(data stored in ACNUC32233 zone)

EMBL: AB055618

ID   AB055618; SV 1; linear; mRNA; STD; MUS; 8740 BP.
XX
AC   AB055618;
XX
DT   10-JAN-2002 (Rel. 70, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Mus musculus mRNA for betaIV-spectrin sigma1, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-8740
RA   Komada M.;
RT   ;
RL   Submitted (07-FEB-2001) to the INSDC.
RL   Masayuki Komada, Tokyo Institute of Technology, Department of Biological
RL   Sciences, Faculty of Bioscience and Biotechnology; 4259 Nagatsuta,
RL   Midori-ku, Yokohama, Kanagawa 226-8501, Japan
RL   (E-mail:makomada@bio.titech.ac.jp, Tel:81-45-924-5702, Fax:81-45-924-5771)
XX
RN   [2]
RX   DOI; 10.1083/jcb.200110003.
RX   PUBMED; 11807096.
RA   Komada M., Soriano P.;
RT   "Beta]IV-spectrin regulates sodium channel clustering through ankyrin-G at
RT   axon initial segments and nodes of Ranvier";
RL   J. Cell Biol. 156(2):337-348(2002).
XX
DR   MD5; 852c94cbd3831049975ed318cfd4ad7e.
DR   EuropePMC; PMC2199236; 11807096.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..8740
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   5'UTR           1..142
FT   CDS_pept        143..7828
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /product="betaIV-spectrin sigma1"
FT                   /db_xref="GOA:Q8VIE5"
FT                   /db_xref="InterPro:IPR001589"
FT                   /db_xref="InterPro:IPR001605"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002017"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR016343"
FT                   /db_xref="InterPro:IPR018159"
FT                   /db_xref="InterPro:IPR036872"
FT                   /db_xref="InterPro:IPR041681"
FT                   /db_xref="MGI:MGI:1890574"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VIE5"
FT                   /protein_id="BAB83243.1"
FT                   /translation="MAQVPGEVDNMEGPAVSNNNNPSARWESPDRGWDREPPAAANAAA
FT                   SLFECSRIKALADEREAVQKKTFTKWVNSHLARVGCHIGDLYADLRDGFVLTRLLEVLS
FT                   GEQLPRPTRGRMRIHSLENVDKALQFLKEQRVHLENVGSHDIVDGNHRLTLGLVWTIIL
FT                   RFQIQVIKIETEDNRETRSAKDALLLWCQMKTAGYPEVNIQNFTTSWRDGLAFNALIHR
FT                   HRPDLVDLSKLTKSNANYNLQRAFRTAEQHLGLARLLDPEDVNMEAPDEKSIITYVVSF
FT                   YHYFSKMKALAVEGKRIGKVLDQVLEVDKIIERYEELAAELLAWIHRTVDLISNQKFAN
FT                   SLSGVQQQLQAFTAYCTLEKPVKFQEKGNLEVLLFSIQSKLRAHNRRLFVPREGCGIWD
FT                   IDKAWGELEKAEHEREAALRAELIRQEKLELLAQRFDHKVAMRESWLNENQRLVSQDNF
FT                   GYELPAVEAAMKKHEAIEADIAAYEERVQGVAELAQALAAEGYYDARRVAAQRDSVLRQ
FT                   WALLTGLVGARRTRLEQNLALQKVFQEMVYMVDWMEEMQTQLLSRECGQHLVEADDLLQ
FT                   KHGLLEGDIAAQSERVEALNAAALRFSQLQGYQPCDPQVICNRVNHVHGCLSELQEQAA
FT                   RRRAELEASRSLWALLQELEEAESWARDKERLLEATSGSGGAAGTAGGAHDLSSTARLL
FT                   AQHKILQGELGGRRALLQQALRRGEELAAAGGSVGPGAEPLHLAGLAERAASARRRWQR
