(data stored in ACNUC27125 zone)

EMBL: AB032163

ID   AB032163; SV 2; linear; genomic DNA; STD; HUM; 11711 BP.
XX
AC   AB032163; AB032158-AB032162;
XX
DT   26-MAR-2000 (Rel. 63, Created)
DT   09-APR-2008 (Rel. 95, Last updated, Version 5)
XX
DE   Homo sapiens DD4 gene for dihydrodiol dehydrogenase 4, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-11711
RA   Nishizawa M., Watanabe K., Ito S., Nakajima T.;
RT   ;
RL   Submitted (03-SEP-1999) to the INSDC.
RL   Contact:Mikio Nishizawa Ritsumeikan University, College of Life Sciences,
RL   Department of Biomedical Sciences; Nojihigashi 1-1-1, Kusatsu, Shiga
RL   525-8577, Japan
XX
RN   [2]
RX   DOI; 10.1046/j.1365-2443.2000.00310.x.
RX   PUBMED; 10672042.
RA   Nishizawa M., Nakajima T., Yasuda K., Kanzaki H., Sasaguri Y., Watanabe K.,
RA   Ito S.;
RT   "Close kinship of human 20alpha-hydroxysteroid dehydrogenase gene with
RT   three aldo-keto reductase genes";
RL   Genes Cells 5(2):111-125(2000).
XX
DR   MD5; da29f8703e433662c052261536f93981.
DR   Ensembl-Gn; ENSG00000198610; homo_sapiens.
DR   Ensembl-Tr; ENST00000263126; homo_sapiens.
DR   Ensembl-Tr; ENST00000380448; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..11711
FT                   /organism="Homo sapiens"
FT                   /chromosome="10"
FT                   /mol_type="genomic DNA"
FT                   /sex="male"
FT                   /dev_stage="adult"
FT                   /clone="lambda HHSD"
FT                   /tissue_lib="lambda EMBL3"
FT                   /tissue_type="liver"
FT                   /note="country:Japan"
FT                   /db_xref="taxon:9606"
FT   regulatory      3021..3026
FT                   /regulatory_class="TATA_box"
FT   CDS_pept        join(3081..3164,4607..4774,5544..5660,6924..7001,
FT                   7442..7564,8576..8685,8953..9118,9972..10054,11141..11183)
FT                   /codon_start=1
FT                   /gene="DD4"
FT                   /product="dihydrodiol dehydrogenase 4"
FT                   /note="3 alpha-hydroxysteroid dehydrogenase type 1"
FT                   /note="AKR 1C4"
FT                   /note="cDNA is reported in Acc #AB031085"
FT                   /db_xref="GOA:P17516"
FT                   /db_xref="HGNC:HGNC:387"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="PDB:2FVL"
FT                   /db_xref="UniProtKB/Swiss-Prot:P17516"
FT                   /protein_id="BAA92893.1"
FT                   /translation="MDPKYQRVELNDGHFMPVLGFGTYAPPEVPRNRAVEVTKLAIEAG
FT                   FRHIDSAYLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCTFFQPQMVQPALESSLK
FT                   KLQLDYVDLYLLHFPMALKPGETPLPKDENGKVIFDTVDLSATWEVMEKCKDAGLAKSI
FT                   GVSNFNCRQLEMILNKPGLKYKPVCNQVECHPYLNQSKLLDFCKSKDIVLVAHSALGTQ
FT                   RHKLWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRENI
FT                   QVFEFQLTSEDMKVLDGLNRNYRYVVMDFLMDHPDYPFSDEY"
FT   exon            3081..3164
FT                   /gene="DD4"
FT                   /product="dihydrodiol dehydrogenase 4"
FT                   /number=1
FT                   /note="AKR 1C4"
FT   gap             4134..4233
FT                   /estimated_length=unknown
FT   exon            4607..4774
FT                   /gene="DD4"
FT                   /product="dihydrodiol dehydrogenase 4"
FT                   /number=2
FT                   /note="AKR 1C4"
FT   gap             5036..5135
FT                   /estimated_length=unknown
