(data stored in ACNUC32233 zone)

EMBL: AB055620

ID   AB055620; SV 1; linear; mRNA; STD; MUS; 4864 BP.
XX
AC   AB055620;
XX
DT   10-JAN-2002 (Rel. 70, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Mus musculus mRNA for betaIV-spectrin sigma6-B, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4864
RA   Komada M.;
RT   ;
RL   Submitted (07-FEB-2001) to the INSDC.
RL   Masayuki Komada, Tokyo Institute of Technology, Department of Biological
RL   Sciences, Faculty of Bioscience and Biotechnology; 4259 Nagatsuta,
RL   Midori-ku, Yokohama, Kanagawa 226-8501, Japan
RL   (E-mail:makomada@bio.titech.ac.jp, Tel:81-45-924-5702, Fax:81-45-924-5771)
XX
RN   [2]
RX   DOI; 10.1083/jcb.200110003.
RX   PUBMED; 11807096.
RA   Komada M., Soriano P.;
RT   "Beta]IV-spectrin regulates sodium channel clustering through ankyrin-G at
RT   axon initial segments and nodes of Ranvier";
RL   J. Cell Biol. 156(2):337-348(2002).
XX
DR   MD5; aa84ef22492228b5abacfd56036ae7db.
DR   EuropePMC; PMC2199236; 11807096.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4864
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   5'UTR           1..226
FT   CDS_pept        227..3952
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /product="betaIV-spectrin sigma6-B"
FT                   /db_xref="GOA:Q8VBX2"
FT                   /db_xref="InterPro:IPR001605"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002017"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR018159"
FT                   /db_xref="InterPro:IPR041681"
FT                   /db_xref="MGI:MGI:1890574"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VBX2"
FT                   /protein_id="BAB83245.1"
FT                   /translation="MLMARDGTREDSHKLHKRWLRHQAFMAELAQNKEWLEKIEREGQQ
FT                   LMQEKPELAASVRKKLGEIRQCWAELESTTQAKARQLFEASKADQLVQSFAELDKRLLH
FT                   MESQLQDVDPGGDLATVNSQLKKLQSMESQVEEWCREVGELQAQTAALPLEQASKELVG
FT                   ERQSAVGERLVRLLEPLQERRRLLLASKELHQVAHDLDDELAWVQERLPLAMQTERGTG
FT                   LQAVQQHIKKNQGLRREIQAHGPRLEEVLERAGVLASLRSPEAEAVRRGQEQLQSAWTG
FT                   LREAAERRQQTLDAAFQVEQYYFDVAEVEAWLGEQELLMMSEDKGKDEQSTLQLLKKHL
FT                   QLEQGVENYEESIAQLSRQCRALLEMGHPDSEQISRRQSQVDRLYVALKELGEERRVSL
FT                   EQQYWLYQLSRQVDELEHWIAEKEVVAGSPELGQDFEHVSVLQEKFSEFASETGTAGRE
FT                   RLAAVNQMVDELIECGHTAAATMAEWKDGLNEAWAELLELMGTRAQLLAASRELHKFFS
FT                   DARELQGQIEEKRRRLPRLTAPPEPRPSASSMQRTLRAFEHDLQLLVSQVRQLQEGAAQ
FT                   LRTVYAGEHAEAIASREQEVLQGWKELLAACEDARLHVSSTADALRFHSQARDLLSWMD
FT                   GIAGQIGAADKPRDVSSVEVLMNYHQGLKTELEARVPELAACQELGRSLLLNKSAMADE
FT                   IQAQLDKLGSRKEEVSEKWDRHWEWLQQMLEVHQFAQEAVVADAWLTAQEPLLQSRELG
FT                   SSVDEVEQLIRRHEAFRKAAAAWEERFSSLRRLTTIEKLKAEQSKQPPTPLLGRKFFGD
FT                   PTELAAKAAPLLRPGGYDRGLEPLARRASDTLSAEVRTRVGYVRQELKPERLQPRIDRL
FT                   PETSGKVEPAAPTAAALDTTDTPGTPAATEQVRPRSERQELADRAEELPRRRRSERQES
FT                   VDQPEETARRRRPERQESADHEGPHSLTLGRYEQMERRRERRERRIERQESSEQETPTR
FT                   GELVKGKATLADIVEQLQEKEAGPGIPAGVPSLPQPRELPPGRLPNGLEPPERTPRPDR
FT                   PRARDRPKPRRRPRPREGGEGGGSRRSRSAPAQGGSAPAPPPPPTHTVQHEGFLLRKRE
FT                   LDANRKSSNRSWVSLYCVLSKGELGFYKDSKGPASGGTHGGEPLLSLHKATSEVASDYK
FT                   KKKHVFKLQTQDGSEFLLQAKDEEEMNGWLEAVANSVAEHAEIARWGQTLPTTSSTDEG
FT                   NPKREGGERRASGRRK"
