(data stored in ACNUC32233 zone)

EMBL: AB055619

ID   AB055619; SV 1; linear; mRNA; STD; MUS; 4743 BP.
XX
AC   AB055619;
XX
DT   10-JAN-2002 (Rel. 70, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Mus musculus mRNA for betaIV-spectrin sigma6-A, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4743
RA   Komada M.;
RT   ;
RL   Submitted (07-FEB-2001) to the INSDC.
RL   Masayuki Komada, Tokyo Institute of Technology, Department of Biological
RL   Sciences, Faculty of Bioscience and Biotechnology; 4259 Nagatsuta,
RL   Midori-ku, Yokohama, Kanagawa 226-8501, Japan
RL   (E-mail:makomada@bio.titech.ac.jp, Tel:81-45-924-5702, Fax:81-45-924-5771)
XX
RN   [2]
RX   DOI; 10.1083/jcb.200110003.
RX   PUBMED; 11807096.
RA   Komada M., Soriano P.;
RT   "Beta]IV-spectrin regulates sodium channel clustering through ankyrin-G at
RT   axon initial segments and nodes of Ranvier";
RL   J. Cell Biol. 156(2):337-348(2002).
XX
DR   MD5; 51bb9a51113ef45fd8c9d6c2603e22dc.
DR   EuropePMC; PMC2199236; 11807096.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4743
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   5'UTR           1..105
FT   CDS_pept        106..3831
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /product="betaIV-spectrin sigma6-A"
FT                   /db_xref="GOA:Q8VBX2"
FT                   /db_xref="InterPro:IPR001605"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002017"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR018159"
FT                   /db_xref="InterPro:IPR041681"
FT                   /db_xref="MGI:MGI:1890574"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VBX2"
FT                   /protein_id="BAB83244.1"
FT                   /translation="MLMARDGTREDSHKLHKRWLRHQAFMAELAQNKEWLEKIEREGQQ
FT                   LMQEKPELAASVRKKLGEIRQCWAELESTTQAKARQLFEASKADQLVQSFAELDKRLLH
FT                   MESQLQDVDPGGDLATVNSQLKKLQSMESQVEEWCREVGELQAQTAALPLEQASKELVG
FT                   ERQSAVGERLVRLLEPLQERRRLLLASKELHQVAHDLDDELAWVQERLPLAMQTERGTG
FT                   LQAVQQHIKKNQGLRREIQAHGPRLEEVLERAGVLASLRSPEAEAVRRGQEQLQSAWTG
FT                   LREAAERRQQTLDAAFQVEQYYFDVAEVEAWLGEQELLMMSEDKGKDEQSTLQLLKKHL
FT                   QLEQGVENYEESIAQLSRQCRALLEMGHPDSEQISRRQSQVDRLYVALKELGEERRVSL
FT                   EQQYWLYQLSRQVDELEHWIAEKEVVAGSPELGQDFEHVSVLQEKFSEFASETGTAGRE
FT                   RLAAVNQMVDELIECGHTAAATMAEWKDGLNEAWAELLELMGTRAQLLAASRELHKFFS
FT                   DARELQGQIEEKRRRLPRLTAPPEPRPSASSMQRTLRAFEHDLQLLVSQVRQLQEGAAQ
FT                   LRTVYAGEHAEAIASREQEVLQGWKELLAACEDARLHVSSTADALRFHSQARDLLSWMD
FT                   GIAGQIGAADKPRDVSSVEVLMNYHQGLKTELEARVPELAACQELGRSLLLNKSAMADE
FT                   IQAQLDKLGSRKEEVSEKWDRHWEWLQQMLEVHQFAQEAVVADAWLTAQEPLLQSRELG
FT                   SSVDEVEQLIRRHEAFRKAAAAWEERFSSLRRLTTIEKLKAEQSKQPPTPLLGRKFFGD
FT                   PTELAAKAAPLLRPGGYDRGLEPLARRASDTLSAEVRTRVGYVRQELKPERLQPRIDRL
FT                   PETSGKVEPAAPTAAALDTTDTPGTPAATEQVRPRSERQELADRAEELPRRRRSERQES
FT                   VDQPEETARRRRPERQESADHEGPHSLTLGRYEQMERRRERRERRIERQESSEQETPTR
FT                   GELVKGKATLADIVEQLQEKEAGPGIPAGVPSLPQPRELPPGRLPNGLEPPERTPRPDR
FT                   PRARDRPKPRRRPRPREGGEGGGSRRSRSAPAQGGSAPAPPPPPTHTVQHEGFLLRKRE
FT                   LDANRKSSNRSWVSLYCVLSKGELGFYKDSKGPASGGTHGGEPLLSLHKATSEVASDYK
FT                   KKKHVFKLQTQDGSEFLLQAKDEEEMNGWLEAVANSVAEHAEIARWGQTLPTTSSTDEG
