(data stored in SCRATCH zone)

EMBL: AB039286

ID   AB039286; SV 1; linear; genomic DNA; STD; HUM; 4300 BP.
XX
AC   AB039286;
XX
DT   13-SEP-2000 (Rel. 65, Created)
DT   03-DEC-2000 (Rel. 66, Last updated, Version 2)
XX
DE   Homo sapiens gene for transcription factor Sp1, partial cds.
XX
KW   transcription factor Sp1.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-4300
RA   Takahara T., Yanagisawa S., Akanuma H.;
RT   ;
RL   Submitted (28-FEB-2000) to the INSDC.
RL   Hiroshi Akanuma, University of Tokyo, Graduate School of Arts & Sciences;
RL   Komaba 3-8-1, Meguro, Tokyo 153-8902, Japan
RL   (E-mail:cakanum@m.ecc.u-tokyo.ac.jp, Tel:+81-3-5454-4392(ex.44392))
XX
RN   [2]
RX   DOI; 10.1074/jbc.M002010200.
RX   PUBMED; 10973950.
RA   Takahara T., Kanazu S., Yanagisawa S., Akanuma H.;
RT   "Heterogeneous Sp1 mRNAs in human HepG2 cells include a product of
RT   homotypic trans-splicing";
RL   J Biol Chem 275(48):38067-38072(2000).
XX
DR   MD5; f94ab2c8cf7c08d051a4bbc14f057994.
DR   Ensembl-Gn; ENSG00000185591; homo_sapiens.
DR   Ensembl-Tr; ENST00000327443; homo_sapiens.
DR   Ensembl-Tr; ENST00000426431; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4300
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="lambdaSp1E1"
FT                   /cell_line="HepG2 cell"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        join(438..444,1805..1959,2256..>3768)
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="Sp1"
FT                   /product="transcription factor Sp1"
FT                   /db_xref="GOA:P08047"
FT                   /db_xref="HGNC:HGNC:11205"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="PDB:1SP1"
FT                   /db_xref="PDB:1SP2"
FT                   /db_xref="PDB:1VA1"
FT                   /db_xref="PDB:1VA2"
FT                   /db_xref="PDB:1VA3"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08047"
FT                   /protein_id="BAB13476.1"
FT                   /translation="MSDQDHSMDEMTAVVKIEKGVGGNNGGNGNGGGAFSQARSSSTGS
FT                   SSSTGGGGQESQPSPLALLAATCSRIESPNENSNNSQGPSQSGGTGELDLTATQLSQGA
FT                   NGWQIISSSSGATPTSKEQSGSSTNGSNGSESSKNRTVSGGQYVVAAAPNLQNQQVLTG
FT                   LPGVMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQDGSGQIQIIPGANQQIITNRGSGG
FT                   NIIAAMPNLLQQAVPLQGLANNVLSGQTQYVTNVPVALNGNITLLPVNSVSAATLTPSS
FT                   QAVTISSSGSQESGSQPVTSGTTISSASLVSSQASSSSFFTNANSYSTTTTTSNMGIMN
FT                   FTTSGSSGTNSQGQTPQRVSGLQGSDALNIQQNQTSGGSLQAGQQKEGEQNQQTQQQQI
FT                   LIQPQLVQGGQALQALQAAPLSGQTFTTQAISQETLQNLQLQAVPNSGPIIIRTPTVGP
FT                   NGQVSWQTLQLQNLQVQNPQAQTITLAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVT
FT                   VNAAQLSSMPGLQTINLSALGTSGIQVHPIQGLPLAIANAP"
XX
SQ   Sequence 4300 BP; 937 A; 1260 C; 1016 G; 1087 T; 0 other;
     aagctttgcc tatccctacg tctcagggag cccgcctgcc ggttgactgg tttccttcca        60