FT   exon            5544..5660
FT                   /gene="DD4"
FT                   /product="dihydrodiol dehydrogenase 4"
FT                   /number=3
FT                   /note="AKR 1C4"
FT   exon            6924..7001
FT                   /number=4
FT   exon            7442..7564
FT                   /number=5
FT   gap             7994..8093
FT                   /estimated_length=unknown
FT   exon            8576..8685
FT                   /gene="DD4"
FT                   /product="dihydrodiol dehydrogenase 4"
FT                   /number=6
FT                   /note="AKR 1C4"
FT   exon            8953..9118
FT                   /number=7
FT   gap             9526..9625
FT                   /estimated_length=unknown
FT   exon            9972..10054
FT                   /gene="DD4"
FT                   /product="dihydrodiol dehydrogenase 4"
FT                   /number=8
FT                   /note="AKR 1C4"
FT   gap             10540..10639
FT                   /estimated_length=unknown
FT   exon            11141..11183
FT                   /gene="DD4"
FT                   /number=9
FT   regulatory      11350..11355
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 11711 BP; 3479 A; 2147 C; 2118 G; 3467 T; 500 other;
     gctagccaaa gctgaataat gaaactaaac ccctatctct taccattggc aaagttaagt        60
     caacgtggat taaggaccta caaggaaaat ctgaaactat gaatgtccta ggagaaaacc       120
     ttggaaaaac tcttctggac attgagctag gccaagatat aatgatgaag atgccaaaaa       180
     ggaaatgtaa caaagacaga taaatgggaa ttaaactaaa aaacttatgg gcagcaagag       240
     aaataatcaa cagaatatct acagaatggg aaaaatattt tcaaatttag gctccaacaa       300
     aggactttta tttagattct ataaggaact caaaccaact caacaagtaa aacacaaaca       360
     atcccattaa aaactaggca gaagacatga acagacattc atcaaatgaa gacatacaag       420
     cagctgacaa atatacagga aactgttttt aatagtcatc agaaaaatgc aaattaaaag       480
     cacattgaga tgtcatcttg caccagtcag aatgactatt attaaaatgt caaaaaacaa       540
     caaatatcag tgtggatgtg gaaagaaggc aaaatgtgca tatacatact aatatgcata       600
     tatatatata ttaagtgtac atacgtatac taagcatata tgcttatgga atactaagca       660
     tccactaaaa agagtgaaat taagtccttt tcagcagcat ggatggaact aaaggatatt       720
     attctaagta aactatcgta caagcacaac aaaataccac atattctcat ttataagggg       780
     aagctaaaca atgtgtacac acggacataa acatggaaat aatagacatc aagtacttca       840
     aaagggagaa aggtggagac aggggcaaag atgacaaaac ttcctattgg gtacaatgtt       900
     cactatttaa gtgatgtgta caccagaggc ccaaacctca ccagtatgta atgtgtctat       960
     ataacaaacc tacacatgtg cctatttaat ctaaaataat ttttaagact ttaataagaa      1020
     ataaaaatcc ggaagtcttt ccttactaat atcaatgcct gtaattcttc acagtttgtc      1080
     agtttatttt cttcctcata atgaacgctg ttttcctgtt tctttgcagc tttgttattg      1140
     tttttatcgc acatttgaaa aacagccaca tttcataatc tatatatatt ccgtgtcatg      1200
     acaatgatca gctaatatgc ttggcatatt cttaagtctc gacatcagcc ctacatgaaa      1260
     acttaaggtc ttctcagttc ttttctgaac gtgcatctgc ctagactctg tgtgccctat      1320
     ttgatttctc caaataccca atggttttga ataccttatc atgtcaaaaa ttcacagctc      1380
     agcttctcct aagtgccata gatggcctat tgtatgtctc ttccccctaa tctcttgcca      1440
     gtggcatctg tgcatctata gtcaccctgc atctctactg agccactcta taaataaatg      1500
     agtttatttt agttcatttc agattgtttt ttgataattc catgggagat ttgagagctt      1560
     tctaatctac catcctgctg atgacactct gtgtgaaaat ttttaaatgg ctctattata      1620
