(data stored in ACNUC9435 zone)

EMBL: AB051553

ID   AB051553; SV 1; linear; mRNA; STD; HUM; 4809 BP.
XX
AC   AB051553;
XX
DT   07-FEB-2001 (Rel. 66, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Homo sapiens mRNA for KIAA1766 protein, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-4809
RA   Ohara O., Nagase T., Kikuno R.;
RT   ;
RL   Submitted (22-NOV-2000) to the INSDC.
RL   Osamu Ohara, Kazusa DNA Rsearch Institute, Department of Human Gene
RL   Research; 1532-3, Yana, Kisarazu, Chiba 292-0812, Japan
RL   (E-mail:cdnainfo@kazusa.or.jp, URL:http://www.kazusa.or.jp/huge,
RL   Tel:81-438-52-3913, Fax:81-438-52-3914)
XX
RN   [2]
RX   DOI; 10.1093/dnares/7.6.347.
RX   PUBMED; 11214970.
RA   Nagase T., Kikuno R., Hattori A., Kondo Y., Okumura K., Ohara O.;
RT   "Prediction of the coding sequences of unidentified human genes. XIX. The
RT   complete sequences of 100 new cDNA clones from brain which code for large
RT   proteins in vitro";
RL   DNA Res. 7(6):347-355(2000).
XX
DR   MD5; 6cb20e8c03c5140c50cdfec6815005db.
DR   Ensembl-Gn; ENSG00000133812; homo_sapiens.
DR   Ensembl-Tr; ENST00000256190; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4809
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /clone="fj16085"
FT                   /note="vector:pBluescriptII SK plus"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        <1..3374
FT                   /codon_start=3
FT                   /gene="KIAA1766"
FT                   /product="KIAA1766 protein"
FT                   /note="Start codon is not identified. fj16085 cDNA clone
FT                   for KIAA1766 has a 37-bp deletion at the position between
FT                   280 and 318 of the sequence of KIAA1766."
FT                   /db_xref="GOA:Q86WG5"
FT                   /db_xref="H-InvDB:HIT000001482.16"
FT                   /db_xref="HGNC:HGNC:2135"
FT                   /db_xref="InterPro:IPR001194"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR004182"
FT                   /db_xref="InterPro:IPR005112"
FT                   /db_xref="InterPro:IPR005113"
FT                   /db_xref="InterPro:IPR010569"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR022096"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR030564"
FT                   /db_xref="InterPro:IPR030567"
FT                   /db_xref="InterPro:IPR037516"
FT                   /db_xref="InterPro:IPR037823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q86WG5"
FT                   /protein_id="BAB21857.1"
FT                   /translation="RFPQKDWDDTPFPQGIELFCQPGGWQLSRERKQPTFFVVVLTDID
FT                   SDRHYCSCLTFYEAEINLQGTKKEEIEGEAKVSGLIQPAEVFAPKSLVLVSRLYYPEIF
FT                   RACLGLIYTVYVDSLNVSLESLIANLCACLVPAAGGSQKLFSLGAGDRQLIQTPLHDSL
FT                   PITGTSVALLFQQLGIQNVLSLFCAVLTENKVLFHSASFQRLSDACRALESLMFPLKYS
FT                   YPYIPILPAQLLEVLSSPTPFIIGVHSVFKTDVHELLDVIIADLDGGTIKIPECIHLSS
FT                   LPEPLLHQTQSALSLILHPDLEVADHAFPPPRTALSHSKMLDKEVRAVFLRLFAQLFQG
FT                   YRSCLQLIRIHAEPVIHFHKTAFLGQRGLVENDFLTKVLSGMAFAGFVSERGPPYRSCD
FT                   LFDELVAFEVERIKVEENNPVKMIKHVRELAEQLFKNENPNPHMAFQKVPRPTEGSHLR
FT                   VHILPFPEINEARVQELIQENVAKNQNAPPATRIEKKCVVPAGPPVVSIMDKVTTVFNS
FT                   AQRLEVVRNCISFIFENKILETEKTLPAALRALKGKAARQCLTDELGLHVQQNRAILDH
FT                   QQFDYIIRMMNCTLQDCSSLEEYNIAAALLPLTSAFYRKLAPGVSQFAYTCVQDHPIWT
FT                   NQQFWETTFYNAVQEQVRSLYLSAKEDNHAPHLKQKDKLPDDHYQEKTAMDLAAEQLRL
FT                   WPTLSKSTQQELVQHEESTVFSQAIHFANLMVNLLVPLDTSKNKLLRTSAPGDWESGSN