     agccaatcat ctccagctcc cgcccatctt cacttcctgc atccttcatt ggcttttaac       120
     actgagaggg cggtcttttt aggcggacac caggcacgca acttagtctc acacgccttg       180
     gagagcaagc gagtcttgcc attggataat tccaccgtct ttcttctgca agtccctcct       240
     ttccccctcc ctcattgggc ggggcagcag agaaggggcg gggcctaggt tgggcttgtg       300
     gcgcgctgct ccctcctcct tacccccccc tccctgtccg gtccgggttc gcttgcctcg       360
     tcagcgtccg cgtttttccc ggcccccccc aacccccccg gacaggaccc ccttgagctt       420
     gtccctcagc tgccaccatg agcggtaagg atgagtccac tccaagctta ggggtgggag       480
     gcgagtgagg gggcgcgcgc gagggccgac cgggcgatcc ccgccgtgaa gcgggggcgg       540
     gcgggaggcg gcggcggcgg cggcctaggt cccgcccggg gcggagggaa gggagggaga       600
     cggggcagtg gcggggcctc cgaggaggag ggggatgggc cgcccgcccc gggggagggg       660
     gcagcgtggc ctcgcccgcc ccctgcccgc cccggccacg ggggacgggc cttacccccc       720
     actactcggc cgcccgcctg aggctcctcc cgccgggggc tggagccgcg ggggcggccc       780
     gagcagcgaa ggccccgccc gggccaaccg cctgcctggt ccgccctctg gtcgccgcct       840
     gctccaaggc cctcctcccc ccactttccg tagatttccc ttcccccccg ccccccaccg       900
     tcccgccctt tccacgcccc tcaccccgaa accgcccttt ccctcagggc ccgccctccg       960
     ccccgaaacc ttctgactac taacctgtag atccctttag ttccttagca gtattcacaa      1020
     atgtttttct actcacactt tttacttctt tttcccctct cgttactttt cacacttgga      1080
     tttttgtttg tctttttttt tttttttttt tttgagacgg agttttcgct cttgttaccc      1140
     agactggaat gcaatggtgc gatctcggct cactgcaacc tctgcctccc ggattcaggc      1200
     gattctcctg cctcagcctc cgggagtagc tggaattaca ggcatgcgcc accacacccg      1260
     gctaattttg tatttttagt agagacaggg tttctccatg ttggtcaggc tggtctcaaa      1320
     actcccgacc ccaggtgatc tgcctgcctc cgcctcccaa agtaatggga ttacaggcgt      1380
     gaccaccgcg cctggcctct ccatctcttt taaacttaat tttagcaagc tttccatgca      1440
     cccacatgtt gttttatgcc ttacctgtcc ttttcctttt tttcccttag gatacttttt      1500
     cttatttaga aactctcacc atgcctaccg tccttcacat ttcctatccc caaagcactt      1560
     tttgaatgtt ttcttagttt aattttgtac aagggagaat taaggcccac ttttggcaca      1620
     ttgaacctag ttcatgtcct gcatgccctg cagctcccct ctgccctcca atccattttc      1680
     tttatactgg tggctttcgc cttcctgtta gtcattgcta tttcatcata gcctcctttt      1740
     atccttccta cttcatttct tttcttccct caagtttacg ttgtttgttt tttaattatt      1800
     ttagaccaag atcactccat ggatgaaatg acagctgtgg tgaaaattga aaaaggagtt      1860
     ggtggcaata atgggggcaa tggtaatggt ggtggtgcct tttcacaggc tcgaagtagc      1920
     agcacaggca gtagcagcag cactggagga ggagggcagg taagtgataa tcatagagtg      1980
     gggaaggtgt tgagaagatg taaatattct tagataattg ccttactctt cacagaaagc      2040
     gttttaggga gagactaaac cattttatag ataaggaagt aagagaatgg agatccccaa      2100
     agacaaagga gtttcagcaa tacagatagg tcagcttttt gtttctgttt tttgctcctt      2160
     gtctgcacta cgttgctgtt tatttgttgt atactgcccc ctaggctggc agctgggtgt      2220
