(data stored in ACNUC31183 zone)

EMBL: AB028962

ID   AB028962; SV 1; linear; mRNA; STD; HUM; 5446 BP.
XX
AC   AB028962;
XX
DT   04-AUG-1999 (Rel. 60, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens mRNA for KIAA1039 protein, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-5446
RA   Ohara O., Nagase T., Kikuno R.;
RT   ;
RL   Submitted (17-JUN-1999) to the INSDC.
RL   Osamu Ohara, Kazusa DNA Research Institute, Laboratory of DNA Technology;
RL   Yana 1532-3, Kisarazu, Chiba 292-0812, Japan (E-mail:cdnainfo@kazusa.or.jp,
RL   Tel:81-438-52-3913, Fax:81-438-52-3914)
XX
RN   [2]
RX   DOI; 10.1093/dnares/6.3.197.
RX   PUBMED; 10470851.
RA   Kikuno R., Nagase T., Ishikawa K., Hirosawa M., Miyajima N., Tanaka A.,
RA   Kotani H., Nomura N., Ohara O.;
RT   "Prediction of the coding sequences of unidentified human genes. XIV. The
RT   complete sequences of 100 new cDNA clones from brain which code for large
RT   proteins in vitro";
RL   DNA Res. 6(3):197-205(1999).
XX
DR   MD5; dfd87ec9d40506ffc7617b39668cb96a.
DR   Ensembl-Gn; ENSG00000132359; homo_sapiens.
DR   Ensembl-Tr; ENST00000254695; homo_sapiens.
DR   Ensembl-Tr; ENST00000366401; homo_sapiens.
DR   Ensembl-Tr; ENST00000540393; homo_sapiens.
DR   Ensembl-Tr; ENST00000542807; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5446
FT                   /organism="Homo sapiens"
FT                   /chromosome="17"
FT                   /mol_type="mRNA"
FT                   /clone_lib="pBluescriptII SK plus"
FT                   /clone="fh02337"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        <1..1337
FT                   /codon_start=3
FT                   /gene="KIAA1039"
FT                   /product="KIAA1039 protein"
FT                   /db_xref="GOA:Q684P5"
FT                   /db_xref="H-InvDB:HIT000000756.16"
FT                   /db_xref="HGNC:HGNC:29176"
FT                   /db_xref="InterPro:IPR000331"
FT                   /db_xref="InterPro:IPR035974"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q684P5"
FT                   /protein_id="BAA82991.1"
FT                   /translation="FKEFLDLLGDTITLQDFKGFRGGLDVTHGQTGVESVYTTFRDREI
FT                   MFHVSTKLPFTDGDAQQLQRKRHIGNDIVAIIFQEENTPFVPDMIASNFLHAYIVVQVE
FT                   TPGTETPSYKVSVTAREDVPTFGPPLPSPPVFQKGPEFREFLLTKLTNAENACCKSDKF
FT                   AKLEDRTRAALLDNLHDELHAHTQAMLGLGPEEDKFENGGHGGFLESFKRAIRVRSHSM
FT                   ETMVGGQKKSHSGGIPGSLSGGISHNSMEVTKTTFSPPVVAATVKNQSRSPIKRRSGLF
FT                   PRLHTGSEGQGDSRARCDSTSSTPKTPDGGHSSQEIKSETSSNPSSPEICPNKEKPFMK
FT                   LKENGRAISRSSSSTSSVSSTAGEGEAMEEGDSGGSQPSTTSPFKQEVFVYSPSPSSES
FT                   PSLGAAATPIIMSRSPTDAKSRNSPRSNLKFRFDKLSHASSGAGH"
XX
SQ   Sequence 5446 BP; 1141 A; 1520 C; 1526 G; 1259 T; 0 other;
     cttttaagga gttcttggac ctgctggggg acacgatcac actgcaggat ttcaaaggtt        60
     tccgaggagg cctggacgtg acccacggac agacaggggt ggaatcagtg tacacaacat       120
     tccgggacag ggagatcatg tttcacgttt ccacaaagct gccatttacc gacggagacg       180
     cccagcagct ccagagaaag agacacattg gaaatgacat cgtggccatc atcttccaag       240
     aggaaaacac gccgtttgtc ccagacatga tagcctccaa tttcttacat gcctacatcg       300
     tcgtgcaggt cgagacccca ggcacagaga ccccatccta caaggtctct gtcactgcgc       360
     gggaagatgt gcccaccttt ggtccacctc tgcccagtcc ccccgttttc cagaagggcc       420
     cggaattcag ggagtttctg ctcaccaagc tcaccaatgc cgagaacgcc tgctgcaagt       480