FT                   SIVTNSIAGSVAESYDTESGFEDSENTDIANSVVRFITRFIDKVCTESGVTQDHIKSLH
FT                   CMIPGIVAMHIETLEAVHRESRRLPPIQKPKILRPALLPGEEIVCEGLRVLLDPDGREE
FT                   ATGGLLGGPQLLPAEGALFLTTYRILFRGTPHDQLVGEQTVVRSFPIASITKEKKITMQ
FT                   NQLQQNMQEGLQITSASFQLIKVAFDEEVSPEVVEIFKKQLMKFRYPQSIFSTFAFAAG
FT                   QTTPQIILPKQKEKNTSFRTFSKTIVKGAKRAGKMTIGRQYLLKKKTGTIVEERVNRPG
FT                   WNEDDDVSVSDESELPTSTTLKASEKSTMEQLVEKACFRDYQRLGLGTISGSSSRSRPE
FT                   YFRITASNRMYSLCRR"
XX
SQ   Sequence 4809 BP; 1465 A; 960 C; 1011 G; 1373 T; 0 other;
     agagatttcc acagaaggac tgggatgata caccttttcc acagggaatt gagttgtttt        60
     gtcagcctgg cgggtggcag ctgtccagag agaggaagca gccaacgttc tttgtggttg       120
     tcctgacaga cattgactca gatcgacatt actgctcatg cctaaccttc tatgaggcag       180
     agatcaatct tcagggaaca aagaaggaag agattgaagg tgaagcaaaa gtgtctggtt       240
     taattcagcc tgcagaagtg tttgctccca aaagcctggt gttggtatcc agattatatt       300
     atccagaaat ttttagggct tgcctgggtt tgatctatac cgtgtatgtg gacagcctga       360
     atgtctcctt ggaaagtcta attgcaaacc tttgtgcctg ccttgtccca gcggctggag       420
     ggtctcagaa gctgttttct ttgggtgcag gagatagaca gttgatccag actcctttac       480
     atgatagtct tcctatcacg ggcactagtg tggctctcct gttccagcaa ttgggaattc       540
     aaaatgtcct cagcctcttt tgtgcagtcc tcacagaaaa taaggttctc ttccattctg       600
     caagtttcca gagacttagt gatgcttgta gagccctgga atctttaatg tttcctctta       660
     aatatagtta tccttatatc cctattctcc cggctcagct actggaagtt ctaagttccc       720
     caacgccttt cattattgga gtacattctg tctttaaaac tgatgtccat gaacttttag       780
     atgtaatcat agcagatttg gatggaggca ctattaaaat tcccgaatgt attcacctct       840
     cttccctccc agaaccactt ctacatcaga ctcaatcagc tctttctttg attttacacc       900
     cagatttgga agtagcagat catgcttttc ctcctccacg aacagcttta tcccactcaa       960
     aaatgctgga taaagaggtg cgagccgttt tccttagatt atttgcacaa ctcttccaag      1020
     gatatagatc ctgcctgcaa cttataagaa ttcatgcaga gccagtaata catttccaca      1080
     agacagcatt cttggggcag cgtggtttgg tcgagaatga tttcctcact aaagtactca      1140
     gtggaatggc atttgcaggt tttgtttcag aaagaggtcc tccttataga tcttgtgatc      1200
     tctttgatga gttggtagcc tttgaagtag agagaattaa agttgaagaa aataacccag      1260
     tgaagatgat aaagcatgtc agggaacttg ctgagcaact attcaaaaat gagaatccaa      1320
     atcctcatat ggcattccag aaagttccac ggccaacaga aggatcccat ttgcgagttc      1380
     atattcttcc tttcccagag attaatgaag cccgggttca ggaattaata caggaaaatg      1440
     ttgctaagaa ccagaatgca cctcctgcca cacgaataga aaagaaatgt gttgtgccag      1500
     caggtccacc tgttgtttcg ataatggaca aggtgacgac agttttcaac agtgcacaaa      1560
     gactagaagt tgtcagaaac tgtatctcat tcatatttga aaataaaatt ttggaaactg      1620
     aaaagaccct tcctgctgca ctcagagccc ttaaaggaaa ggcagcaaga cagtgtctca      1680
     ctgatgaatt gggtttgcat gtccagcaaa accgggcaat attagaccat caacagtttg      1740
     actacataat aaggatgatg aattgtactc tacaggattg ttcaagttta gaagaataca      1800
     acattgccgc agcattactc cctttgacca gtgctttcta taggaaactt gcccctggag      1860
     tcagccagtt tgcttacacg tgtgtacaag accaccccat ttggacaaat cagcaatttt      1920
     gggagacaac cttttacaat gcagtgcagg aacaggttcg ctccctttat ctctcagcca      1980
     aggaagacaa tcatgccccg catctgaagc aaaaggataa gcttcctgat gaccattatc      2040
     aggagaagac agcaatggac ctggcagctg agcaactacg cctttggcct accctgagca      2100
     agtcaactca gcaagagcta gtgcaacatg aggaaagcac tgtctttagt caggccattc      2160
     actttgcaaa cctcatggtg aacctgctag ttccactcga cacaagtaaa aacaagctcc      2220
