(data stored in ACNUC27125 zone)

EMBL: AB031085

ID   AB031085; SV 1; linear; mRNA; STD; HUM; 972 BP.
XX
AC   AB031085;
XX
DT   26-MAR-2000 (Rel. 63, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens mRNA for dihydrodiol dehydrogenase 4, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-972
RA   Nishizawa M., Ito S.;
RT   ;
RL   Submitted (14-AUG-1999) to the INSDC.
RL   Contact:Mikio Nishizawa Ritsumeikan University, College of Life Sciences,
RL   Department of Biomedical Sciences; Nojihigashi 1-1-1, Kusatsu, Shiga
RL   525-8577, Japan
XX
RN   [2]
RX   DOI; 10.1046/j.1365-2443.2000.00310.x.
RX   PUBMED; 10672042.
RA   Nishizawa M., Nakajima T., Yasuda K., Kanzaki H., Sasaguri Y., Watanabe K.,
RA   Ito S.;
RT   "Close kinship of human 20alpha-hydroxysteroid dehydrogenase gene with
RT   three aldo-keto reductase genes";
RL   Genes Cells 5(2):111-125(2000).
XX
DR   MD5; d0bfe947fd3d6aa5951cabbc26a3e64a.
DR   Ensembl-Gn; ENSG00000198610; homo_sapiens.
DR   Ensembl-Tr; ENST00000263126; homo_sapiens.
DR   Ensembl-Tr; ENST00000380448; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..972
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        1..972
FT                   /codon_start=1
FT                   /product="dihydrodiol dehydrogenase 4"
FT                   /note="AKR 1C4"
FT                   /note="DD4"
FT                   /note="Human DD4 is also known as human
FT                   3alpha-hydroxysteroid dehydrogenase (HSD) type 1 and
FT                   chlordecone reductase"
FT                   /db_xref="GOA:P17516"
FT                   /db_xref="H-InvDB:HIT000059026.12"
FT                   /db_xref="HGNC:HGNC:387"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="PDB:2FVL"
FT                   /db_xref="UniProtKB/Swiss-Prot:P17516"
FT                   /protein_id="BAA92885.1"
FT                   /translation="MDPKYQRVELNDGHFMPVLGFGTYAPPEVPRNRAVEVTKLAIEAG
FT                   FRHIDSAYLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCTFFQPQMVQPALESSLK
FT                   KLQLDYVDLYLLHFPMALKPGETPLPKDENGKVIFDTVDLSATWEVMEKCKDAGLAKSI
FT                   GVSNFNCRQLEMILNKPGLKYKPVCNQVECHPYLNQSKLLDFCKSKDIVLVAHSALGTQ
FT                   RHKLWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRENI
FT                   QVFEFQLTSEDMKVLDGLNRNYRYVVMDFLMDHPDYPFSDEY"
XX
SQ   Sequence 972 BP; 283 A; 223 C; 225 G; 241 T; 0 other;
     atggatccca aatatcagcg tgtagagcta aatgatggtc acttcatgcc cgtattggga        60
     tttggcacct atgcacctcc agaggttccg aggaacagag ctgtagaggt caccaaatta       120
     gcaatagaag ctggcttccg ccatattgat tctgcttatt tatacaataa tgaggagcag       180
     gttggactgg ccatccgaag caagattgca gatggcagtg tgaagagaga agacatattc       240
     tacacttcaa agctttggtg cactttcttt caaccacaga tggtccaacc agccttggaa       300
     agctcactga aaaaacttca actggactat gttgacctct atcttcttca tttcccaatg       360
     gctctcaagc caggtgagac gccactacca aaagatgaaa atggaaaagt aatattcgac       420
     acagtggatc tctctgccac atgggaggtc atggagaagt gtaaggatgc aggattggcc       480
     aagtccatcg gggtgtcaaa cttcaactgc aggcagctgg agatgatcct caacaagcca       540
     ggactcaagt acaagcctgt ctgcaaccag gtagaatgtc atccttacct caaccagagc       600
     aaactgctgg atttctgcaa gtcaaaagac attgttctgg ttgcccacag tgctctggga       660
     acccaacgac ataaactatg ggtggaccca aactccccag ttcttttgga ggacccagtt       720
     ctttgtgcct tagcaaagaa acacaaacga accccagccc tgattgccct gcgctaccag       780
     ctgcagcgtg gggttgtggt cctggccaag agctacaatg agcagcggat cagagagaac       840
     atccaggttt ttgaattcca gttgacatca gaggatatga aagttctaga tggtctaaac       900
     agaaattatc gatatgttgt catggatttt cttatggacc atcctgatta tccattttca       960
     gatgaatatt ag                                                           972
//

If you have problems or comments...

PBIL Back to PBIL home page