(data stored in ACNUC9543 zone)

EMBL: AB020237

ID   AB020237; SV 1; linear; genomic DNA; STD; MUS; 4456 BP.
XX
AC   AB020237;
XX
DT   10-MAY-1999 (Rel. 59, Created)
DT   10-MAY-1999 (Rel. 59, Last updated, Version 1)
XX
DE   Mus musculus gene for ribosomal protein L27A, complete cds.
XX
KW   ribosomal protein L27A.
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4456
RA   Kusuda J.;
RT   ;
RL   Submitted (18-NOV-1998) to the INSDC.
RL   Jun Kusuda, National Institute of Infectious Diseases, Division of Genetic
RL   Resources; 1-23-1, Toyama-cho, Shinjuku-ku, Tokyo 162-8640, Japan
RL   (E-mail:jkusuda@nih.go.jp, Tel:81-3-5285-1111(ex.2122), Fax:81-3-5285-1181)
XX
RN   [2]
RA   Kusuda J., Hirai M., Tanuma R., Hirata M., Hashimoto K.;
RT   "Genomic structures and chromosomal localizations of the human and mouse
RT   ribosomal protein L27A genes";
RL   Unpublished.
XX
DR   MD5; 2e4db8f1b57c5c90bc2153bb3888c79c.
DR   Ensembl-Gn; ENSMUSG00000046364; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032842; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0032826; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0032757; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032830; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032540; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033336; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031868; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0032513; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0032665; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0032618; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0032759; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032650; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033357; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031575; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031981; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000143107; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0085815; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0085891; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0085832; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0085856; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0085415; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0086357; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0085933; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0085358; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0085552; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0085403; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0085598; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0085445; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0086644; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0085338; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0084463; mus_musculus_wsbeij.
DR   RFAM; RF00334; SNORA3.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4456
FT                   /organism="Mus musculus"
FT                   /mol_type="genomic DNA"
FT                   /clone="MRPL27A-4"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        join(1138..1140,1503..1566,1836..1911,2383..2557,
FT                   3514..3642)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="RPL27A"
FT                   /product="ribosomal protein L27A"
FT                   /db_xref="GOA:P14115"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="MGI:MGI:1347076"
FT                   /db_xref="UniProtKB/Swiss-Prot:P14115"
FT                   /protein_id="BAA77362.1"
FT                   /translation="MPSRLRKTRKLRGHVSHGHGRIGKHRKHPGGRGNAGGMHHHRINF
FT                   DKYHPGYFGKVGMRHYHLKRNQSFCPTVNLDKPWTLVSEQTRVNAAKNKTGVAPIIDVV
FT                   RSGYYKVLGKGKLPKQPVIVKAKFFSRRAEEKIKGVGGACVLVA"
XX
SQ   Sequence 4456 BP; 1168 A; 1000 C; 1166 G; 1122 T; 0 other;
     cacccatagt atcaccaaca ggactgcctg aataggagct gaacaaggac agccatagat        60
     atgctattac agcccacacg agaaagttcg agaccatcat gcctagccaa tcgattagga       120
     gtgtaactcc agcagtcagg aggtacaagg ccagccttgg cttcagagta agaccctgtc       180
     tcaaaacaaa tacaagatct tgaggaaatg gtgtggctaa agtcaaactg cccagattgt       240
     aatggactaa acaccgagca agaagctagc agacagacag gatttgccca ctctgctttc       300
     tgagagtttt gactagaata ttctttagtt taacggatca agtaagaaac aataaaacag       360
     attaaggggt tagaatcttg tgcacaagtg tccacttttg ttagcaagca ggctacacgc       420
     caggaactca tggatttaaa aggaaaacaa gcaaaattgc ccagtcctga acccttagag       480
     aatctgggct ctatcgggaa gaaaaatgta acttggcaat tagaagttac aagtgtgata       540
     gttcgagtaa acaagtaaca aaacaggtcc aagaaggtcg acacggaaaa tacttgtatg       600
     aggagcacgc tgggctggga acctcgggtc caggggagta aaagcatacc agccagagtc       660
     tggagaaaat tcaaatgtga tgtttataca aaatagttac agaatctaga tccctgaagc       720
     acagaaggct gttcaaattt ggcaggacat gaagagagga ccagagcaaa agagaagggc       780
     agtgtccctt taagggacgt cagaggccct gcggaagtct tgccgatgct ctgagccacc       840