FT   3'UTR           3953..4864
FT   regulatory      4840..4845
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 4864 BP; 1012 A; 1396 C; 1669 G; 787 T; 0 other;
     ggggaccaca cagtcatctt ctaaccagga aagggcttga gagtccttct aatcagtctt        60
     atttgcacag atttcccctc ccttcactta gcccaactct tatgggccaa gagcctgaac       120
     ctgaagttct tgaggggtgt tttgaggctg tgctagatgg ggagagggtc catcctgagc       180
     cctcttcctc tgccctgcac agctggatgg ctggatccat gagaagatgc tgatggctcg       240
     tgatggcacc cgggaagaca gccacaagct gcacaagaga tggctccggc accaggcgtt       300
     catggctgag ctggctcaga ataaggagtg gctggagaag atagaaaggg agggccagca       360
     actgatgcag gagaaaccgg agctggcagc ctctgtgcgc aagaaattag gtgagatccg       420
     gcagtgctgg gcggagctgg agagcaccac acaggccaag gcgcgccagc tcttcgaggc       480
     cagcaaggcg gaccagctag tgcagagctt cgcggagctg gacaagcggc tgcttcacat       540
     ggaaagccag ctgcaagacg tagaccccgg tggggacctg gccactgtca acagccagct       600
     caagaagtta cagtccatgg agtctcaggt ggaggagtgg tgccgagagg tgggcgagct       660
     tcaggcgcag acggcggcgc ttccgctgga gcaggcgagc aaggagttgg tgggggagcg       720
     gcagagtgcg gtgggcgagc gcctggtgcg cctgctggag cctttgcagg agcgacgccg       780
     cttgttgctg gcatccaagg agctgcatca ggtggcccac gacctggacg atgaactggc       840
     ttgggttcaa gagcggctgc cactggccat gcagacagag cgaggcactg gcttgcaggc       900
     tgtccagcag cacatcaaaa agaaccaggg cctgcggcgg gagatccagg ctcacgggcc       960
     gcgcttggag gaggtgctgg agcgcgcggg cgtgctggcc tcgctgcgca gcccagaggc      1020
     cgaagcggtg cgccgtggcc aagagcagct gcagagcgcc tggaccgggc tgcgggaagc      1080
     ggccgaacgg cggcagcaga cgctggacgc cgccttccag gtggaacagt actactttga      1140
     cgtggctgag gtggaggcat ggctgggcga gcaggagctg ctcatgatga gtgaggacaa      1200
     gggcaaggat gaacagagca ccctgcagct gctcaagaag catttacaac tggaacaggg      1260
     cgtggagaac tatgaggaaa gcatcgccca gctgtcacgc cagtgccggg cgctactgga      1320
     aatgggacac ccagacagtg agcaaatcag ccgccgacag tcccaagtgg atcgcctcta      1380
     tgtggcgctc aaggagctgg gcgaggaacg cagggtgagc ctggaacagc agtactggct      1440
     ctaccagctc agccgccagg tggatgagct ggaacactgg atagccgaga aggaggtggt      1500
     agctggctcc ccagagctgg gccaggactt cgaacacgtg tcggtgctac aggagaaatt      1560
     ctcagagttt gccagtgaga caggaaccgc agggcgggag cggctggcgg cggtcaacca      1620
     gatggtggac gagctgattg agtgtggtca cacagcagcg gccaccatgg ctgagtggaa      1680
     ggacgggctg aacgaggcct gggctgagct gctggaactc atgggcaccc gggcccagct      1740
     gctcgctgcc tctcgggagc tgcataagtt cttcagcgat gcccgggagc ttcaagggca      1800
     gattgaggag aagcggagga ggctgccccg cctgacggca ccacctgaac ccagacccag      1860
     tgccagctcc atgcagcgga ccctgcgagc ctttgagcac gacctgcagc tcctcgtgtc      1920
     ccaggtacgg cagctgcagg aaggggcggc ccagctgcgg acggtgtacg ctggcgagca      1980
     cgccgaggcc atcgccagcc gcgagcagga ggtgttgcag ggctggaagg agctgctagc      2040
     agcctgtgaa gatgctcgtc tgcacgtcag ctccacggcc gacgccctgc gcttccacag      2100
     ccaggcccgc gacctgctct cctggatgga cggcatcgcg ggccagatcg gggcagctga      2160
     caaacccagg gatgtgtcat cggtggaggt gcttatgaac taccaccagg gcctgaagac      2220
     agagttggag gcgcgcgtgc ctgagctggc agcctgccag gagctggggc ggtctctatt      2280
     actcaacaaa agcgccatgg ctgatgagat ccaggcccag ctggacaagc tgggaagccg      2340
     gaaggaggag gtgtcggaga agtgggaccg tcactgggag tggctgcagc agatgctgga      2400