     ttccattgct tcaatgtata gtaatttacc taattatttt cttttattgt tccttttagg      1680
     aagaagtgaa tagaagaaaa gagggtgttg caaatcaaaa gcacatagag atatcatctt      1740
     acaccagtca gaatggctat tcttaaaatg tcagacaaca acagatattg gtatggattc      1800
     ttcacagatg ttaatcatct tcgttttttg ttttttgttt tttttttttt tttgagacag      1860
     tcttgctctg tcgcccaggc tggagtgcag tgacccaatc ttggctcact gcaacctctg      1920
     cctcctgagt ttaagcaatt gtcttgcctc agcctcctga gtaactggga ttacaggtat      1980
     ccactaccac tccagactaa tttttgtatt tttcgtagag acaagatttc acttgattgg      2040
     tctcaaactc ctgacctcaa gtaaacctac cgccttggcc ttccaaagtg ctggggttac      2100
     aggcgtgagc cactgccccc ggcctaatca tcgtgttcta gtctgccctc caatgggaga      2160
     aacaagtaaa attatgccat gtgaggatta ttcaccaatt tattttaatt acttttttct      2220
     ttataacatt taataagatc acaaattata taaaatagtt atcagctttt tgggaagtta      2280
     cttttgctgg tttcttataa aactgatgga agatacaaac actattaaag aactgtttgc      2340
     atgttgcaaa tgatgtccaa agtccaaaca ttgttaataa ttaatactcc aataaacatc      2400
     atgtcagaat ttctgttttc ttttcccttt gaacctttgc aggattacca catcatcagg      2460
     accacacctt catcaggaat gaatattcct actacaatta aagaagaaac aaaattaatt      2520
     tgttggtgaa aaacgtaaaa agagaaattt tctttggttt tgtttaattt ctttattgag      2580
     ggtcaccact aaaaaaaatg ctcactggtc attcttttga atactgtctg agagaaagat      2640
     gtaagatggt tgattatttc aaatgacaga agataaagat gggatatcat catggcatga      2700
     acaaaaacaa gatttgtagc tggaggtatt ttatagtcta acatgatcac caatcattct      2760
     ataaacctgt tggatgagtt tatcagacag acagagagag agattgattg attctgaata      2820
     gaaaatttca ctttagaaaa aaatattttg actatataat aatgtatgta aaaattctct      2880
     ttgataagaa acgagtgaac tggattcaat tttcctcaca gcctgtgtaa tacaccatca      2940
     cttgcttcct cctacatgcc attgattagc cccagggagc agtgcagcac tgcctgccca      3000
     tgttttacat aacccctgaa tataaatgcc agatgttgct gaaggaaaca ggatctgctt      3060
     agtgaaagaa gtggcaagca atggatccca aatatcagcg tgtagagcta aatgatggtc      3120
     acttcatgcc cgtattggga tttggcacct atgcacctcc agaggtaata atcacatttt      3180
     cagcattgag catttaaaag agcaaagcta gaataagtga acgatgacct gggttgttca      3240
     gctttgtgtt tctgttaccc tgagtgactc acgtggtctg tcttactggg ctagagctat      3300
     tctatgttca aagagaaaag gtagtcaatg tttgttttgc actgaggtct gtcatatggt      3360
     aatttactgc ttatttttat tttatacact gtttttatat gctgtttctg tgtattgccc      3420
     agcttggcag aatatataaa actcaacagt gaagaacact gcctggcagt tccctttcta      3480
     ggagatgact gcagtgagaa tggtttctcc atttatttct gtggttgaag aaatctttta      3540
     ttcttctact agacgtgatc aaaagaaaca tttgtggtaa cagcacctaa agatggggtg      3600
     tatgaaaact gttgggagag tactgctgag ctgccgcgtg gtcttgagca tgacacagta      3660
     atactggtcc tggacttaat acaatgccct gcacaactct cacctctagg aaaattatct      3720
     gaaaggaaaa ataactttat tctaaggaaa acctagaacc tcacaagaaa aattttaaat      3780
     ttttggtccg tgttaatatg catcagattt gtatcaaaat gataggggtg gccctctgac      3840
     acggaagtgg gcaaaatgga gacatttttt ctagactgag ctatttctac actggaagaa      3900
     aacttgtatt ccaagactac taagtgtgtt aataaggagt agtcacataa aatttttgtc      3960
     taaatttgat caactatacg ttgtaagaat ttacagagaa acaccttgaa gaccatcgac      4020
     aggagtggtt cactttgtaa tgcaaattgg catgaaggag aagtaaggaa aagcacaaca      4080
