(data stored in ACNUC24361 zone)

EMBL: AB023232

ID   AB023232; SV 1; linear; mRNA; STD; HUM; 4284 BP.
XX
AC   AB023232;
XX
DT   09-APR-1999 (Rel. 59, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens mRNA for KIAA1015 protein, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-4284
RA   Ohara O., Nagase T., Kikuno R.;
RT   ;
RL   Submitted (04-FEB-1999) to the INSDC.
RL   Osamu Ohara, Kazusa DNA Research Institute, Laboratory of DNA Technology;
RL   Yana 1532-3, Kisarazu, Chiba 292-0812, Japan (E-mail:cdnainfo@kazusa.or.jp,
RL   Tel:+81-438-52-3913, Fax:+81-438-52-3914)
XX
RN   [2]
RX   DOI; 10.1093/dnares/6.1.63.
RX   PUBMED; 10231032.
RA   Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M., Miyajima N.,
RA   Tanaka A., Kotani H., Nomura N., Ohara O.;
RT   "Prediction of the coding sequences of unidentified human genes. XIII. The
RT   complete sequences of 100 new cDNA clones from brain which code for large
RT   proteins in vitro";
RL   DNA Res. 6(1):63-70(1999).
XX
DR   MD5; ab01ecff1afceea51ad0972b4a667bc9.
DR   Ensembl-Gn; ENSG00000196652; homo_sapiens.
DR   Ensembl-Tr; ENST00000326775; homo_sapiens.
DR   Ensembl-Tr; ENST00000394170; homo_sapiens.
DR   Ensembl-Tr; ENST00000451158; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4284
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone_lib="pBluescriptII SK plus"
FT                   /clone="hk03609"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        <187..2712
FT                   /codon_start=1
FT                   /gene="KIAA1015"
FT                   /product="KIAA1015 protein"
FT                   /note="Start codon is not identified"
FT                   /note="hk03609 cDNA clone for KIAA1015 has a 136-bp
FT                   deletion at position between827 and 964 of the sequence of
FT                   KIAA1015."
FT                   /db_xref="GOA:Q9Y2L8"
FT                   /db_xref="H-InvDB:HIT000000732.17"
FT                   /db_xref="HGNC:HGNC:12867"
FT                   /db_xref="InterPro:IPR001909"
FT                   /db_xref="InterPro:IPR003309"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036051"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="InterPro:IPR038269"
FT                   /db_xref="PDB:2EM5"
FT                   /db_xref="PDB:2EMM"
FT                   /db_xref="PDB:2EMZ"
FT                   /db_xref="PDB:2EN3"
FT                   /db_xref="PDB:2EOM"
FT                   /db_xref="PDB:2EON"
FT                   /db_xref="PDB:2EOO"
FT                   /db_xref="PDB:2YSO"
FT                   /db_xref="PDB:2YTG"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Y2L8"
FT                   /protein_id="BAA76859.2"
FT                   /translation="VGMIMTESREVIDLDPPAETSQEQEDLFIVKVEEEDCTWMQEYNP
FT                   PTFETFYQRFRHFQYHEASGPREALSQLRVLCCEWLRPELHTKEQILELLVLEQFLTIL
FT                   PEEFQPWVREHHPESGEEAVAVIENIQRELEERRQQIVACPDVLPRKMATPGAVQESCS
FT                   PHPLTVDTQPEQAPQKPRLLEENALPVLQVPSLPLKDSQELTASLLSTGSQKLVKIEEV
FT                   ADVAVSFILEEWGHLDQSQKSLYRDDRKENYGSITSMGYESRDNMELIVKQISDDSESH
FT                   WVAPEHTERSVPQDPDFAEVSDLKGMVQRWQVNPTVGKSRQNPSQKRDLDAITDISPKQ
FT                   STHGERGHRCSDCGKFFLQASNFIQHRRIHTGEKPFKCGECGKSYNQRVHLTQHQRVHT