FT                   LEEAAARRERRLQEARALHQFGADLDGLLDWLRDAYRLAAAGDFGHDEASSRRLARQHR
FT                   ALTGEVEAHRGPVGGLRRQLATLGGASGAGPLVVALQVRVVEAEQLFAEVTEVAALRRQ
FT                   WLRDALAVYRMFGEVHACELWIGEKEQWLLAMRVPDSLDDVEVVQHRFESLDQEMNSLM
FT                   GRVLDVNQTVQELVEGGHPSSDEVRSCQDHLNSRWNRIVELVEQRKEEMSAVLLVENHV
FT                   LEVAEVRAQVREKRRAVESAPRAGGALQWRLSGLEAALQALEPRQAALLEEAALLAERF
FT                   PAQATRLHQGAEELGAEWGALAGAAQACGEAVAAAGRLQRFLRDLDTFLDWLVRAQEAA
FT                   GAVEGPLPRSLEEADGLLARHAALKEEVDQREEDYARIVAASEALLASEGAELGPGLAL
FT                   DEWLPHLEVGWHKLLGLWEERREALVQAHVYQLFLRDLCQALAVLRNQEVALSGAELPC
FT                   TVESVEEAMKRHRDFLTTMELNQQKMQVAVQAAESLLRQGNAYGEQAQEAVARLLEKSQ
FT                   ENQLRAQQWMQKLLDQLVLQHFLRDCHELDGWIHEKMLMARDGTREDSHKLHKRWLRHQ
FT                   AFMAELAQNKEWLEKIEREGQQLMQEKPELAASVRKKLGEIRQCWAELESTTQAKARQL
FT                   FEASKADQLVQSFAELDKRLLHMESQLQDVDPGGDLATVNSQLKKLQSMESQVEEWCRE
FT                   VGELQAQTAALPLEQASKELVGERQSAVGERLVRLLEPLQERRRLLLASKELHQVAHDL
FT                   DDELAWVQERLPLAMQTERGTGLQAVQQHIKKNQGLRREIQAHGPRLEEVLERAGVLAS
FT                   LRSPEAEAVRRGQEQLQSAWTGLREAAERRQQTLDAAFQVEQYYFDVAEVEAWLGEQEL
FT                   LMMSEDKGKDEQSTLQLLKKHLQLEQGVENYEESIAQLSRQCRALLEMGHPDSEQISRR
FT                   QSQVDRLYVALKELGEERRVSLEQQYWLYQLSRQVDELEHWIAEKEVVAGSPELGQDFE
FT                   HVSVLQEKFSEFASETGTAGRERLAAVNQMVDELIECGHTAAATMAEWKDGLNEAWAEL
FT                   LELMGTRAQLLAASRELHKFFSDARELQGQIEEKRRRLPRLTAPPEPRPSASSMQRTLR
FT                   AFEHDLQLLVSQVRQLQEGAAQLRTVYAGEHAEAIASREQEVLQGWKELLAACEDARLH
FT                   VSSTADALRFHSQARDLLSWMDGIAGQIGAADKPRDVSSVEVLMNYHQGLKTELEARVP
FT                   ELAACQELGRSLLLNKSAMADEIQAQLDKLGSRKEEVSEKWDRHWEWLQQMLEVHQFAQ
FT                   EAVVADAWLTAQEPLLQSRELGSSVDEVEQLIRRHEAFRKAAAAWEERFSSLRRLTTIE
FT                   KLKAEQSKQPPTPLLGRKFFGDPTELAAKAAPLLRPGGYDRGLEPLARRASDTLSAEVR
FT                   TRVGYVRQELKPERLQPRIDRLPETSGKVEPAAPTAAALDTTDTPGTPAATEQVRPRSE
FT                   RQELADRAEELPRRRRSERQESVDQPEETARRRRPERQESADHEGPHSLTLGRYEQMER
FT                   RRERRERRIERQESSEQETPTRGELVKGKATLADIVEQLQEKEAGPGIPAGVPSLPQPR
FT                   ELPPGRLPNGLEPPERTPRPDRPRARDRPKPRRRPRPREGGEGGGSRRSRSAPAQGGSA
FT                   PAPPPPPTHTVQHEGFLLRKRELDANRKSSNRSWVSLYCVLSKGELGFYKDSKGPASGG
FT                   THGGEPLLSLHKATSEVASDYKKKKHVFKLQTQDGSEFLLQAKDEEEMNGWLEAVANSV
FT                   AEHAEIARWGQTLPTTSSTDEGNPKREGGERRASGRRK"
FT   3'UTR           7829..8740
FT   regulatory      8716..8721
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 8740 BP; 1765 A; 2467 C; 3101 G; 1407 T; 0 other;
     gcggatctgg ccgagcggcg ggccggtggg gccgaacaga gccgggcccg gtccggcgac        60
     gaacgcccgc agggagggcg gtgctgcgcg gcgagcatcc gggaccgcat cggcggccgg       120
     cgcccaggcc ctgcctcccc caatggcaca agtaccaggg gaggtggaca acatggaggg       180