     gccattgctg cccggagaca aaaaccaacc gcaccagaaa agaacagtgc actccgacga       900
     tgaccggccg cagcggcgct cgactaggga ggagctaccg gggcttccgg gggcgggcgc       960
     caccggttca ccccgcccat ccacacggaa aggaagaggc gggcgccggg agccgtgacg      1020
     tcaggagccc ttcccgaagc cggcctcctg gccggaaatg aagcattggt cccgcccccg      1080
     cgcctgctac ctcgcgagac ttcgtgagct cctccctttt ccctttctgc caccgccatg      1140
     gtaggtcttc tcttggcctc cgctccatcg cggagggtcg gggctctgct tcccagcctt      1200
     tcagctgctt gctatggtcc tagtgggtct ccatggctgg gcgtagcctg cggggcggga      1260
     tgacccactc gggtgtgggg cgaggaacgt ggggccgcgt gttccgacca gagctgggat      1320
     cgcgtggacg tgcgggcccg ggcggctgag cacgctctga gtcccggcct cggcttagcc      1380
     ggtgctccag aaggcaagtc ctcgtgtgca ggcctgatcc gggcaggcag gcattgctgc      1440
     cctctccccg gtctccccat cctctaagca ggcctaacca ctttgctgtt tttcccacgc      1500
     agccatccag actgaggaag acccggaaac tccggggcca cgtgagccac ggccacggcc      1560
     gcatcggtaa gtgtgcgcct cctcggcgtt tggcctttgg agttttgttg gaaagtagac      1620
     atccgtgggt ggaaggaaac acttgcagtt cccctacttt atgttggtag cggggtgaga      1680
     gttaaacaca tgccgctggg atgtgaaatg ccgtaaatgt tccttctatc cccgagtctt      1740
     gataaatcgg gcttagaaac ggatggtaaa ctgagagcag gaataagggc atgtgagcag      1800
     ctataagtca cacaagttgc tttgtgtgcc gacaggtaag caccgcaagc acccaggcgg      1860
     ccgcgggaat gctggaggca tgcaccacca caggatcaac tttgacaaat agtgatgttt      1920
     tggagtgggg gctgaagggg tgagttagga cggtgtctcc ctggaaacgg gcttcttacc      1980
     tttggtatgg ctagctttag caagtaaacg ctgcacttga actgagggga cctgtccgag      2040
     gctagagtca cgctcaggta ttgcttgttg ccttagtgtg cttaagtcct cgaagaataa      2100
     ctgctgacct tattcactgg ctgtgtggac tttctggcac agtcagtcac caggttagtg      2160
     acatatgtca agttaaccca ttcaaagtta cgttgcaccc tatttaggga atcctttaag      2220
     gagtgggggt gctactgagt gacctgactt ttagttcaaa aattgtatct ggtgcctgct      2280
     gtgtcaatgt ttacagtagt gaacacttac actcactagg agacaactac aaagataagt      2340
     tttctcagtg aggctctgaa gatggttgcc ttccctcccc agtcacccag gttactttgg      2400
     gaaagttggt atgcggcatt accacttgaa gaggaaccag agcttctgcc caacagtcaa      2460
     cttggataaa ccgtggacat tggtcagcga gcaaacacgg gtcaatgcgg caaaaaacaa      2520
     aactggagtt gctcccatca ttgatgttgt tcgatcagtg agtgaactga cttgccattc      2580
     gttttaaaag attttatgta tatgagaaca ctcttcagag aaaaacaaca gaaaagggca      2640
     tcggatccca ttatgtatgg atggttgtga gctaccatgt ggttgctggg aattgaacac      2700
     aggctctctg gaagtccagt cagtacttag agctgagcca tctctccagc agcctgcctt      2760
     gtcactctta atgggacctt taatacacgg tcttatttga aagccaaacc tatatataca      2820
     tttggccatt acctattaga aaattttagt agaattgttg caggtgattg aattggtcac      2880
     atgctaataa ctcttcctct gcttggttcc cacttgtttc catttctaac aggtttgctt      2940
     tttgaggtat atagttggtc cagaatggtc ttaaggcaca tcctggcttt tttttttttt      3000
     ttgcaggtta aagtgttcat tatttaaggc ccaaaattgt ttaaagtccc ccaatccccc      3060
     cccccccaaa aaaaaaacca caccagccta agtgcagaga cccaaaccac agggaggctt      3120
     tcatgggccc atcattccta acctactata tttagtaggg tgtaactggt caggagtggg      3180
     ggggggtgtt tggccgaggc tagagtcaca tcctgacatg gtgcttgtcc tggtgtgcta      3240
     cagttctcgg agagaatcgc tggtcttgat tcattggtag gggccttcag tgtcccttct      3300
     agtgcccaga tcagaaacat ggcctatctg ggctggcata tgctatactc tcaactatgg      3360
     aggtgtagtt ggtgaatctc tatgatccca tattgatcta catttgagtt agaggccagg      3420
     ctttacatac ctgaaaaggg ggaataagtc aagtcctacc tgaatcttgg ggtgttatgt      3480
     gtctgatgta tgttgtgaat ctttctatta tagggctact acaaagttct gggcaaggga      3540
     aagctcccta agcaacctgt catcgtgaag gccaaattct tcagcagaag agctgaggag      3600
     aagattaagg gtgttggagg tgcctgtgtt ctggtggctt aaaagccaca ccggaggtta      3660
     attaaatgct aacattttcc atgtggtctt tgcatccttc cttgtctgca tgttggaaat      3720
     ctgcctaaca ttctaggaag aggtgaggtg tgggcccttg agagtcagtc tgtgggaata      3780
     agtgtagccc aactatgcac agttgtaaat tcctacatcc ccgtgtgtat tggtcttgat      3840
     attcaaagaa ttgatgaatg ccattacttt cagtccaaag tgaagaaacc tggtctcaaa      3900
     aaatcccgag gaccagaaat gagatgggtt ttcctgaaaa tctaaagttc ttgaaaaacc      3960
     ttgccatcca gattgctagc aactgcctag ctttgtaagc ttactgtgat ggacaggtag      4020
     ctcaggacga ctggtcactt aatactggac agattagcat ggaaaactta aggggaggag      4080
     gaggtagtag gttccatcca gcttcgcttt gttggggcat ctaggtgttg ttccaaggga      4140
     gcatgcctac ctgcaacagg acatcactgg ttgggaatac tgtagaacca gagctgtgac      4200
     ctttgaacta ctagaaagat gaaattttat gtaaagagta ccttggagta aataaataaa      4260
     gcccaagatc ctgattgtct acatctttaa atctggaagt ttttagggag taggttgtgt      4320
     atgcttagta ctgacgctgc tttagtagac aagtgcgtag taagaggcag tataagttgg      4380
     gtcactaaat acggaaaaat tcattttaag atgtgttggg ggacaaaaga cttctggctc      4440
     tagagataat actgtg                                                      4456
//

If you have problems or comments...

PBIL Back to PBIL home page