     cggaagctct agccttggta aaccttgagt gcctgcacag caaacagagg atcnnnnnnn      4140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      4200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnntccggta aaccaaagca agaactcagg      4260
     atacagaaag ccctctgtcc ttgccataag gtagagggtc taattgagct ggttaacaca      4320
     agcctgtaga tggcaaaact taaagaacaa aactaaaaga gcaccctgta acacatgccc      4380
     actggggctt caggagctgt aaacatccac acctagacac tgtcaacggg tcatagtccc      4440
     acaacctgcc cccatctgta tgctccccta gaggtctgag cagcgggggc ctgaagaagc      4500
     gagccacacc cccactgcac accctgtgag gacaagggaa cttttcctgt ttcactacct      4560
     ctcaagcaca ttgatcacca aatactacct ttcgttgctc cttcaggttc cgaggaacag      4620
     agctgtagag gtcaccaaat tagcaataga agctggcttc cgccatattg attctgctta      4680
     tttatacaat aatgaggagc aggttggact ggccatccga agcaagattg cagatggcag      4740
     tgtgaagaga gaagacatat tctacacttc aaaggtactg tgcctatgat gagcatgtat      4800
     gcacatgtat ttaatgggat tgtgtggaga tgacaattct gtaactggtt cagtagttgt      4860
     gggtgaattg tgcttattag ttccaattta ttcacacata ttcaggtatt aaagctaaaa      4920
     taaaaggcag agaatgatga tgcctttctc atcattgttg tgttcaaatt tactacttga      4980
     aagttacttt aggttttgag cctcagctca gatcagtata attattttag aattcnnnnn      5040
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      5100
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnncagaa gtatcttgaa tgattgctca      5160
     acacatgtca gcacgtaaaa actttttgct cttcagtttc taaacaggaa tgcttattct      5220
     tgcccatcgg gttcaatgga tgagaaaaat tagactattc aaatgcttta taatttctct      5280
     caaacacagt tcagatcatc agaattactt gatatcaatt tttacctact gaaaatttta      5340
     attccattgt tcagcagttg tactaactat atatgcaata tgtagctttc atataggtag      5400
     gtcatatcaa aataaaacaa agggaatttt tgccagaggt catctgtttg gaacggtgaa      5460
     aaatgtctaa atattaggtg aagcaaacta ataaaactag ctcatgtttt tattcaacat      5520
     aaatccttta ttttaccatg cagctttggt gcactttctt tcaaccacag atggtccaac      5580
     cagccttgga aagctcactg aaaaaacttc aactggacta tgttgacctc tatcttcttc      5640
     atttcccaat ggctctcaag gtagggaatt tgtgagatca acttctcttc tgttctcagc      5700
     atgaccatcc tttatgatgg ttgaattgaa cttcttctaa ggagggtgta ggtgttatta      5760
     catggcagaa gagtcctaag tataatgact aagccatttt cttgaagagt acaaccttcc      5820
     ttctgtaacg tatgatgaca agagaagaca gtacatcaac ctcaaagcct ctgcttcaaa      5880
     aattcaagaa aataacaaca gccaccttca aggctctgtc ttaattaggg ttcctgagtc      5940
     catctcttag gatcttcaca gatacagaga tccatgcagc tgtggtaccc caaaaaaact      6000
     gctgcacatg tggtgtacag tgagtttcca ttatctttcc ccattttaag ctgaagtaga      6060
     tttggtggaa ctcactctgg gtgagtttta aaaaggaaac cataatagga cctgagaatc      6120
     cttgcctttt tcactaaggc ttgtttcaca atggagtttg tagctttgcc tagtcatgaa      6180
     tttcggttgt gcataacttt taaatttata gaaaaaaaac tcaggctagt ttatttaaaa      6240
     aagagtttat tgcatgatgc aaatgggtag tcactgccat gaatacattt caagatttga      6300
     cgtagactct aaaaatgtga cctttctcca taattatcta tgaactccaa gaagttttct      6360
     ggatttttgt cccagccttt ttgattgttg gcaatgatag ctttgaggca gctcaatgct      6420
     catggtgatt aacataaaag aacctccgtg ggtcttacaa ctttcaaatt aatactgaaa      6480
     agaacttcca tttgaacatg tttagcttat gatcctgctc atggactatc aagtcttcag      6540
     ggggataagg aactcttatt gtatcacctg gatcaagaat acaatccctt attgctggat      6600
     atcaagggct gtttgagtca aagagaggca tttcccccaa aaaaattata ggatcagaca      6660
     aaagtaacag aagtcgactg tgaaccccca ttaaaacctg taaaatggtt attaatatat      6720