     cggacaagtt tgcaaagctg gaggaccgga ccagggctgc cctcctggac aaccttcacg       540
     atgagctcca cgcccacaca caggccatgc tgggactggg cccagaggag gacaagtttg       600
     agaatggagg ccacgggggg ttcctggagt cttttaagag ggccatccgc gtacgcagcc       660
     actccatgga gaccatggtg ggcggccaga agaagtcgca cagtgggggc atccctggca       720
     gcctcagcgg gggcatctcc cacaacagca tggaggtcac caagaccacc ttctcgcctc       780
     cagtggtggc ggcaacggtg aagaaccagt cacggagtcc catcaagcga cgctcggggc       840
     tcttcccccg cctgcacacg ggctcagaag gccagggcga cagccgggca cgatgtgaca       900
     gcacatccag cacacccaag accccagatg gtggacactc ctctcaggag ataaagtctg       960
     agacctcatc caatcccagc tctccagaaa tctgccccaa caaggagaag cccttcatga      1020
     agttgaagga aaacggccgc gccatctccc gctcctcctc cagcaccagc agcgtcagca      1080
     gcactgcagg ggagggcgag gccatggagg agggcgacag tgggggcagc cagccgtcca      1140
     cgacctcacc cttcaagcag gaggtgtttg tctacagccc gtccccgagc agcgagagcc      1200
     ccagcctggg ggcagctgcc accccaatca tcatgagccg gagtcccaca gatgccaaaa      1260
     gcagaaactc cccgagatcg aacctgaaat tccgctttga caagctcagc catgccagct      1320
     ctggtgcggg tcactaatgt gaaagtggag tccttcgcct gtccaaggga atcccctctt      1380
     ctgtcctgga aaaggctcct gacctcccag tgtgatgtcc gggtccttta tcatcctatt      1440
     catcctggag aggaaaagtg tcgggcaaag ggggatctgg ggggagctca gcagtgactg      1500
     gggagctggt ctgcctcaga gacagagtag ggggtgggag cagagcctcg gtgagggtct      1560
     tggccacagg gcagtgcctt cctgaacgtg gcaggcttta ctaccaggaa cgcactcggt      1620
     ggtggaggcc ccatgttccc aggagccaag attcgtagca tccttgaggc catcctgata      1680
     aaattcggcg ctattgcccc cgtagctctg gagctctaaa ccgtctatct gcttctgtgc      1740
     tgaacgcctt tcccatctgc tgacgtaggc ccagggctgc cctgcccctg ctgccagtgt      1800
     accgtgagcg gggctccagc cagttcaagc tcagagccag agctggacgg gccagaactg      1860
     cgctgcacac ttcctggact gaggcgggga ctttgggtcc cacccggttt ctcctgatta      1920
     tggctgctgt ggggtgaggg gagggagggg cagccccgag gcagtctctt ccctttgaga      1980
     agatattttc ccacaaaggg gtgggaagcc aggagtgaga aggaattcag ggagagcaaa      2040
     ggagccagtg ctgagatgct gctgtgttgg ttgaggaaaa cctcgggcct gagggccagg      2100
     ccggagccca ggtctctgct gacaatgggg gttcaaggaa gacgtcgtta tctcccctcc      2160
     ccacttactc gaggagagag gtgagggggg gatgacttgc gggttctgat caggcccctg      2220
     ggtggggaag gggcacagtg tccctcagca gcttacgccc ctggagtctt ggggggccca      2280
     gcctggccct ggggcctttt ccagctactg tgcccttggg cagctgcgtc tggggctcaa      2340
     ccccccaatc ctgttcccct ctccagctgc gggtctgtag gcagctgtca catctgaagg      2400
     gtttctgcaa cctggacccc atctgggtgt gggtcagacc ctgtgaccca catgccaccc      2460
     ccaccctcca cagagccccc ttgctgggac agccagctca cctccaagga catcccctcc      2520
     tggcttctcc cccttccgag tctgcagcgc cgtgggcttc tctgccgatg ggcccgggtt      2580
     ggggttaagg tgggcatcct ccaggtacaa cgagcctgaa gagccccttt cagtgcagac      2640
     ggggctgcag agtgacactg gctgggcacc tgccccacga ccaatgacaa ggatttccag      2700
     ctgaatgctt tattcccata gggatctgga cctgtgccca agatataaat actacacttt      2760
     tttttttttt ttttttttaa ctgacattgt gaaattctcc ctatagcttt tgccattcaa      2820
     gcaacattgt gatctttctt ccccgccacg tgtgtgggaa tgattgagtc ctgtttgcaa      2880
     gctggagagg agctctccct tcgctagtac tttctctaaa gtactagtct agtaaaattt      2940
     attcttgtta gaaggtcaac aaaatatctg tttagctttt atgaagagtc accgtagcag      3000