     cccagcagtc tccaacaaca acaacccttc agctcgctgg gagagcccag atcggggctg       240
     ggatcgggaa cctcccgcag ccgccaatgc tgcggcttca ctctttgagt gctctcggat       300
     caaggcttta gcagatgagc gagaggctgt gcagaagaaa accttcacca agtgggtgaa       360
     ttcgcacctt gcccgcgtgg gctgccacat tggagacctg tatgcagacc ttcgggacgg       420
     gtttgtcctc acccggcttc tggaagtgct gtcgggggag cagctgccga ggcccactcg       480
     cggccgcatg cggatccact cgctggagaa cgtggacaag gctctgcagt tcctgaagga       540
     gcagcgtgtg catctggaga acgtggggtc acatgacatc gtggatggga accaccgact       600
     gacgctgggg ctggtctgga ccatcatcct gcgcttccag attcaagtca tcaagattga       660
     gacagaagac aacagagaga cccgctccgc caaggacgct ctgctcttgt ggtgccagat       720
     gaaaacagcc ggttaccctg aggtaaacat ccagaatttc accaccagct ggagagatgg       780
     cctggccttc aatgccctca ttcaccgtca caggcctgat cttgtggacc tcagcaaact       840
     taccaagtcc aacgccaact acaacctgca gagagctttc cgcacagccg agcagcacct       900
     ggggctagca cgtctgctgg accccgaaga tgtgaacatg gaggctccag atgagaagtc       960
     cattatcacc tatgtggtct ccttctacca ctacttctcc aagatgaagg ctctggcggt      1020
     ggagggaaaa cggattggaa aggtcctgga ccaggtgttg gaggtggaca agatcataga      1080
     acgctatgag gagctggcgg cggagctgtt ggcctggatc catcgcactg tggacctcat      1140
     tagcaaccaa aagtttgcta actcactgag tggggtgcag cagcagctgc aggccttcac      1200
     ggcttactgt acgctggaga agcccgtcaa gtttcaggag aaggggaacc tggaggtgct      1260
     actcttcagc atccaaagca aactgcgcgc ccacaaccgg cgcctctttg tgcctcgaga      1320
     aggctgtggc atctgggata ttgacaaggc gtggggtgag ctggagaagg cagagcatga      1380
     gcgagaggcg gccctcagag ctgagctcat ccggcaggag aagttggaac tcttggctca      1440
     aagatttgac cacaaggtgg ccatgaggga gagctggcta aatgagaacc agcgcctggt      1500
     ctcccaggac aacttcggat atgagctgcc ggcagtggag gcagccatga agaagcacga      1560
     agccattgag gcagacattg cagcctacga ggagcgggtt cagggtgtgg cggagttagc      1620
     ccaggcgttg gcagctgaag gctactatga tgcccggcgg gtggctgccc agcgtgacag      1680
     tgtccttcgc cagtgggccc tgctgaccgg gctggtaggt gcccggcgga cccggcttga      1740
     gcagaatctg gccctgcaga aggtcttcca ggagatggtc tacatggtgg actggatgga      1800
     ggagatgcag actcagctgc tgtctcggga atgtgggcag cacctggtgg aggccgatga      1860
     cctgctgcag aagcacgggc tgctggaggg ggacatcgca gcccagagtg agcgagtgga      1920
     ggccctcaat gctgcagccc tgagattctc ccagctacag ggctatcagc cctgcgaccc      1980
     tcaggtcatt tgcaaccgtg tgaaccacgt gcatggctgt ctgtcggagc tgcaggagca      2040
     ggcagcacgg cggcgcgcag agctggaagc ttctcggagc ctgtgggcgc tgctgcagga      2100
     gctggaggag gcggagagtt gggcgcggga caaggagcgc ctcctagagg ccacgagcgg      2160
     cagtggtggc gcggcgggca cggcgggcgg cgcgcacgac ctgtccagca ccgctcgcct      2220
     gctggcgcag cataagatcc tgcagggcga gctgggcggc cggcgggcgc tgctgcagca      2280
     ggcgctgcga cgcggggagg agttggctgc ggcgggcggc tccgtgggcc cgggcgccga      2340