     ataatggaag tagaagatta aaggaagcct gtctcctaaa gacattcctt aaaactctgt      6780
     acgtgaaaca cttggcccac atcactttct agaacatttc agcacctacc tcacggtgga      6840
     ttattatcct aaaatgtaca tgggagcatg cctatgggtg gaaaagttaa atggtgacac      6900
     taaagtgact gcttctactt cagccaggtg agacgccact accaaaagat gaaaatggaa      6960
     aagtaatatt cgacacagtg gatctctctg ccacatggga ggtgagtgct tggaggacag      7020
     agtacagaaa aggaagacaa gaagaggtaa acctgttccc cagctttcat atgcaacatt      7080
     ggaatatgca ccattggaac tagaaattaa ggagcttgac aaaggaagtt ttgctgagtg      7140
     gtagggaaga atacatgact gaaatagaat agcaggaaat gaaggagata aactggggac      7200
     aaggaagaca gatattcctc ccgctccatg gacatttatc tctccagctt cctaaagagg      7260
     atacacaaat tcttcttgct gtcactatcc ttttgttatc tgttgtaatt ttttctcttg      7320
     agaatcactg ctattttcat tgtcatatct taacagttgt tgctttaaca gttctgtctt      7380
     gcatttatca taatctgcag ccaactgcac aaataattcc tcacaacccc tttctcccca      7440
     ggtcatggag aagtgtaagg atgcaggatt ggccaagtcc atcggggtgt caaacttcaa      7500
     ctgcaggcag ctggagatga tcctcaacaa gccaggactc aagtacaagc ctgtctgcaa      7560
     ccaggtgagc accctcaacc tcctctcctt tctcttctca atgtccatct tcctgtccta      7620
     ctgcctggct tccatttgtt ttgttccact tacatttgtg aaacagaaga ttctagaaag      7680
     caaaacatct gtctagaaga aaacggaaga cccttaattg cacctcttct tggagaagtc      7740
     ttaatgaaaa tggtacagag accttcatgc taaattgtgt gtactatttt ggggggaggt      7800
     gaatttcatc aaggaggact gaaatggtta atcagaactc agggagaagg tggacttatc      7860
     tctaaggtat gaaagaccac cagagagtgg attggtaaag atgatttgga gtagaatgta      7920
     tataattata gaggccataa aaacatggga tgagcaataa atcaggagac agtgagaata      7980
     agagaagatc ggtnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      8040
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnntttaacc      8100
     actcaacact atgaagacat ggattgtttt gctataattt gtaattcatt ttattcattg      8160
     ttggtttttg atgctcaaat ctatgcaaat gttactggga ttcctataaa actacttttc      8220
     tcttttaaac ctgcccttat gagtctttaa agaaattctt acattctggc acaatttgat      8280
     gttcaaagct cagaatctta acctatccca agtctagaat tggccatgtg cacttctagt      8340
     ggtcaaaggt tgttagaaac tggctctggt tcatagagtt gctaatgctc agaaataaca      8400
     tttctatata tacttttaga ccagcaatat aaactgtatt tttataaact gattgttact      8460
     tgacagtaat attctgttca aatttaatgt tatactttat tcagcttatt ttaatcttta      8520
     tattaacata tctgttttga attatctgat gcttttctct cttgatcatc taaaggtaga      8580
     atgtcatcct tacctcaacc agagcaaact gctggatttc tgcaagtcaa aagacattgt      8640
     tctggttgcc cacagtgctc tgggaaccca acgacataaa ctatggtaat aagagcatca      8700
     ggaagtttac ctaaaatgcc attttgatga aaaattttag ttatagcata ctcagtctcc      8760
     tagagttcat tctcaatggg tcagggtaag gggataattt gcatttctta tgagatacca      8820
     ggtgatgctg ctgctgttca gggacctcac ttgagaggct ctggtgcaga atgaacacct      8880
     tagtctgttt agggagcctc taccaaactg aatccagcct caagacttca gcatttctgg      8940
     ctttccttcc agggtggacc caaactcccc agttcttttg gaggacccag ttctttgtgc      9000
     cttagcaaag aaacacaaac gaaccccagc cctgattgcc ctgcgctacc agctgcagcg      9060
     tggggttgtg gtcctggcca agagctacaa tgagcagcgg atcagagaga acatccaggt      9120
     gaggagttgg gtgggcatca gggctcctgc acagtgtcct tcacacgtgt gcttcttgta      9180
     aggttctcag gacacccttg gactaagtcc acttcctggg catttcctat gcacaaatgc      9240