FT                   GEKPYKCQVCGKAFRVSSHLVQHHSVHSGERPYGCNECGKNFGRHSHLIEHLKRHFREK
FT                   SQRCSDKRSKNTKLSVKKKISEYSEADMELSGKTQRNVSQVQDFGEGCEFQGKLDRKQG
FT                   IPMKEILGQPSSKRMNYSEVPYVHKKSSTGERPHKCNECGKSFIQSAHLIQHQRIHTGE
FT                   KPFRCEECGKSYNQRVHLTQHQRVHTGEKPYTCPLCGKAFRVRSHLVQHQSVHSGERPF
FT                   KCNECGKGFGRRSHLAGHLRLHSREKSHQCRECGEIFFQYVSLIEHQVLHMGQKNEKNG
FT                   ICEEAYSWNLTVIEDKKIELQEQPYQCDICGKAFGYSSDLIQHYRTHTAEKPYQCDICR
FT                   ENVGQCSHTKQHQKIYSSTKSHQCHECGRGFTLKSHLNQHQRIHTGEKPFQCKECGMNF
FT                   SWSCSLFKHLRSHERTDPINTLSVEGSLL"
XX
SQ   Sequence 4284 BP; 1195 A; 1005 C; 1073 G; 1011 T; 0 other;
     caggggagag agtggctccg tttgcctccc cgctttggtg atgctgtgcg agcggcttcg        60
     ggggccctgg agacgtccga gtcactgagg gtgggctggg actcggggcc cgcgtcccat       120
     ctccccgccg attggtccgc cccccgtgcg agtgtaacac agccagcctc gaagacttcc       180
     ctctgagttg gaatgataat gaccgaatcc cgagaagtta tagacttaga ccccccagct       240
     gagacttccc aggagcagga agaccttttc atagtgaagg tggaagaaga agactgcacc       300
     tggatgcagg agtacaaccc gccaacgttt gagacttttt accagcgctt caggcacttc       360
     cagtaccatg aggcttcagg accccgggag gctctcagcc aactccgggt gctctgctgt       420
     gagtggctga ggcccgagct gcacacgaag gagcagatcc tggagctgct ggtgctggag       480
     cagttcctga ccatcctgcc tgaagagttc cagccctggg tgagggaaca tcaccctgaa       540
     agtggagaag aggcggtggc cgtgatagaa aatatacagc gagaacttga ggaacgcaga       600
     cagcagattg ttgcctgccc tgatgtgctt cctcggaaga tggcaacacc tggagcagtg       660
     caggagtcct gcagccccca tcccctgacc gtggacaccc agcctgagca agcgccacag       720
     aagcctcgtc tcctggagga aaatgccctt cctgttctcc aagttccttc ccttcccctg       780
     aaggacagcc aggagctgac agcttcactt ctctcaactg ggtcccagaa gttggtgaaa       840
     attgaagagg tggctgatgt ggctgtatcc ttcatcctgg aggaatgggg gcatttggac       900
     cagtcccaga agtcccttta tagggatgac aggaaggaga actatgggag tattacttcc       960
     atgggttatg agtccaggga caatatggag ctcatagtga agcagatttc tgatgactct      1020
     gaatcacact gggtggcgcc agaacacacc gaaaggagcg ttcctcagga tccagacttt      1080
     gcagaagtca gtgaccttaa aggcatggta caaaggtggc aggtcaaccc cactgtgggg      1140
     aaatcaaggc agaatccttc ccagaaaagg gatctggatg caatcacaga catcagccct      1200
     aagcaaagca cacatggcga gagagggcac agatgcagcg attgtggcaa attcttcctc      1260
     caagcctcaa actttattca gcatcggcgc atccacactg gagaaaaacc gtttaagtgc      1320
     ggagaatgtg ggaagagcta caatcagcgg gtgcacctca cccagcacca gcgcgtccac      1380
     acaggggaga aaccctacaa atgtcaggtg tgcggaaagg ctttccgggt gagttcccac      1440
     ctggttcagc accacagtgt ccacagcgga gagaggccct atggctgcaa tgagtgtggg      1500
     aagaacttcg gtcgccattc gcatctgatc gaacacctaa aacgccactt cagggagaaa      1560
     tcccagagat gcagtgacaa aagaagtaag aacacaaaat taagtgttaa gaagaaaatt      1620
     tcagaatatt cagaagcaga catggaacta tctggaaaaa cccaaagaaa tgtttctcaa      1680
     gttcaagatt ttggagaagg ctgtgagttt caaggcaagc tggatagaaa gcagggaatt      1740
     cccatgaaag agatactagg acaaccatct tcaaagagga tgaactacag tgaagtccca      1800
     tatgtccaca aaaaatcctc cactggagag agaccacata aatgtaacga gtgtgggaaa      1860
     agcttcattc agagtgcaca tcttattcaa catcaaagaa tacacactgg ggagaaacca      1920