     gcctttgcat ttggctggcc tggcggagcg cgcggctagc gctcggcgcc gctggcagcg      2400
     gctggaagag gcggctgcgc gccgggaacg gcggctgcag gaggcgcggg cgctgcacca      2460
     atttggcgcc gacctggacg ggctgctgga ctggcttcgt gacgcgtatc gtctagcagc      2520
     cgctggagat tttggtcacg acgaagcgtc cagccgtcgc ctggcgcgcc agcaccgcgc      2580
     tctcaccggg gaggtggaag cgcaccgtgg ccctgtgggt ggcctgaggc gccagctggc      2640
     gacactggga ggagccagtg gcgcagggcc gctggtggtg gctctgcagg tgcgcgtggt      2700
     ggaagccgaa cagttgttcg ccgaggtgac cgaggtggcc gcgctgcgac gacagtggct      2760
     tcgggacgcg ctcgccgtgt accgcatgtt cggcgaggta catgcctgcg agttgtggat      2820
     cggggagaaa gagcagtggc tgctggccat gcgtgtgccc gattccctcg acgacgttga      2880
     ggtggtgcag catcgatttg aaagtcttga ccaggaaatg aacagcctga tgggccgagt      2940
     cctggatgtg aaccaaacag ttcaggagtt ggtagaagga ggtcatccca gctccgatga      3000
     ggtgcgctcc tgtcaggacc atctcaacag caggtggaac cgcatcgtgg agttggtgga      3060
     acagcgcaaa gaggagatga gcgcggtgct gctggtggag aaccacgtgc tggaggtggc      3120
     cgaggtgcgc gcccaagtgc gcgagaagcg acgggcagtg gagagcgcgc cccgggcggg      3180
     gggagccctg caatggcgcc tgagtggcct ggaggcggct ctacaggcgc tagagccgcg      3240
     acaggcggcg ctgctggagg aggcggcgct gctggccgaa cgcttccccg cacaggcgac      3300
     gcgcctgcac cagggcgccg aggagctagg agccgagtgg ggcgcactgg ccggagcggc      3360
     tcaggcctgc ggcgaggcgg ttgcggcggc aggtcgcctg cagcgtttcc tgcgcgattt      3420
     ggatactttc ctggactggc tggtgcgggc gcaggaggca gcaggcgccg tcgaggggcc      3480
     gctgcctcgc agcctggagg aggcggatgg gctgctggcg cgccacgccg cgctcaagga      3540
     ggaggtggat cagcgtgagg aggactacgc gcgcatcgtg gctgccagtg aagcgctgct      3600
     agcgtccgag ggcgcggagc tgggccccgg tctggcgcta gacgagtggc tgccgcacct      3660
     cgaggttggc tggcacaaac tgctcggctt gtgggaggag cgcagggagg cgctggtcca      3720
     agcgcacgtc tatcaactct tcctgagaga cctgtgccag gcgcttgcgg tgctgcgcaa      3780
     ccaggaggtg gcgctgtctg gcgctgaact cccttgcaca gtggagtcgg tagaagaggc      3840
     gatgaaaagg caccgggatt ttctcaccac gatggagctg aaccagcaaa agatgcaggt      3900
     ggcggttcaa gctgcagaga gcctgctgcg gcaaggcaac gcctacgggg agcaggcgca      3960
     ggaggcagtg gctcggctgc tagagaagag ccaagaaaat cagctgaggg cccagcagtg      4020
     gatgcaaaaa ctactggacc agcttgtgct gcagcacttt cttagagatt gtcatgagct      4080
     ggatggctgg atccatgaga agatgctgat ggctcgtgat ggcacccggg aagacagcca      4140
     caagctgcac aagagatggc tccggcacca ggcgttcatg gctgagctgg ctcagaataa      4200
     ggagtggctg gagaagatag aaagggaggg ccagcaactg atgcaggaga aaccggagct      4260
     ggcagcctct gtgcgcaaga aattaggtga gatccggcag tgctgggcgg agctggagag      4320
     caccacacag gccaaggcgc gccagctctt cgaggccagc aaggcggacc agctagtgca      4380
     gagcttcgcg gagctggaca agcggctgct tcacatggaa agccagctgc aagacgtaga      4440
     ccccggtggg gacctggcca ctgtcaacag ccagctcaag aagttacagt ccatggagtc      4500
