGGSSGSAPSSGGSASSTNTNSSIEAKNYSDLVRGNRIGSGAGGTVYKVIHRPSSRL
FT                   YALKVIYGNHEETVRRQICREIEILRDVNHPNVVKCHEMFDQNGEIQVLLEFMDKGSLE
FT                   GAHVWKEQQLADLSRQILSGLAYLHSRHIVHRDIKPSNLLINSAKNVKIADFGVSRILA
FT                   QTMDPCNSSVGTIAYMSPERINTDLNQGKYDGYAGDIWSLGVSILEFYLGRFPFPVSRQ
FT                   GDWASLMCAICMSQPPEAPATASPEFRHFISCCLQREPGKRRSAMQLLQHPFILRASPS
FT                   QNRSPQNLHQLLPPPRPLSSSSSPTT"
FT   polyA_site      1608
FT                   /note="23 a nucleotides"
XX
SQ   Sequence 1608 BP; 410 A; 336 C; 353 G; 509 T; 0 other;
     gttccctttt cagtgtcctt tcaatttctt tcgacgaaac ttcatttctc aatttctttt        60
     gattttgatc gcttcgaaga acgaatcaat ttaagcctgc cacaaacaaa ccctagaata       120
     cgacaacgca cgacgacgaa gaagtcgaag aagactacta ctataaacga cgaagatcat       180
     tacttcaatc ttcaatcgag cttttaaatt ttcagatcgt agaagaaaat cgaacttttg       240
     attccaaaag cgatgagacc gattcaatcg cctccaggag tttccgttcc ggtgaaaagc       300
     cgtccccgtc gccgtcctga tcttacctta ccgcttcctc aacgcgatgt ttctctcgct       360
     gtacctcttc ctctcccacc tacttccggt ggttccggtg gctctagtgg atctgcgccg       420
     tcttctggtg gttcggcgtc ttcaacgaac actaacagct ccatagaagc gaagaactat       480
     tcggatttag tgagaggtaa ccgtatcgga agcggagcag gtggaacggt atacaaagtg       540
     attcaccgtc cgagttctcg tctatatgca cttaaggtga tatacggtaa ccacgaggag       600
     actgtgagac gtcagatctg tagagagatc gagattttac gagatgtgaa tcatccaaac       660
     gttgtgaaat gtcacgagat gtttgatcag aacggtgaga tccaggtttt gcttgagttt       720
     atggataaag gttctttaga aggtgctcat gtgtggaaag agcaacaatt agctgatcta       780
     tctcgtcaga ttcttagtgg tttagcttat ctccatagcc gtcacatagt tcatcgtgat       840
     atcaaaccat cgaatctttt gataaactct gctaaaaacg ttaagattgc tgattttgga       900
     gttagtagga tcttggctca gactatggat ccgtgtaatt catctgttgg aaccattgct       960
     tatatgagtc ctgagaggat taacactgat ttgaatcagg gaaagtatga tggttatgct      1020
     ggagatattt ggagcttagg tgttagcatt ttggagtttt acttggggag gtttcctttc      1080
     cctgtgagta gacaaggtga ttgggctagt cttatgtgtg ccatttgtat gtctcagcct      1140
     ccagaagctc cagcgactgc gtcgccggag tttcggcatt ttatctcgtg ttgcttgcag      1200
     agagaaccgg ggaaaaggag gagtgctatg cagctattgc agcatccttt catattaaga      1260
     gcaagtccga gccagaacag gtctcctcag aatctacatc aactcttgcc tcctcctcgt      1320
     cctctgtcct cgtcttcttc tccaaccaca tagcgttttc tctcttcttc ccttcatcaa      1380
     ctcatatttt ttgtgttact actgttcttg agtctgttgt ccaatttttt gctaatcatg      1440
     gagggtctct gaattttaca tttattaggg agtaaaaaac tcgagagagg gtttttggga      1500
     ttattgtttt ctagaaaggt aaaagagaac aatgataata ttcttatgct tatgatggtg      1560
     catgtatccc caatgtagct ttgttgaatt ttcataaaag tttttgcc                   1608
//

If you have problems or comments...

PBIL Back to PBIL home page