     ggtacaccag tttgctcagg aggccgtggt ggctgacgcc tggctgacag ctcaggaacc      2460
     gctcctgcag agccgggagc tgggcagcag tgtggatgag gtggagcagc tcatccggcg      2520
     acacgaggcc ttccgaaaag cagctgcggc ctgggaggag aggttcagct ctctgcggcg      2580
     cttgaccacg atcgagaaac tcaaggcaga acagagtaag cagccaccca cccccttact      2640
     ggggcgcaag ttctttgggg accccacaga gctggcggcc aaggcagcgc ctttgctgcg      2700
     tccagggggc tatgacaggg gcctggagcc tttggcccgc agggcctcgg acacgctgtc      2760
     agcggaagtg cggacccggg ttgggtatgt gcgccaggag ctcaagcccg agcgtctcca      2820
     gccgcgcatt gaccggctgc cagagacctc ggggaaggta gaacccgcgg ccccgacagc      2880
     cgcagcgttg gacacgacgg acacccctgg gactccggcg gcgacggagc aggtccggcc      2940
     ccggtcggag cgccaggagt tagcggatcg tgcggaggag ctgccacgga gacgaagatc      3000
     agaacgccag gagtccgtgg atcaaccaga ggagacagcg cggaggcggc ggcctgagcg      3060
     ccaggagtcc gcggaccacg aggggccgca cagccttact ctaggtcgct acgagcagat      3120
     ggagagacgg cgggagcgga gggagcggcg gatagaacga caggagtcta gcgaacagga      3180
     gactcccacc aggggagagc tggtcaaagg gaaggccact ctggctgata ttgtggagca      3240
     acttcaggag aaagaggcag gcccagggat ccctgctggg gtgccgtcgc tgcctcagcc      3300
     tcgcgagctt ccccctggtc gcctgcccaa cgggcttgag ccgcccgagc ggacacctcg      3360
     gcccgatcgg ccgcgggcac gggaccggcc caagccgcgc cggcggccac ggcctcgaga      3420
     gggtggtgag ggcgggggaa gccggcgctc gcgctccgcc cctgcccagg gaggttccgc      3480
     ccccgcgccg ccacctccgc ccactcacac agtgcagcac gagggcttcc tgctgcgcaa      3540
     gcgcgagctc gacgctaacc gcaagtcgtc caaccggtca tgggtgagcc tgtactgtgt      3600
     gctcagcaag ggggagctgg gcttctacaa ggactccaaa ggcccagcat cagggggcac      3660
     gcatggcggg gaaccactgc tcagcctgca caaagccacc agcgaggtgg ctagtgacta      3720
     caagaaaaag aagcatgtct tcaagcttca gacccaggat ggcagtgagt tcttgctcca      3780
     ggctaaagat gaggaggaga tgaacggctg gctggaggct gtggctaact ccgtggcaga      3840
     acacgccgag atcgcccgat ggggtcagac actacctacc acgtcatcca cagatgaggg      3900
     caaccccaag cgtgagggcg gggagcgtag ggccagcggg cgccggaagt gattccaggt      3960
     accctttccc ccaccttgga gtctgacaag tctccttgcc cctcctctct gcactgtgga      4020
     cacaaagaca acttctcatc cgcaagggcc ggaatgactg cggatgtgcc actgtgggcc      4080
     tgaaatagaa gggacttctg cactccaaga ggtggtggta ggggattgct gtccctatag      4140
     ccatatctcg gtcccttccc gctcgccaac cccaccccag gtgctggggc tccattcttt      4200
     ttatgcaata actgagcttg gtggggccgg gcagggagcc agttgagcca agctccctgc      4260
     ccaatcgtca gatcctgccc caagaatctg gagtggcgag ggatctagga ggtggtgatt      4320
     tgttggcctc ctctccgccc taaggatgga caacgggggc gctggtgagg tcccctggac      4380
     catccagggt gctagggggt ggggagggga cacactccct ccctgccttt acctcacttc      4440
     caatgctgcc ttgatctgtc tgggaagagg gaggacaggg gcccttagcc cctgtactcc      4500
     gccatctcag agccatgcgg ttaattcctg acttagttta tttttgcaaa aacgtagacc      4560
     cccccccttc cttcccccgc cccgcatccg cgaaggcttt taataggagg ggagtcaaag      4620
     ttcaaaactg tcttcctctc tcctccccga ttctagctgt aaatgccact tcccgagggg      4680
     gagggggtgg gaaagccctc cccctgcatg cttctggctg gagcacctcc ctgggacgga      4740
     gggaatcagg gttacaggca accccagtgg ctgcttggag acgctgccaa ggcagggggg      4800
     tgcggggcgg tgtggcaggc gcacactgta tgtacctata ataaaccctt tggctttgac      4860
     agtc                                                                   4864
//

If you have problems or comments...

PBIL Back to PBIL home page