     tcaggtggag gagtggtgcc gagaggtggg cgagcttcag gcgcagacgg cggcgcttcc      4560
     gctggagcag gcgagcaagg agttggtggg ggagcggcag agtgcggtgg gcgagcgcct      4620
     ggtgcgcctg ctggagcctt tgcaggagcg acgccgcttg ttgctggcat ccaaggagct      4680
     gcatcaggtg gcccacgacc tggacgatga actggcttgg gttcaagagc ggctgccact      4740
     ggccatgcag acagagcgag gcactggctt gcaggctgtc cagcagcaca tcaaaaagaa      4800
     ccagggcctg cggcgggaga tccaggctca cgggccgcgc ttggaggagg tgctggagcg      4860
     cgcgggcgtg ctggcctcgc tgcgcagccc agaggccgaa gcggtgcgcc gtggccaaga      4920
     gcagctgcag agcgcctgga ccgggctgcg ggaagcggcc gaacggcggc agcagacgct      4980
     ggacgccgcc ttccaggtgg aacagtacta ctttgacgtg gctgaggtgg aggcatggct      5040
     gggcgagcag gagctgctca tgatgagtga ggacaagggc aaggatgaac agagcaccct      5100
     gcagctgctc aagaagcatt tacaactgga acagggcgtg gagaactatg aggaaagcat      5160
     cgcccagctg tcacgccagt gccgggcgct actggaaatg ggacacccag acagtgagca      5220
     aatcagccgc cgacagtccc aagtggatcg cctctatgtg gcgctcaagg agctgggcga      5280
     ggaacgcagg gtgagcctgg aacagcagta ctggctctac cagctcagcc gccaggtgga      5340
     tgagctggaa cactggatag ccgagaagga ggtggtagct ggctccccag agctgggcca      5400
     ggacttcgaa cacgtgtcgg tgctacagga gaaattctca gagtttgcca gtgagacagg      5460
     aaccgcaggg cgggagcggc tggcggcggt caaccagatg gtggacgagc tgattgagtg      5520
     tggtcacaca gcagcggcca ccatggctga gtggaaggac gggctgaacg aggcctgggc      5580
     tgagctgctg gaactcatgg gcacccgggc ccagctgctc gctgcctctc gggagctgca      5640
     taagttcttc agcgatgccc gggagcttca agggcagatt gaggagaagc ggaggaggct      5700
     gccccgcctg acggcaccac ctgaacccag acccagtgcc agctccatgc agcggaccct      5760
     gcgagccttt gagcacgacc tgcagctcct cgtgtcccag gtacggcagc tgcaggaagg      5820
     ggcggcccag ctgcggacgg tgtacgctgg cgagcacgcc gaggccatcg ccagccgcga      5880
     gcaggaggtg ttgcagggct ggaaggagct gctagcagcc tgtgaagatg ctcgtctgca      5940
     cgtcagctcc acggccgacg ccctgcgctt ccacagccag gcccgcgacc tgctctcctg      6000
     gatggacggc atcgcgggcc agatcggggc agctgacaaa cccagggatg tgtcatcggt      6060
     ggaggtgctt atgaactacc accagggcct gaagacagag ttggaggcgc gcgtgcctga      6120
     gctggcagcc tgccaggagc tggggcggtc tctattactc aacaaaagcg ccatggctga      6180
     tgagatccag gcccagctgg acaagctggg aagccggaag gaggaggtgt cggagaagtg      6240
     ggaccgtcac tgggagtggc tgcagcagat gctggaggta caccagtttg ctcaggaggc      6300
     cgtggtggct gacgcctggc tgacagctca ggaaccgctc ctgcagagcc gggagctggg      6360
     cagcagtgtg gatgaggtgg agcagctcat ccggcgacac gaggccttcc gaaaagcagc      6420
     tgcggcctgg gaggagaggt tcagctctct gcggcgcttg accacgatcg agaaactcaa      6480
     ggcagaacag agtaagcagc cacccacccc cttactgggg cgcaagttct ttggggaccc      6540
     cacagagctg gcggccaagg cagcgccttt gctgcgtcca gggggctatg acaggggcct      6600
     ggagcctttg gcccgcaggg cctcggacac gctgtcagcg gaagtgcgga cccgggttgg      6660
