(data stored in ACNUC27125 zone)

EMBL: AB045829

ID   AB045829; SV 1; linear; mRNA; STD; HUM; 991 BP.
XX
AC   AB045829;
XX
DT   13-JUL-2000 (Rel. 64, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens mRNA for 3alpha-hydroxysteroid dehydrogenase variant, complete
DE   cds.
XX
KW   3alph-hydroxysteroid dehydrogenase type 1; AKR1C4; chlordecone reductase;
KW   DD4.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-991
RA   Hara A.;
RT   ;
RL   Submitted (11-JUL-2000) to the INSDC.
RL   Akira Hara, Gifu Pharmaceutical University, Labratory of Biochemistry;
RL   Mitahora-higashi, Gifu, Gifu 502-8585, Japan (E-mail:hara@gifu-pu.ac.jp,
RL   Tel:810582378586, Fax:810582378586)
XX
RN   [2]
RX   PUBMED; 10634139.
RA   Kume T., Iwasa H., Shiraishi H., Yokoi T., Nagashima K., Otsuka M.,
RA   Terada T., Takagi T., Hara A., Kamataki T.;
RT   "Characterization of a novel variant (S145C/L311V) of
RT   3alpha-hydroxysteroid/dihydrodiol dehydrogenase in human liver";
RL   Pharmacogenetics 9(6):763-771(1999).
XX
DR   MD5; cffab8642fe8a8cec098be7c4c274607.
DR   Ensembl-Gn; ENSG00000198610; homo_sapiens.
DR   Ensembl-Tr; ENST00000263126; homo_sapiens.
DR   Ensembl-Tr; ENST00000380448; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..991
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /tissue_lib="liver"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        1..972
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /standard_name="dihydrodiol dehydrogenase 4"
FT                   /product="3alpha-hydroxysteroid dehydrogenase variant"
FT                   /EC_number="1.1.1.213"
FT                   /note="The product shows three- to five-fold decreases in
FT                   catalytic efficiency for xenobiotic and steroidal
FT                   substrates compared to AKR1C4. The frequency of the variant
FT                   gene by a genomic DNA analysis is about 20"
FT                   /db_xref="GOA:P17516"
FT                   /db_xref="H-InvDB:HIT000059449.12"
FT                   /db_xref="HGNC:HGNC:387"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="PDB:2FVL"
FT                   /db_xref="UniProtKB/Swiss-Prot:P17516"
FT                   /protein_id="BAA99542.1"
FT                   /translation="MDPKYQRVELNDGHFMPVLGFGTYAPPEVPRNRAVEVTKLAIEAG
FT                   FRHIDSAYLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCTFFQPQMVQPALESSLK
FT                   KLQLDYVDLYLLHFPMALKPGETPLPKDENGKVIFDTVDLCATWEVMEKCKDAGLAKSI
FT                   GVSNFNCRQLEMILNKPGLKYKPVCNQVECHPYLNQSKLLDFCKSKDIVLVAHSALGTQ
FT                   RHKLWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRENI
FT                   QVFEFQLTSEDMKVLDGLNRNYRYVVMDFVMDHPDYPFSDEY"
XX
SQ   Sequence 991 BP; 288 A; 223 C; 234 G; 246 T; 0 other;
     atggatccca aatatcagcg tgtagagcta aatgatggtc atttcatgcc cgtattggga        60
     tttggcacct atgcacctcc agaggttccg aggaacagag ctgtagaggt caccaaatta       120
     gcaatagaag ctggcttccg ccatattgat tctgcttatt tatacaataa tgaggagcag       180
     gttggactgg ccatccgaag caagattgca gatggcagtg tgaagagaga agacatattc       240
     tacacttcaa agctttggtg cactttcttt caaccacaga tggtccaacc agccttggaa       300
     agctcactga aaaaacttca actggactat gttgacctct atcttcttca tttcccaatg       360
     gctctcaagc caggtgagac gccactacca aaagatgaaa atggaaaagt aatattcgac       420
     acagtggatc tctgtgccac atgggaggtc atggagaagt gtaaggatgc aggattggcc       480
     aagtccatcg gggtgtcaaa cttcaactgc aggcagctgg agatgatcct caacaagcca       540
     ggactcaagt acaagcctgt ctgcaaccag gtagaatgtc atccttacct caaccagagc       600
     aaactgctgg atttctgcaa gtcaaaagac attgttctgg ttgcccacag tgctctggga       660
     acccaacgac ataaactatg ggtggaccca aactccccag ttcttttgga ggacccagtt       720
     ctttgtgcct tagcaaagaa acacaaacga accccagccc tgattgccct gcgctaccag       780
     ctgcagcgtg gggttgtggt cctggccaag agctacaatg agcagcggat cagagagaac       840
     atccaggttt ttgaattcca gttgacatca gaggatatga aagttctaga tggtctaaac       900
     agaaattatc gatatgttgt catggatttt gttatggacc atcctgatta tccattttca       960
     gatgaatatt agcatagagg gtgttgcacg a                                      991
//

If you have problems or comments...

PBIL Back to PBIL home page