(data stored in ACNUC21429 zone)

EMBL: AB035275

ID   AB035275; SV 1; linear; mRNA; STD; HUM; 2861 BP.
XX
AC   AB035275;
XX
DT   11-JAN-2001 (Rel. 66, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens DA41 mRNA, complete cds.
XX
KW   DA41.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2861
RA   Hanaoka E.;
RT   ;
RL   Submitted (26-NOV-1999) to the INSDC.
RL   Eiji Hanaoka, Chiba Cancer Center Research Institute, Division of
RL   Biochemistry; 666-2 Nitona Chuoh-ku, Chiba, Chiba 260-8717, Japan
RL   (E-mail:tozaki@biolab.kazusa.or.jp, Tel:81-43-264-5431(ex.5202),
RL   Fax:81-43-265-4459)
XX
RN   [2]
RP   1-2861
RA   Hanaoka E.;
RT   "human DA41";
RL   Unpublished.
XX
DR   MD5; 58526eb45614d24fbe556647735186ec.
DR   Ensembl-Gn; ENSG00000135018; homo_sapiens.
DR   Ensembl-Tr; ENST00000257468; homo_sapiens.
DR   Ensembl-Tr; ENST00000376395; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2861
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /tissue_lib="ZAPII"
FT                   /tissue_type="lung"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        171..1940
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="DA41"
FT                   /product="DA41"
FT                   /db_xref="GOA:Q9UMX0"
FT                   /db_xref="H-InvDB:HIT000059126.14"
FT                   /db_xref="HGNC:HGNC:12508"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015496"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR028799"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="PDB:2JY5"
FT                   /db_xref="PDB:2JY6"
FT                   /db_xref="PDB:2KLC"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9UMX0"
FT                   /protein_id="BAB20436.1"
FT                   /translation="MAESGESGGPPGSQDSAAGAEGAGAPAAAASAEPKIMKVTAKTPK
FT                   EKEEFAVPENSSVQQSKEEISKRFKSHTDQLVLIFAGKILKDQDTSSQHGIHDGLTVHL
FT                   VIKTQNRPQDHSAQQTNTAGSNVTTSSTPNSNSTSGSATSNPFGLGGLGGLAGLSSLGL
FT                   NTTNFSELQSQMQRQLLSNPEMMVQIMENPFVQSMLSNPDLMRQLIMANPQMQQLIQRN
FT                   PEISHMLNNPDIMRQTLELARNPAMMQEMMRNQDRALSNLESIPGGYNALRRMYTDIQE
FT                   PMLSAAQEQFGGNPFASLVSNTSSGEGSQPSRTENRDPLPNPWAPQTSQSSSASSGTAS
FT                   TVGGTTGSTASGTSGQSTTAPNLVPGVGASMFNTPGMQSLLQQITENPQLMQNMLSAPY
FT                   MRSMMQSLSQNPDLAAQMMLNNPLFAGNPQLQEQMRQQLPTFLQQMQNPDTLSAMSNPR
FT                   AMQALLQIQQGLQTLATEAPGLIPGFTPGLGALGSTGGSSGTNGSNATPSENTSPTAGT
FT                   TEPGHQQFIQQMLQALAGVYSQLQNPEVRFQQQLEQLSAMGFLNREANLQALIATGGDI
FT                   NAAIERLLGSQPS"
XX
SQ   Sequence 2861 BP; 848 A; 644 C; 599 G; 770 T; 0 other;
     gattgggtag tccccacctt ttgagcaagt tcagcctggt taagtccaag ctgaattccg        60
     gctgcattct tcgctgtcca ggcctgccgg ctctggtgtc tgctggctcc tccttgctcg       120
     cctgctccct cctgcttgcc tgagtcaccg ccgccgccgc cgccacagcc atggccgaga       180
     gtggtgaaag cggcggtcct ccgggctccc aggatagcgc cgccggagcc gaaggtgctg       240
     gcgcccccgc ggccgctgcc tccgcggagc ccaaaatcat gaaagtcacc gcgaagaccc       300
     cgaaagaaaa ggaggaattc gccgtgcccg agaatagctc cgtccagcag tctaaggaag       360
     aaatctctaa acgttttaaa tcacacactg accaacttgt gttgatattt gctggaaaaa       420
     ttttgaaaga tcaagatacc tcgagtcagc atggaattca tgatggactt actgttcacc       480