     gtatgtgcgc caggagctca agcccgagcg tctccagccg cgcattgacc ggctgccaga      6720
     gacctcgggg aaggtagaac ccgcggcccc gacagccgca gcgttggaca cgacggacac      6780
     ccctgggact ccggcggcga cggagcaggt ccggccccgg tcggagcgcc aggagttagc      6840
     ggatcgtgcg gaggagctgc cacggagacg aagatcagaa cgccaggagt ccgtggatca      6900
     accagaggag acagcgcgga ggcggcggcc tgagcgccag gagtccgcgg accacgaggg      6960
     gccgcacagc cttactctag gtcgctacga gcagatggag agacggcggg agcggaggga      7020
     gcggcggata gaacgacagg agtctagcga acaggagact cccaccaggg gagagctggt      7080
     caaagggaag gccactctgg ctgatattgt ggagcaactt caggagaaag aggcaggccc      7140
     agggatccct gctggggtgc cgtcgctgcc tcagcctcgc gagcttcccc ctggtcgcct      7200
     gcccaacggg cttgagccgc ccgagcggac acctcggccc gatcggccgc gggcacggga      7260
     ccggcccaag ccgcgccggc ggccacggcc tcgagagggt ggtgagggcg ggggaagccg      7320
     gcgctcgcgc tccgcccctg cccagggagg ttccgccccc gcgccgccac ctccgcccac      7380
     tcacacagtg cagcacgagg gcttcctgct gcgcaagcgc gagctcgacg ctaaccgcaa      7440
     gtcgtccaac cggtcatggg tgagcctgta ctgtgtgctc agcaaggggg agctgggctt      7500
     ctacaaggac tccaaaggcc cagcatcagg gggcacgcat ggcggggaac cactgctcag      7560
     cctgcacaaa gccaccagcg aggtggctag tgactacaag aaaaagaagc atgtcttcaa      7620
     gcttcagacc caggatggca gtgagttctt gctccaggct aaagatgagg aggagatgaa      7680
     cggctggctg gaggctgtgg ctaactccgt ggcagaacac gccgagatcg cccgatgggg      7740
     tcagacacta cctaccacgt catccacaga tgagggcaac cccaagcgtg agggcgggga      7800
     gcgtagggcc agcgggcgcc ggaagtgatt ccaggtaccc tttcccccac cttggagtct      7860
     gacaagtctc cttgcccctc ctctctgcac tgtggacaca aagacaactt ctcatccgca      7920
     agggccggaa tgactgcgga tgtgccactg tgggcctgaa atagaaggga cttctgcact      7980
     ccaagaggtg gtggtagggg attgctgtcc ctatagccat atctcggtcc cttcccgctc      8040
     gccaacccca ccccaggtgc tggggctcca ttctttttat gcaataactg agcttggtgg      8100
     ggccgggcag ggagccagtt gagccaagct ccctgcccaa tcgtcagatc ctgccccaag      8160
     aatctggagt ggcgagggat ctaggaggtg gtgatttgtt ggcctcctct ccgccctaag      8220
     gatggacaac gggggcgctg gtgaggtccc ctggaccatc cagggtgcta gggggtgggg      8280
     aggggacaca ctccctccct gcctttacct cacttccaat gctgccttga tctgtctggg      8340
     aagagggagg acaggggccc ttagcccctg tactccgcca tctcagagcc atgcggttaa      8400
     ttcctgactt agtttatttt tgcaaaaacg tagacccccc cccttccttc ccccgccccg      8460
     catccgcgaa ggcttttaat aggaggggag tcaaagttca aaactgtctt cctctctcct      8520
     ccccgattct agctgtaaat gccacttccc gagggggagg gggtgggaaa gccctccccc      8580
     tgcatgcttc tggctggagc acctccctgg gacggaggga atcagggtta caggcaaccc      8640
     cagtggctgc ttggagacgc tgccaaggca ggggggtgcg gggcggtgtg gcaggcgcac      8700
     actgtatgta cctataataa accctttggc tttgacagtc                            8740
//

If you have problems or comments...

PBIL Back to PBIL home page