     cactaactcc tttcctctcc cttattttcg gccaggagtc ccagccatcc cctttggctc      2280
     tgctggcagc aacttgcagc agaattgagt cacccaatga gaacagcaac aactcccagg      2340
     gcccgagtca gtcaggggga acaggtgagc ttgacctcac agccacacaa ctttcacagg      2400
     gtgccaatgg ctggcagatc atctcttcct cctctggggc tacccctacc tcaaaggaac      2460
     agagtggcag cagtaccaat ggcagcaatg gcagtgagtc ttccaagaat cgcacagtct      2520
     ctggtgggca gtatgttgtg gctgccgctc ccaacttaca gaaccagcaa gttctgacag      2580
     gactacctgg agtgatgcct aatattcagt atcaagtaat cccacagttc cagaccgttg      2640
     atgggcaaca gctgcagttt gctgccactg gggcccaagt gcagcaggat ggttctggtc      2700
     aaatacagat cataccaggt gcaaaccaac agattatcac aaatcgagga agtggaggca      2760
     acatcattgc tgctatgcca aacctactcc agcaggctgt ccccctccaa ggcctggcta      2820
     ataatgtact ctcaggacag actcagtatg tgaccaatgt accagtggcc ctgaatggga      2880
     acatcacctt gctacctgtc aacagcgttt ctgcagctac cttgactccc agctctcagg      2940
     cagtcacgat cagcagctct gggtcccagg agagtggctc acagcctgtc acctcaggga      3000
     ctaccatcag ttctgccagc ttggtatcat cacaagccag ttccagctcc tttttcacca      3060
     atgccaatag ctactcaact actactacca ccagcaacat gggaattatg aactttacta      3120
     ccagtggatc atcagggacc aactctcaag gccagacacc ccagagggtc agtgggctac      3180
     aggggtctga tgctctgaac atccagcaaa accagacatc tggaggctca ttgcaagcag      3240
     gccagcaaaa agaaggagag caaaaccagc agacacagca gcaacaaatt cttatccagc      3300
     ctcagctagt tcaaggggga caggccctcc aggccctcca agcagcacca ttgtcagggc      3360
     agacctttac aactcaagcc atctcccagg aaaccctcca gaacctccag cttcaggctg      3420
     ttccaaactc tggtcccatc atcatccgga caccaacagt ggggcccaat ggacaggtca      3480
     gttggcagac tctacagctg cagaacctcc aagttcagaa cccacaagcc caaacaatca      3540
     ccttagcccc aatgcagggt gtttccttgg ggcagaccag cagcagcaac accactctca      3600
     cacccattgc ctcagctgct tccattcctg ctggcacagt cactgtgaat gctgctcaac      3660
     tctcctccat gccaggcctc cagaccatta acctcagtgc attgggtact tcaggaatcc      3720
     aggtgcaccc aattcaaggc ctgccgttgg ctatagcaaa tgccccaggt aagatttcca      3780
     atcttgtgca tttattggga accaactcta gcatcgtagc tgaaacttga gtctaaagaa      3840
     aggaatagag ccttttgaga taacactttc ttgagggtta gtcatttagg caaataaatt      3900
     tgagaaatag agattctgtt taagtaattt ggaactgaag taaaggaaac ttctccagtt      3960
     agtttgagga aggagcactt ctgggcaata ttctggagtc tgtaatactc agtgtttttg      4020
     gtgctgcaga ataatggttg acaagctttc tgtaaagggc cagatagtaa cgtaaatatt      4080
     ttagacattg tgggcctcat gtggtcacat tttcttttct tttttttttt tttgagacag      4140
     agtcttgctc tgtcatccag gctggagtgc agtggcgcga tctcggctca ctgcaagctc      4200
     cgcctcccag gttcacgcca ttctcctgcc tcagcctccc gagtggctgg gactacaggt      4260
     gcctgccacc acgcccgggt aattttttgt atttttagta                            4300
//

If you have problems or comments...

PBIL Back to PBIL home page