(data stored in ACNUC13479 zone)

EMBL: AB035147

ID   AB035147; SV 1; linear; mRNA; STD; PLN; 1800 BP.
XX
AC   AB035147;
XX
DT   13-AUG-2000 (Rel. 64, Created)
DT   14-APR-2005 (Rel. 83, Last updated, Version 5)
XX
DE   Arabidopsis thaliana AtSR1 mRNA for serine/threonine protein kinase,
DE   complete cds.
XX
KW   serine/threonine protein kinase.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1800
RA   Kusano T., Sano H.;
RT   ;
RL   Submitted (19-NOV-1999) to the INSDC.
RL   Tomonobu Kusano, Nara Institute of Science and Technology, Research and
RL   Education Center for Genetic Information; 8916-5 Takayama-cho, Ikoma, Nara
RL   630-0101, Japan (E-mail:kusano@bs.aist-nara.ac.jp, Tel:81-743-72-5651,
RL   Fax:81-743-72-5659)
XX
RN   [2]
RX   DOI; 10.1007/s004380000354.
RX   PUBMED; 11212922.
RA   Chikano H., Ogawa M., Ikeda Y., Koizumi N., Kusano T., Sano H.;
RT   "Two novel genes encoding SNF-1 related protein kinases from Arabidopsis
RT   thaliana: differential accumulation of AtSR1 and AtSR2 transcripts in
RT   response to cytokinins and sugars, and phosphorylation of sucrose synthase
RT   by AtSR2";
RL   Mol. Gen. Genet. 264(5):674-681(2001).
XX
DR   MD5; 51ce81e83315752ec56999f59e8e13c6.
XX
CC   Sequence updated (27-Apr-2000)
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1800
FT                   /organism="Arabidopsis thaliana"
FT                   /ecotype="Columbia"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        225..1553
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="AtSR1"
FT                   /product="serine/threonine protein kinase"
FT                   /db_xref="GOA:Q9LZW4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004041"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR018451"
FT                   /db_xref="PDB:2ZFD"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LZW4"
FT                   /protein_id="BAB11737.1"
FT                   /translation="MVDSDPVEFPPENRRGQLFGKYEVGKLVGCGAFAKVYHGRSTATG
FT                   QSVAIKVVSKQRLQKGGLNGNIQREIAIMHRLRHPSIVRLFEVLATKSKIFFVMEFAKG
FT                   GELFAKVSKGRFCEDLSRRYFQQLISAVGYCHSRGIFHRDLKPENLLLDEKLDLKISDF
FT                   GLSALTDQIRPDGLLHTLCGTPAYVAPEVLAKKGYDGAKIDIWSCGIILFVLNAGYLPF
FT                   NDHNLMVMYRKIYKGEFRIPKWTSPDLRRLLTRLLDTNPQTRITIEEIIHDPWFKQGYD
FT                   DRMSKFHLEDSDMKLPADETDSEMGARRMNAFDIISGSPGFNLSGLFGDARKYDRVERF
FT                   VSAWTAERVVERLEEIVSAENLTVAKKETWGMKIEGQKGNFAMVVEINQLTDELVMIEV
FT                   RKRQRAAASGRDLWTDTLRPFFVELVHESDQTDPEPTQVHTTS"
XX
SQ   Sequence 1800 BP; 491 A; 413 C; 425 G; 471 T; 0 other;
     tgtctgtctc tcttttgttt tctctgctaa cagatctctc taaatatctg ttacttttgt        60
     tcatatcttt ttacttttca aactactaat tttcctttcg cttcttctat taataacaac       120
     actctctctc tcagacttct tttctttttt ttctacggcg ttgattcatt cgcaatgacc       180
     tcagtttctg tgtaccataa ttgacctagc agattctgtt tttaatggta gattctgacc       240
     cggtggaatt tccgccggag aaccgccgtg gacagctctt cggcaaatac gaggtcggaa       300
     aattggtggg atgcggcgcc ttcgcgaaag tgtaccacgg gaggagcaca gcgacgggtc       360
     agagcgttgc gatcaaagtg gtgagcaagc aacggctgca gaaaggagga ctcaatggca       420
     acattcagag agagatcgct atcatgcacc gtctgcgcca cccttctatc gtgcgcctgt       480
     tcgaggtcct cgccaccaaa tccaagatct tcttcgtcat ggaattcgcc aagggcggtg       540
     agctattcgc caaagtctcc aagggcaggt tctgcgagga tcttagccgt cgttatttcc       600
     agcagctcat ctccgccgtc ggatattgcc actcccgcgg catctttcac cgtgatctca       660
     aaccggagaa tctcctcctc gacgagaagc tcgatttgaa gatctctgat ttcggactca       720
     gcgctcttac cgatcagatc cgacccgacg gcctcctcca cacactctgt ggtacgccgg       780
     cgtacgtggc gcctgaggtt ttggcgaaga aagggtacga cggtgctaaa atcgacatat       840
     ggtcatgtgg aatcatactg ttcgtcctca acgccggtta tctccctttc aacgaccata       900
     atctcatggt tatgtaccgg aaaatctaca agggagaatt tcgcattccc aagtggacct       960
     caccggatct ccggcgactg ctgactcggc ttttagacac gaatccgcag acgaggatca      1020
     ctatcgaaga gatcatccac gatccatggt tcaaacaggg ctacgacgat cggatgtcta      1080
     aattccatct agaggactcc gatatgaaac tcccggcgga cgagaccgac agcgagatgg      1140
     gagcaaggag gatgaacgca ttcgacatca tctcaggatc tccagggttc aatctctccg      1200
     gtcttttcgg agacgccaga aagtacgacc gagtggaacg gttcgtgtcg gcgtggacgg      1260
     cggagagggt ggtggagagg ctggaggaga tcgtgtcggc ggagaatctg acggtggcga      1320
     agaaggaaac atgggggatg aagatcgagg ggcaaaaagg taacttcgca atggtggttg      1380
     agataaacca gctaacggac gagctggtta tgatagaggt gaggaagaga caaagagccg      1440
     ctgcatctgg acgagattta tggacagata cactcaggcc tttcttcgtc gagcttgtgc      1500
     acgaatcaga ccaaacggac ccagaaccaa ctcaagtaca tacgacgtcg tagtttaggt      1560
     atctgtcaaa taaattatcc aaataataat taaaaaaaaa tatcccgggt tatatgtaat      1620
     tgcttttttt tttacccgga gaatatctct gacataatta ttcaggaaat ttctcgacaa      1680
     atcttaattt ttagttggca agtatgtatc ttcttgttat gtaatcataa ttatatttta      1740
     tataaatgaa aaataaaata taaaaaaatg tattacttaa aaaaaaaaaa aaaaaaaaaa      1800
//

If you have problems or comments...

PBIL Back to PBIL home page