     cccccacggc tggaaagagg cccgtacgtt ctggacgcgt tttgttggct gggcttctgg      3060
     aggcactggc aaggtcaaac tgcatttctt taagaacagt tgcaggatct ggcttgcctc      3120
     tgtgggaagc cggcattaca ggtgcttggt ggatgggccg tgtcacattg ccatctgggg      3180
     tcctttgggg tttccaggtt gtcagcatgc tgtcccattt gggaatccca tacctgcctg      3240
     tccccactgc gctggctgac ccttgctgcc tgctgcctct tgggagggct ttgtccctgc      3300
     ctctgagctg gtgggcagga tggctgggtg gcccccagag aagcacagac ctgggatggg      3360
     gtctccatgc ccggtttgct gttggaatga tctgaacagg accccaaatg cctcttccct      3420
     ctggtcatgc ctcactatct ctaggagctc catcctgtgg cttccagagt gtgcacttcc      3480
     agcccacccg ggcagtgctg agagggagga ggagaacaag gatggcccag cctcccctcc      3540
     ctcccctaga ccacggggcg ggcagctcgg gttcctggag ggctgtttcc cccacgctgt      3600
     ccctacatct gctctgatct aaaatgtctt tccttttatg ctgcgcccag tcttggggct      3660
     caaagatttg cccaaacctc attggccctc gtgactaggc tcatctagat ggtgctcacg      3720
     ctggtgtttg aggcatttcc actgtgatct ccacgagggg atgttttccg ggacacatct      3780
     ctggctctgg gaactgcctg actcactgaa gaaactactt ttcaggcact gtagggtcac      3840
     ccatatgcct ccagctcagt tgacgcttaa aaacaggtgc agaaaagctc gcgatggaag      3900
     gtcttaatga gagtgtctgt ctatgccagt catgtaaaat gacgtttctt gaaaaagatt      3960
     cagtggttca gctttgtcag catcatctca acacaagcct gctggctctt tttagcatct      4020
     catccaacca tgtcatcgtc cagatgagaa atcttagccc aggtgagggg aataacttgc      4080
     ttgaggtcac acagctggct gttggcaaag ctgggattag aaccctcaac ccagggtccc      4140
     ttcctctgca gcgcctacat ggttggttga ataagtggct gcgtttcctg gggccctggg      4200
     ttttggggaa gccagttagc tgctgctttg gcactggcat ggaggtgagc agtcaaggat      4260
     gctggtgagg ccgcagtttc tgctcttttt catcaggggg gatagtctct aggatttttc      4320
     agtgaggacc cttgggcttt ggatgcagct tgaaccaaga aaacgaggag ggaaagggat      4380
     tcagtgaact attcctcagt gggatcggtt cttcagctcc tgatgggggc tgtgtaatgg      4440
     gggcagaggc cagggaaaaa gatgctgttc acccaccctc agcttccctt ttcctaaatt      4500
     aagaggaaaa gtggtcaaag aaaaactctt catttctccc tgattcttaa gcgaaggtgg      4560
     ttaatagaaa ctcaggctcc cgtgacaagg caggacaaga gcctgtttcg ctttcctccc      4620
     tgaccctgcc aggtgccaac tcaaacacta cctttctcat tggtttctaa gtcagtagag      4680
     acagatctgt tttaagcagt tgggggttcg agtagatctc atgggtacag gaggccagca      4740
     gggaccaggc cagtcagcca tgctcaggac ccctcggctc ctcccccagc ctctagctac      4800
     cctgtatcga ggcaagggga ggccagtaaa gtttgccaag cctgatcctg cagcctggtg      4860
     gggctggctg gggtattctt ttaccaaact ctgttttacc gccagcccct tgtacacccc      4920
     aatcccatgt ctccctccct tcagctggac cgtgtgcccc tttgggagga agaagacaag      4980
     ccccactagg gccaagggca gcagagccct gccgagtgag aggctgtggg gcagcggctc      5040
     tgtcctgtgc cttaccagcc ctggggaggg ggacatttgg ctggaagact ggaatttaat      5100
     tgccatcgtc tttgattttg tgacatttct gcttggaagt gtgaactacc ctcccccccc      5160
     cgcttcctgc tccttagcat gcgtgcagct ctctcctgtt ttgggtgttc cccttggaca      5220
     ctccagctcg gggactgctg gcgtgtgaat gtgcagattc ccctgtgtgg tcgaacctaa      5280
     gaactgtggc ttggaagtga tgctccatgt gacgacgact ttgctttctt tcctcttagt      5340
     gaggaggtga ttcgtagatc ccaactgcct atgtaatgta aataatgtac atttaattta      5400
     ttgctatggt agcacattgt atttgttaat gtacaaaaca aattct                     5446
//

If you have problems or comments...

PBIL Back to PBIL home page