     tttgtgtgca taagtgtttt ctactctacc acaggagggg cagcatgggt ggagagaatc      9300
     aggatgggac caaaaccagg aattttggtt tcacaacata aagttggcaa cttaactcta      9360
     tccctctgct agggacatca ccttttcttc attttctgaa gtgaggagtt gggttaggtg      9420
     ttctctaatc ttcaaaaatc attgcagatt tttcatgtcc ttgcttactc agtataaatt      9480
     tcatatattt attctcttag aattatttgt tgagtgcctg ttgaannnnn nnnnnnnnnn      9540
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      9600
     nnnnnnnnnn nnnnnnnnnn nnnnncatca aactgtctaa attatacatt tcaaaatttc      9660
     tctagattct tctgaatcta agtacatgaa ccaatcatgt gcacataagg tcaacttcgt      9720
     tccatcttta gtttctgttg agatcttgtc ttcagttttg tgcagtttca atatgtaata      9780
     tctaggaata gatttatatt ttatctgata ttctttaatc acttgagagt ttagagatgg      9840
     tctttcataa cttttggaaa cttatcaaat attttacata ttgcctctac accctactgt      9900
     gtgatatact tggctattcc aagttgacaa ttatgcaatc taagaataaa cattttctac      9960
     ttctttggta ggtttttgaa ttccagttga catcagagga tatgaaagtt ctagatggtc     10020
     taaacagaaa ttatcgatat gttgtcatgg atttgtaagt aactttggaa aatgggtttc     10080
     ccagtttatt tttagaggag gaatgtcaga tgggtgttga aagtgacctc aataccaggg     10140
     agacagaggc cagtgcaagt gagaggtgag acaggaactc tctggaactc tccttctgga     10200
     ttcactccag agctctgttc tctgacaggg tgagtggacc cagggtcagc atgggtcaac     10260
     ctgtgcctct gctctcctga ctccatggaa atttccagag cagccaatat tattgctaaa     10320
     tctgcaactt tcatgtaggc ctggcatttc tgccgtggcc tagtggacag tagatattgc     10380
     ccatatggct tgattaatgt ttttccaaat ctgtacttat agctttttct tccaaatcca     10440
     ctcagtttct tatcagctaa aaaacatttc caacaacact ggtgtccatg ccagaaattc     10500
     tcttctcttc catatggaat tgctcactag atcatgtcan nnnnnnnnnn nnnnnnnnnn     10560
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     10620
     nnnnnnnnnn nnnnnnnnnc aatttacatg tctgaatcaa agaaaatatt ttccatatgg     10680
     taagcagcta gtcagtaatg aatacattct tttaaaagga tatgtgattg ctaccaataa     10740
     catttaaccc tcaaaacttt ttgttaatga tgaacatata gctggcttat ttctattcaa     10800
     aacaatgcaa gatgagttcc tgccttcatt gagaatttga aatagaaaat gtcagaatat     10860
     ctctttgctc tgttgacaga tatggaggac tatgtttgaa caattgaccc tgtgtagttt     10920
     gtgtgataaa ttccaggcaa gggaatataa gttgaaaatt ttcttatttt gaaaaaaaaa     10980
     aaacacatta taaactcatg ttcatgaaag acattctaca aatagtccga aaataaactt     11040
     cttaacattc acactaatgg cagcttcata taaattttgc taccagcttt ttaatagagt     11100
     catttcatcc atatttatgt actatccttt ctcttttcag tcttatggac catcctgatt     11160
     atccattttc agatgaatat tagcatagag ggtgttgcac gacatctagc agaaggccct     11220
     gtgtgtggat ggtgatgcag aggatgtctc tatgctggtg actggacaca cggcctctgg     11280
     ttaaatccct cccctcctgc ttggcaactt cagctagcta gatatatcca tggtccagaa     11340
     agcaaacata ataaattttt atcttgaagt aattgaatgt ttttccttaa agattctttt     11400
     cctactcctt tctctgttac ttgtgtgttt cttttccttc tagttcttta aggccaaaaa     11460
     ctgatttgcc tataagtttg gggcagagag tagatgataa ccaatatttt atagacattt     11520
     ttgaggtgag agtaggtgga gttttcagcc tctagaggag aagcaagtga catatttgtt     11580
     agtctgtctt tagctcttcc agaaagaaga aaacacacag cacagaacct gaacatgagc     11640
     catattgaca ggatgaccaa caattaatgg cctccctcca gcatcgcaag aatgggagct     11700
     ccagcaacct a                                                          11711
//

If you have problems or comments...

PBIL Back to PBIL home page