     ttcaggtgtg aggaatgtgg gaaaagctac aaccaacgcg tgcacctaac tcagcatcag      1980
     cgcgtccaca caggtgagaa gccctacacc tgtcccttat gtgggaaagc cttcagagtg      2040
     aggtcccacc ttgttcagca tcagagcgtg cacagtgggg agagaccctt caagtgtaac      2100
     gaatgtggga aaggctttgg gaggcgttcc cacctggctg gacatcttcg actccactcc      2160
     cgagagaaat cccatcagtg tcgtgaatgt ggggaaatct tttttcagta cgttagccta      2220
     attgaacatc aggtgctcca catgggtcag aaaaatgaaa aaaatggcat ctgtgaggaa      2280
     gcatatagtt ggaacttgac agtgattgaa gacaagaaga ttgagttaca agagcagcct      2340
     tatcagtgtg atatctgtgg aaaagccttt ggttatagct cagacctcat tcagcattac      2400
     agaactcata cagcagagaa gccctatcaa tgtgatatat gtagagaaaa tgttggccag      2460
     tgttcccaca ccaaacaaca tcaaaaaatc tactccagca caaaatccca tcaatgtcat      2520
     gaatgtggta gaggcttcac tctgaagtca catcttaatc aacatcagag aatccatact      2580
     ggtgagaaac cttttcaatg taaagaatgt ggaatgaatt tcagctggag ttgtagcctc      2640
     tttaaacacc tgagaagcca tgagaggaca gatcccataa ataccttaag tgtagagggg      2700
     tctctgttgt agaatagctc ttaattttag agaaaccttc ctggagggaa accatactcc      2760
     tataatgagc aaagtaacaa cttcaagcat ttttccagcg ttaccatcaa actcacaaat      2820
     aggttgaaat cctttagtta taactcagcc tttaggaaca ccggagaacc cacaataata      2880
     gaaatctttt cgtgttcccc attgagaaat gctttagtta gcatcttcat gcttggaaat      2940
     ctagacaaga agagaatcca tggatggaca tggtcgagga attcggaaag cctgcagttg      3000
     acattcagtc ttcacttgaa actcaaaact gacactagga acagcttcat gagttcagta      3060
     gaagtaagct ttatttgtag cttctgcctt gtttgacggc gtatctattc agggaagcgc      3120
     acagtaaaag aattccttag catgatgtct gttttggtac ctcagcaatg aaccttttct      3180
     agaaattatt attccaacca ctagaatacc ctagtcacta ttcccacttt gagcattaac      3240
     ccctttgaaa agaaatggac ttaaagtatc tctgttttgg caaaattcag gttcaggggc      3300
     tggatggtat gtgtttctgc tgccttattc aatccaccac ttctctgtga aacactctac      3360
     cttgtttttg gtttgattct actgatgtca gggtttagcc ggtagaagga gtagttcagt      3420
     ttgtcaattc aggagaaact gtactggtca gtcacatctt acggcgaagg gagagggacc      3480
     ttaggggagc agagaagaca ggcaaagttg tggactgttt gatcttgtat tacccacagg      3540
     aatgagggca gctaaaccca tagaaggagt tggaccaagg cgaattacga gtcctggtcc      3600
     cagcagtatg tgtgctgact tctgggtgcc ccagaaatag acctctcctg tagagtggtg      3660
     atatacagaa tgagtttcag tttgcattgc agctgggatt gaaagtaatc agtcgtgagc      3720
     aggcaggcag gaggtcctgt tagccctgcc ttccaggaag gttggggtgg gagttttgag      3780
     tgggaaagag gatgacatgt gtgagagagt tctgagcctg tttgctaggg agagtgagtg      3840
     agtgctcttg ggcactgctc aggccgtttc tgctgacttg cctggcttac aataaatgcc      3900
     caataaatat ttgttgacca tatgtgttgt acactgtggt gccctgtcca gtcccctcta      3960
     ccaagctgag acccccatcc ccagctgctc tgagtttggg ctgcaagtgc tcacagctct      4020
     tgttctccag aaactggaga attgccctca ggagatgaga gccatctcac ctcacccagg      4080
     agtcacttcc tctctacacc ccaacacctg gttcatttga ttaaagcgga gaaaactcca      4140
     gggtgctatg actgctctgg cacccttgga tcaggccaag ctagactttt tctgagcctt      4200
     catccgtgct aagctctctc ccttctctat cctgtttcat tccctccctc aaaggcgttt      4260
     cccaaataaa tcacactgtc aatc                                             4284
//

If you have problems or comments...

PBIL Back to PBIL home page