(data stored in ACNUC21429 zone)

EMBL: AB015344

ID   AB015344; SV 1; linear; mRNA; STD; HUM; 1332 BP.
XX
AC   AB015344;
XX
DT   14-DEC-1998 (Rel. 58, Created)
DT   14-DEC-1998 (Rel. 58, Last updated, Version 1)
XX
DE   Homo sapiens HRIHFB2157 mRNA, partial cds.
XX
KW   HRIHFB2157.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1332
RA   Ueki N.;
RT   ;
RL   Submitted (08-JUN-1998) to the INSDC.
RL   Nobuhide Ueki, Helix Research Institute, Inc., Biological Technology Lab.;
RL   1532-3 Yana, Kisarazu, Chiba 292-0812, Japan (E-mail:ueki@hri.co.jp,
RL   Tel:81-438-52-3951, Fax:81-438-52-3952)
XX
RN   [2]
RX   DOI; 10.1038/4315.
RX   PUBMED; 9853615.
RA   Ueki N., Oda T., Kondo M., Yano K., Noguchi T., Muramatsu M.A.;
RT   "Selection system for genes encoding nuclear-targeted proteins";
RL   Nat. Biotechnol. 16(13):1338-1342(1998).
XX
DR   MD5; a0ac301d29cf59a1c8d7fd6fd4db41ce.
DR   Ensembl-Gn; ENSG00000188021; homo_sapiens.
DR   Ensembl-Tr; ENST00000338222; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1332
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /dev_stage="fetus"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        <1..1227
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="HRIHFB2157"
FT                   /db_xref="GOA:Q9UHD9"
FT                   /db_xref="H-InvDB:HIT000058423.11"
FT                   /db_xref="HGNC:HGNC:12509"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015496"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR028430"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR041243"
FT                   /db_xref="PDB:1J8C"
FT                   /db_xref="PDB:2NBV"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UHD9"
FT                   /protein_id="BAA34801.1"
FT                   /translation="RNPEISHLLNNPDIMRQTLEIARNPAMMQEMMRNQDLALSNLESI
FT                   PGGYNALRRMYTDIQEPMLNAAQEQFGGNPFASVGSSSSSGEGTQPSRTENRDPLPNPW
FT                   APPPATQSSATTSTTTSTGSGSGNSSSNATGNTVAAANYVASIFSTPGMQSLLQQITEN
FT                   PQLIQNMLSAPYMRSMMQSLSQNPDLAAQMMLNSPLFTANPQLQEQMRPQLPAFLQQMQ
FT                   NPDTLSAMSNPRAMQALMQIQQGLQTLATEAPGLIPSFTPGVGVGVLGTAIGPVGPVTP
FT                   IGPIGPIVPFTPIGPIGPIGPTGPAAPPGSTGSGGPTGPTVSSAAPRETTSPTSESGPN
FT                   QQFIQQMVQALAGANAPQLPNPEVRFQQQLEQLNAMGFLNREANLQALIATGGDINAAI
FT                   ERLLGSQPS"
XX
SQ   Sequence 1332 BP; 359 A; 389 C; 309 G; 275 T; 0 other;
     agaaacccag aaatcagtca cctgctcaac aacccagaca taatgaggca gacactcgaa        60
     attgccagga atccagccat gatgcaagag atgatgagaa atcaagacct ggctcttagc       120
     aatctagaaa gcatcccagg tggctataat gctttacggc gcatgtacac tgacattcaa       180
     gagccgatgc tgaatgccgc acaagagcag tttgggggta atccatttgc ctccgtgggg       240
     agtagttcct cctctgggga aggtacgcag ccttcccgca cagaaaatcg cgatccacta       300
     cccaatccat gggcaccacc gccagctacc cagagttctg caactaccag cacgaccaca       360
     agcactggta gtgggtctgg caatagttcc agcaatgcta ctgggaacac cgttgctgcc       420
     gctaattatg tcgccagcat ctttagtacc ccaggcatgc agagcctgct gcaacagata       480
     actgaaaacc cccagctgat tcagaatatg ctgtcggcgc cctacatgag aagcatgatg       540
     cagtcgctga gccagaatcc agatttggct gcacagatga tgctgaatag cccgctgttt       600
     actgcaaatc ctcagctgca ggagcagatg cggccacagc tcccagcctt cctgcagcag       660
     atgcagaatc cagacacact atcagccatg tcaaacccaa gagcaatgca ggctttaatg       720
     cagatccagc aggggctaca gacattagcc actgaagcac ctggcctgat tccgagcttc       780
     actccaggtg tgggggtggg ggtgctggga accgctatag gccctgtagg cccagtcacc       840
     cccataggcc ccataggccc tatagtccct tttaccccca taggccccat tgggcccata       900
     ggacccactg gccctgcagc cccccctggc tccaccggct ctggtggccc cacggggcct       960
     actgtgtcca gcgctgcacc tagagaaacc acgagtccta catcagaatc tggacccaac      1020
     cagcagttca ttcagcaaat ggtgcaggcc ctggctggag caaatgctcc acagctgccg      1080
     aatccagaag tcagatttca gcaacaactg gaacagctca acgcaatggg gttcttaaac      1140
     cgtgaagcaa acttgcaggc cctaatagca acaggaggcg acatcaatgc agccattgaa      1200
     aggctgctgg gctcccagcc atcgtaatca catttctgta cctggaaaaa aaatgtatct      1260
     tatttttgat aatggctctt aaatctttaa acacacacac aaaatcgtct ttactttcat      1320
     tttgattctt tt                                                          1332
//

If you have problems or comments...

PBIL Back to PBIL home page