FT                   NPKREGGERRASGRRK"
FT   3'UTR           3832..4743
FT   regulatory      4719..4724
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 4743 BP; 983 A; 1358 C; 1641 G; 761 T; 0 other;
     cttcctacga ggggatcaaa tttgtcctgg tcttgaggag ttcccaaatt tttagggctt        60
     tgcgtcttca gttcctgcgg gctggatggc tggatccatg agaagatgct gatggctcgt       120
     gatggcaccc gggaagacag ccacaagctg cacaagagat ggctccggca ccaggcgttc       180
     atggctgagc tggctcagaa taaggagtgg ctggagaaga tagaaaggga gggccagcaa       240
     ctgatgcagg agaaaccgga gctggcagcc tctgtgcgca agaaattagg tgagatccgg       300
     cagtgctggg cggagctgga gagcaccaca caggccaagg cgcgccagct cttcgaggcc       360
     agcaaggcgg accagctagt gcagagcttc gcggagctgg acaagcggct gcttcacatg       420
     gaaagccagc tgcaagacgt agaccccggt ggggacctgg ccactgtcaa cagccagctc       480
     aagaagttac agtccatgga gtctcaggtg gaggagtggt gccgagaggt gggcgagctt       540
     caggcgcaga cggcggcgct tccgctggag caggcgagca aggagttggt gggggagcgg       600
     cagagtgcgg tgggcgagcg cctggtgcgc ctgctggagc ctttgcagga gcgacgccgc       660
     ttgttgctgg catccaagga gctgcatcag gtggcccacg acctggacga tgaactggct       720
     tgggttcaag agcggctgcc actggccatg cagacagagc gaggcactgg cttgcaggct       780
     gtccagcagc acatcaaaaa gaaccagggc ctgcggcggg agatccaggc tcacgggccg       840
     cgcttggagg aggtgctgga gcgcgcgggc gtgctggcct cgctgcgcag cccagaggcc       900
     gaagcggtgc gccgtggcca agagcagctg cagagcgcct ggaccgggct gcgggaagcg       960
     gccgaacggc ggcagcagac gctggacgcc gccttccagg tggaacagta ctactttgac      1020
     gtggctgagg tggaggcatg gctgggcgag caggagctgc tcatgatgag tgaggacaag      1080
     ggcaaggatg aacagagcac cctgcagctg ctcaagaagc atttacaact ggaacagggc      1140
     gtggagaact atgaggaaag catcgcccag ctgtcacgcc agtgccgggc gctactggaa      1200
     atgggacacc cagacagtga gcaaatcagc cgccgacagt cccaagtgga tcgcctctat      1260
     gtggcgctca aggagctggg cgaggaacgc agggtgagcc tggaacagca gtactggctc      1320
     taccagctca gccgccaggt ggatgagctg gaacactgga tagccgagaa ggaggtggta      1380
     gctggctccc cagagctggg ccaggacttc gaacacgtgt cggtgctaca ggagaaattc      1440
     tcagagtttg ccagtgagac aggaaccgca gggcgggagc ggctggcggc ggtcaaccag      1500
     atggtggacg agctgattga gtgtggtcac acagcagcgg ccaccatggc tgagtggaag      1560
     gacgggctga acgaggcctg ggctgagctg ctggaactca tgggcacccg ggcccagctg      1620
     ctcgctgcct ctcgggagct gcataagttc ttcagcgatg cccgggagct tcaagggcag      1680
     attgaggaga agcggaggag gctgccccgc ctgacggcac cacctgaacc cagacccagt      1740
     gccagctcca tgcagcggac cctgcgagcc tttgagcacg acctgcagct cctcgtgtcc      1800
     caggtacggc agctgcagga aggggcggcc cagctgcgga cggtgtacgc tggcgagcac      1860
     gccgaggcca tcgccagccg cgagcaggag gtgttgcagg gctggaagga gctgctagca      1920
     gcctgtgaag atgctcgtct gcacgtcagc tccacggccg acgccctgcg cttccacagc      1980
     caggcccgcg acctgctctc ctggatggac ggcatcgcgg gccagatcgg ggcagctgac      2040
     aaacccaggg atgtgtcatc ggtggaggtg cttatgaact accaccaggg cctgaagaca      2100
     gagttggagg cgcgcgtgcc tgagctggca gcctgccagg agctggggcg gtctctatta      2160
     ctcaacaaaa gcgccatggc tgatgagatc caggcccagc tggacaagct gggaagccgg      2220
     aaggaggagg tgtcggagaa gtgggaccgt cactgggagt ggctgcagca gatgctggag      2280
     gtacaccagt ttgctcagga ggccgtggtg gctgacgcct ggctgacagc tcaggaaccg      2340