     taagaacatc agcgccaggt gactgggaga gcggaagcaa cagcattgtc acaaacagta      2280
     ttgcaggaag tgtagctgag agctatgata cagagagtgg gtttgaagat tcagagaata      2340
     ctgacattgc caattctgtt gtgcggttca ttacccgatt tattgacaaa gtttgtacag      2400
     agagtggagt tactcaggat cacatcaaga gccttcattg catgatacca ggaattgtag      2460
     ctatgcacat tgagacccta gaagcagtac atcgagaaag cagaagactt ccgcctattc      2520
     agaagcccaa gattcttaga cctgctctgc tgccaggaga agaaattgtc tgtgagggtc      2580
     ttcgagtctt gctggatcct gatggaagag aagaagctac tggaggtctt cttggaggcc      2640
     ctcagctcct gccagcagaa ggagccttgt tcctcaccac atacagaatt ctcttcagag      2700
     gaacacccca tgatcagtta gtgggtgagc agacagttgt gcggagcttt cccattgcct      2760
     ccatcaccaa ggagaagaag attacaatgc agaaccagct acagcagaac atgcaagaag      2820
     gactgcagat cacatcagca tcttttcagt tgattaaggt agcatttgat gaagaagtca      2880
     gtccagaagt agtagagatc tttaagaaac agctgatgaa gttccgttat cctcagtcca      2940
     ttttcagtac ctttgctttt gctgctggac aaactacccc acaaataatt ttaccaaaac      3000
     agaaggaaaa gaacacttct tttcgtacct tctcaaaaac aattgtgaaa ggtgccaaaa      3060
     gggcagggaa aatgacaatt gggcggcaat atttactgaa gaagaagaca gggacaattg      3120
     tggaagaaag agtaaatcgt cctggatgga atgaagatga tgatgtatct gtttcagatg      3180
     agagtgagct ccccacaagt accaccctga aggcctccga gaagtctaca atggaacagt      3240
     tggtggaaaa agcttgtttc agagactatc agcgtttagg tttaggaacc ataagtggca      3300
     gctcttcccg ttcaagaccc gagtatttta gaattactgc ctccaacagg atgtattcac      3360
     tctgccggag gtaagtgtgt cagtgggctc caaaaagagg tcttctttcc tttcttctta      3420
     tttgaatctt taataggcca tttgcatcca tagccctgag atagataaaa atgcctgaaa      3480
     ataagaacaa ggtctccagg atacgagcaa gcatctcatt ggcattctcg gaacaattac      3540
     cttactgaaa gtacctctag taggtgagaa ggtgaaaggt aaagtactca ccccctatga      3600
     atttctcttg tctttctctt cccagtttgc ttcttttcta gcatgactaa agataacttg      3660
     aagaacagga ttttcccagc ccaatagagg acatgaaagt cttttgtagg ctggggagcc      3720
     acaaactctt tctataaagg gtcagttggt aaatattttc agtttatgag ccatagagtc      3780
     tcttgttgca gctattcaac tgtgccgcaa aagcagccac agacagtaag gaaatgagta      3840
     ggcatggcca gttttggccc acaggctata atttgctgac ccaggtgtag gcaaggcttt      3900
     cttatgcggt ctaattggaa tgttttcaag ggaatattac ttaaaggatg taaataaaga      3960
     ggcattttct tttttcagtt cttgtcatct ctcactgttt ttcaaatatg ttgagtctta      4020
     ttccatgctt tactatatgt aaatatatat tttctaaaat tacattttca ccatccacaa      4080
     gtttagtcat tttcatctcc aggtaagatt tttctttgca tttataaatt cctgcttaaa      4140
     cagctctgaa atcactttgt aaattgtaag ctttgtacat attttagaaa gttatcttaa      4200
     tgttactttc aaccctgttg ctcttgaaga tagatatgtc attttaaatg gcaatttaag      4260
     tttacaaata ttaatatgaa acttcagaaa caagttggga atatagtttt gagattgtgg      4320
     ccaaataaac attttgcatg aagttctgaa aaattggcac tctgagtatg cagtaatttt      4380
     tctggaattc tccgtcattc taactaaatt ttctctgaag atgagtcatg ttgtcggggt      4440
     gtgatgtcct gctgtttgga aagtttgcta tcaaaattat gccagccatt gagaaaacag      4500
     actcatttat cattccaatc tgtcagaagt aaaataaaat tttaatagat gacttattag      4560
     aacactggtt ataaagcatt tatgatggta aaaagtaata tatatccatt aagttattag      4620
     caggaaggaa atggaataat aaaaaataat ccaaaagaag gcaagaaagg aaaaaaaagg      4680
     ggacatagaa caaatggaat aaataacaag tagtaagatg gtagatttaa attcaaatat      4740
     atccataatt gcattaatta ttaattgact aaatgttcca attcaaagaa agagatcagg      4800
     gtttgcttt                                                              4809
//

If you have problems or comments...

PBIL Back to PBIL home page