(data stored in ACNUC8465 zone)

EMBL: AB019374

ID   AB019374; SV 1; linear; mRNA; STD; MUS; 2259 BP.
XX
AC   AB019374;
XX
DT   04-JUL-1999 (Rel. 60, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus mRNA for MEK5, complete cds.
XX
KW   MEK5.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2259
RA   Kamakura S., Moriguchi T., Nishida E.;
RT   ;
RL   Submitted (29-OCT-1998) to the INSDC.
RL   Sachiko Kamakura, Kyoto University, Department of Biophysics, Graduate
RL   School of Science; Kitashirakawa-Oiwake-chou, Sakyo-ku, Kyoto, Kyoto
RL   606-8502, Japan (E-mail:skamakura@nishidaCentris.biophys.kyoto-u.ac.jp,
RL   Tel:+81-75-753-4236)
XX
RN   [2]
RX   DOI; 10.1074/jbc.274.37.26563.
RX   PUBMED; 10473620.
RA   Kamakura S., Moriguchi T., Nishida E.;
RT   "Activation of the protein kinase ERK5/BMK1 by receptor tyrosine kinases.
RT   Identification and characterization of a signaling pathway to the nucleus";
RL   J Biol Chem 274(37):26563-26571(1999).
XX
DR   MD5; 58caf17bf3eebef32d6505ddc2af4109.
DR   Ensembl-Gn; ENSMUSG00000058444; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034928; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0034908; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0034838; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034901; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034611; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0035420; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033932; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0034582; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0034741; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0034683; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0034824; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034726; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0035442; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033636; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034045; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000034920; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0092762; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0092839; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0092788; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0092762; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0092341; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0093287; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0092951; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0092270; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0092477; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0092323; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0092493; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0092323; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0093603; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0092373; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0091361; mus_musculus_wsbeij.
DR   EuropePMC; PMC33252; 11320206.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2259
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        597..1943
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="Mek5"
FT                   /product="MEK5"
FT                   /db_xref="GOA:Q9WVS7"
FT                   /db_xref="InterPro:IPR000270"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR034851"
FT                   /db_xref="MGI:MGI:1346345"
FT                   /db_xref="PDB:1WI0"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WVS7"
FT                   /protein_id="BAA82040.1"
FT                   /translation="MLWLALGPFCAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVL
FT                   DVIGQVLPEATTTAFEYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQI
FT                   FPRACKPPGERNIHGLKVNTRAGPSQHTSPVVSDSLPSNSLKKSSAELRKILANGQMNE
FT                   QDIRYRDTLGHGNGGTVYKAHHVPSGKILAVKVILLDITLELQKQIMSELEILYKCDSS
FT                   YIIGFYGAFFVENRISICTEFMDGGSLDVYRKIPEHVLGRIAVAVVKGLTYLWSLKILH
FT                   RDVKPSNMLVNTGGQVKLCDFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVW
FT                   SLGISFMELALGRFPYPQIQKNQGSLMPLQLLQCIVDEDSPVLPLGEFSEPFVHFITQC
FT                   MRKQPKERPAPEELMGHPFIVQFNDGNSTVVSMWVCRALEERRSQQGPP"
FT   polyA_site      2259
FT                   /note="19 A nucleotides"
XX
SQ   Sequence 2259 BP; 512 A; 618 C; 594 G; 535 T; 0 other;
     ccacctccgc tgccgggacg cgggcctcag tcggacgatc ctgcacgcgc cgcgccctcc        60
     ggttccggct gcggtccggg acccgcccct tgaccccgcg gccctgggcc cccctgcctg       120
     gttggagggc aggcgccacc ggtgcacctc cgaaacagcc ccgacccagc ccgcggcgcc       180
     cggccaccgt ccccttgccc accgagacac tcaggacggc aggaccctgg ccactgtacc       240
     tgccttaaac caggccgttg ctccgctgtc tcctcttact cacaaggact acagaatgct       300
     tgtgggttct gttttgtcca cttttgtaac tccaggacct tccgctctct actaattcct       360
     cttggccggt cccccaacag tgcatcctct cctagggaca ctccacacga cctgggcctg       420
     gttttgggcc tgcaagctcc ctcctgatcg ctcctcttca cttctcccca tcttcttgct       480
     ccctatttat cgcctgcctt ctgtctatcg ttccccttgt cacttcttgg ggctcctcct       540
     aagtaggggc aggtcggtac cccttcgccc caggatgtga gaccctttaa cctgtaatgc       600
     tgtggctggc ccttggcccc ttctgtgcca tggagaacca ggtgctggtg attcggatca       660
     agattccaaa tagtggcgcg gtggactgga ccgtgcactc cgggccgcag ttactcttca       720
     gggatgttct ggatgtgata ggccaggttc tgcctgaagc gacgacgaca gcgtttgaat       780
     atgaagatga agatggtgat aggattacag taagaagcga tgaagagatg aaggcaatgc       840
     tgtcctacta ttattccaca gtaatggaac agcaagtaaa tggccagcta atagagccgc       900
     tgcagatatt tccaagagcc tgcaagcctc ccggggaacg gaacatacat ggcctgaagg       960
     tgaatacacg ggctgggcca tctcaacaca ccagccctgt ggtctcagat tcgcttccaa      1020
     gcaatagctt gaagaagtcc tcagctgaac tgagaaagat actggccaac ggccagatga      1080
     atgaacaaga catacggtat cgagacaccc ttggtcatgg caacggaggc acagtctaca      1140
     aagcacatca tgtcccaagt gggaaaattt tagctgtaaa ggttattctg ttagacatta      1200
     cactggagct tcagaagcag atcatgtctg agctggaaat cctttataag tgtgactcat      1260
     cgtatatcat aggattttac ggggcatttt tcgtagaaaa caggatttca atttgtacag      1320
     aattcatgga tggggggtct ttggatgtat ataggaaaat tccagagcac gtccttggaa      1380
     gaattgcagt tgcagttgtt aaaggcctta cctatctgtg gagtttaaag attttacaca      1440
     gagatgtgaa gccctccaac atgcttgtaa acacaggcgg acaggtcaag ctgtgtgact      1500
     ttggcgtgag cacacagctg gtgaattcta tagccaagac gtatgttgga acaaatgctt      1560
     acatggcacc agaaagaatt tcaggagagc agtatgggat ccattctgac gtgtggagct      1620
     taggaatctc tttcatggag cttgctcttg ggaggtttcc atatcctcag attcagaaaa      1680
     accagggatc tttaatgcct ctccagcttc tgcagtgcat tgttgatgag gattcgccgg      1740
     tccttccgct tggagagttc tcggagccgt ttgtacattt catcactcag tgcatgagga      1800
     agcagcccaa ggagagaccg gcgcctgagg agctgatggg tcacccattc atcgtgcagt      1860
     tcaatgatgg aaactccact gtggtgtcca tgtgggtgtg ccgagctcta gaggagaggc      1920
     ggagccagca gggacccccg tgagacctca gcaggacact gaccactgag gaccagtcat      1980
     catgacacag caagccgtga cccctctgtc tgctgtactg gcccagcctc ctgctcgcac      2040
     ctcctgccct acctaggaag ccctccagag ggccagcctc tgctgagcgg gggaagtggg      2100
     cactgactac agcaggtgga gatggtgcag ggcggggtga tgaggttata aaactatgga      2160
     acctcctctg gccccacccc cttatctttc cctactgttc attgtaaagg gtcaggccct      2220
     atcagcagca ctgatgggaa taaaagtatt attgctttg                             2259
//

If you have problems or comments...

PBIL Back to PBIL home page