     ctcctgcaga gccgggagct gggcagcagt gtggatgagg tggagcagct catccggcga      2400
     cacgaggcct tccgaaaagc agctgcggcc tgggaggaga ggttcagctc tctgcggcgc      2460
     ttgaccacga tcgagaaact caaggcagaa cagagtaagc agccacccac ccccttactg      2520
     gggcgcaagt tctttgggga ccccacagag ctggcggcca aggcagcgcc tttgctgcgt      2580
     ccagggggct atgacagggg cctggagcct ttggcccgca gggcctcgga cacgctgtca      2640
     gcggaagtgc ggacccgggt tgggtatgtg cgccaggagc tcaagcccga gcgtctccag      2700
     ccgcgcattg accggctgcc agagacctcg gggaaggtag aacccgcggc cccgacagcc      2760
     gcagcgttgg acacgacgga cacccctggg actccggcgg cgacggagca ggtccggccc      2820
     cggtcggagc gccaggagtt agcggatcgt gcggaggagc tgccacggag acgaagatca      2880
     gaacgccagg agtccgtgga tcaaccagag gagacagcgc ggaggcggcg gcctgagcgc      2940
     caggagtccg cggaccacga ggggccgcac agccttactc taggtcgcta cgagcagatg      3000
     gagagacggc gggagcggag ggagcggcgg atagaacgac aggagtctag cgaacaggag      3060
     actcccacca ggggagagct ggtcaaaggg aaggccactc tggctgatat tgtggagcaa      3120
     cttcaggaga aagaggcagg cccagggatc cctgctgggg tgccgtcgct gcctcagcct      3180
     cgcgagcttc cccctggtcg cctgcccaac gggcttgagc cgcccgagcg gacacctcgg      3240
     cccgatcggc cgcgggcacg ggaccggccc aagccgcgcc ggcggccacg gcctcgagag      3300
     ggtggtgagg gcgggggaag ccggcgctcg cgctccgccc ctgcccaggg aggttccgcc      3360
     cccgcgccgc cacctccgcc cactcacaca gtgcagcacg agggcttcct gctgcgcaag      3420
     cgcgagctcg acgctaaccg caagtcgtcc aaccggtcat gggtgagcct gtactgtgtg      3480
     ctcagcaagg gggagctggg cttctacaag gactccaaag gcccagcatc agggggcacg      3540
     catggcgggg aaccactgct cagcctgcac aaagccacca gcgaggtggc tagtgactac      3600
     aagaaaaaga agcatgtctt caagcttcag acccaggatg gcagtgagtt cttgctccag      3660
     gctaaagatg aggaggagat gaacggctgg ctggaggctg tggctaactc cgtggcagaa      3720
     cacgccgaga tcgcccgatg gggtcagaca ctacctacca cgtcatccac agatgagggc      3780
     aaccccaagc gtgagggcgg ggagcgtagg gccagcgggc gccggaagtg attccaggta      3840
     ccctttcccc caccttggag tctgacaagt ctccttgccc ctcctctctg cactgtggac      3900
     acaaagacaa cttctcatcc gcaagggccg gaatgactgc ggatgtgcca ctgtgggcct      3960
     gaaatagaag ggacttctgc actccaagag gtggtggtag gggattgctg tccctatagc      4020
     catatctcgg tcccttcccg ctcgccaacc ccaccccagg tgctggggct ccattctttt      4080
     tatgcaataa ctgagcttgg tggggccggg cagggagcca gttgagccaa gctccctgcc      4140
     caatcgtcag atcctgcccc aagaatctgg agtggcgagg gatctaggag gtggtgattt      4200
     gttggcctcc tctccgccct aaggatggac aacgggggcg ctggtgaggt cccctggacc      4260
     atccagggtg ctagggggtg gggaggggac acactccctc cctgccttta cctcacttcc      4320
     aatgctgcct tgatctgtct gggaagaggg aggacagggg cccttagccc ctgtactccg      4380
     ccatctcaga gccatgcggt taattcctga cttagtttat ttttgcaaaa acgtagaccc      4440
     ccccccttcc ttcccccgcc ccgcatccgc gaaggctttt aataggaggg gagtcaaagt      4500
     tcaaaactgt cttcctctct cctccccgat tctagctgta aatgccactt cccgaggggg      4560
     agggggtggg aaagccctcc ccctgcatgc ttctggctgg agcacctccc tgggacggag      4620
     ggaatcaggg ttacaggcaa ccccagtggc tgcttggaga cgctgccaag gcaggggggt      4680
     gcggggcggt gtggcaggcg cacactgtat gtacctataa taaacccttt ggctttgaca      4740
     gtc                                                                    4743
//

If you have problems or comments...

PBIL Back to PBIL home page