     ttgtcattaa aacacaaaac aggcctcagg atcattcagc tcagcaaaca aatacagctg       540
     gaagcaatgt tactacatca tcaactccta atagtaactc tacatctggt tctgctacta       600
     gcaacccttt tggtttaggt ggccttgggg gacttgcagg tctgagtagc ttgggtttga       660
     atactaccaa cttctctgaa ctacagagtc agatgcagcg acaacttttg tctaaccctg       720
     aaatgatggt ccagatcatg gaaaatccct ttgttcagag catgctctca aatcctgacc       780
     tgatgagaca gttaattatg gccaatccac aaatgcagca gttgatacag agaaatccag       840
     agattagtca tatgttgaat aatccagata taatgagaca aacgttggaa cttgccagga       900
     atccagcaat gatgcaggag atgatgagga accaggaccg agctttgagc aacctagaaa       960
     gcatcccagg gggatataat gctttaaggc gcatgtacac agatattcag gaaccaatgc      1020
     tgagtgctgc acaagagcag tttggtggta atccatttgc ttccttggtg agcaatacat      1080
     cctctggtga aggtagtcaa ccttcccgta cagaaaatag agatccacta cccaatccat      1140
     gggctccaca gacttcccag agttcatcag cttccagcgg cactgccagc actgtgggtg      1200
     gcactactgg tagtactgcc agtggcactt ctgggcagag tactactgcg ccaaatttgg      1260
     tgcctggagt aggagctagt atgttcaaca caccaggaat gcagagcttg ttgcaacaaa      1320
     taactgaaaa cccacaactt atgcaaaaca tgttgtctgc cccctacatg agaagcatga      1380
     tgcagtcact aagccagaat cctgaccttg ctgcacagat gatgctgaat aatcccctat      1440
     ttgctggaaa tcctcagctt caagaacaaa tgagacaaca gctcccaact ttcctccaac      1500
     aaatgcagaa tcctgataca ctatcagcaa tgtcaaaccc tagagcaatg caggccttgt      1560
     tacagattca gcagggttta cagacattag caacggaagc cccgggcctc atcccagggt      1620
     ttactcctgg cttgggggca ttaggaagca ctggaggctc ttcgggaact aatggatcta      1680
     acgccacacc tagtgaaaac acaagtccca cagcaggaac cactgaacct ggacatcagc      1740
     agtttattca gcagatgctt caggctcttg ctggagtata ttctcagcta cagaatccag      1800
     aagtcagatt tcagcaacaa ctggaacaac tcagtgcaat gggattcttg aaccgtgaag      1860
     caaacttgca agctctaata gcaacaggag gtgatatcaa tgcagctatt gaaaggttac      1920
     tgggctccca gccatcatag cagcatttct gtatcttgaa aaaatgtaat ttatttttga      1980
     taaccgctct taaatcttta aaataacctg ctttatttca ttttgactct tggaattctg      2040
     tgctgttata aacaaaccca atatgatgca ttttaaggtg gagtacagta agatgtgtgg      2100
     gtttttctgt atttttcttt tctggaacag tgggaattaa ggctactgca tgcatcactt      2160
     ctgcatttat tgtaattttt taaaaacatc accttttata gttgggtgac cagattttgt      2220
     cctgcatctg tccagtttat ttgcttttta aacattagcc tatggtagta atttatgtag      2280
     aataaaagca ttaaaaagaa gcaaatcatt tgcactctat aatttgtggt acagtattgc      2340
     ttattgtgac tttggcatgc atttttgcaa acaatgctgt aagatttata ctactgataa      2400
     ttttgtttta tttgtataca atatagagta tgcacatttg ggactgcatt tctggaaaca      2460
     tactgcaata ggctctctga gcaaaacacc tgtaactaaa aaagtgaaga taagaaaata      2520
     ctcttaaagc tgagtatttc ctaattgtat agaatcttac agcatctttg acaaacatct      2580
     cccagcaaaa gtgccggtta gtcaggtttg ttgaaaatac agtagaaaag ctgattctgg      2640
     ttatctcttt aaggacaatt aattgtacag acacataatg taacattgtc tcaacattca      2700
     ttcacagatt gactgtaaat taccttaatc tttgtgcaga ctgaaggaac actgtagtat      2760
     accccaaagt gcatttgcct aggacttctc agcttctccc ataggtagtt taacaggcat      2820
     taaaatttgt aattgaaatg ctaaaaaaaa aaaaaaaaaa a                          2861
//

If you have problems or comments...

PBIL Back to PBIL home page