(data stored in ACNUC32233 zone)

EMBL: AB055621

ID   AB055621; SV 1; linear; mRNA; STD; MUS; 4728 BP.
XX
AC   AB055621;
XX
DT   10-JAN-2002 (Rel. 70, Created)
DT   23-SEP-2008 (Rel. 97, Last updated, Version 6)
XX
DE   Mus musculus mRNA for betaIV-spectrin sigma6-C, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4728
RA   Komada M.;
RT   ;
RL   Submitted (07-FEB-2001) to the INSDC.
RL   Masayuki Komada, Tokyo Institute of Technology, Department of Biological
RL   Sciences, Faculty of Bioscience and Biotechnology; 4259 Nagatsuta,
RL   Midori-ku, Yokohama, Kanagawa 226-8501, Japan
RL   (E-mail:makomada@bio.titech.ac.jp, Tel:81-45-924-5702, Fax:81-45-924-5771)
XX
RN   [2]
RX   DOI; 10.1083/jcb.200110003.
RX   PUBMED; 11807096.
RA   Komada M., Soriano P.;
RT   "Beta]IV-spectrin regulates sodium channel clustering through ankyrin-G at
RT   axon initial segments and nodes of Ranvier";
RL   J. Cell Biol. 156(2):337-348(2002).
XX
DR   MD5; 6a8217e8b2b8158a38ab7ddeb18514af.
DR   EuropePMC; PMC2199236; 11807096.
DR   EuropePMC; PMC5313112; 27979964.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4728
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   5'UTR           1..90
FT   CDS_pept        91..3816
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /product="betaIV-spectrin sigma6-C"
FT                   /db_xref="GOA:Q8VBX2"
FT                   /db_xref="InterPro:IPR001605"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002017"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR018159"
FT                   /db_xref="InterPro:IPR041681"
FT                   /db_xref="MGI:MGI:1890574"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VBX2"
FT                   /protein_id="BAB83246.1"
FT                   /translation="MLMARDGTREDSHKLHKRWLRHQAFMAELAQNKEWLEKIEREGQQ
FT                   LMQEKPELAASVRKKLGEIRQCWAELESTTQAKARQLFEASKADQLVQSFAELDKRLLH
FT                   MESQLQDVDPGGDLATVNSQLKKLQSMESQVEEWCREVGELQAQTAALPLEQASKELVG
FT                   ERQSAVGERLVRLLEPLQERRRLLLASKELHQVAHDLDDELAWVQERLPLAMQTERGTG
FT                   LQAVQQHIKKNQGLRREIQAHGPRLEEVLERAGVLASLRSPEAEAVRRGQEQLQSAWTG
FT                   LREAAERRQQTLDAAFQVEQYYFDVAEVEAWLGEQELLMMSEDKGKDEQSTLQLLKKHL
FT                   QLEQGVENYEESIAQLSRQCRALLEMGHPDSEQISRRQSQVDRLYVALKELGEERRVSL
FT                   EQQYWLYQLSRQVDELEHWIAEKEVVAGSPELGQDFEHVSVLQEKFSEFASETGTAGRE
FT                   RLAAVNQMVDELIECGHTAAATMAEWKDGLNEAWAELLELMGTRAQLLAASRELHKFFS
FT                   DARELQGQIEEKRRRLPRLTAPPEPRPSASSMQRTLRAFEHDLQLLVSQVRQLQEGAAQ
FT                   LRTVYAGEHAEAIASREQEVLQGWKELLAACEDARLHVSSTADALRFHSQARDLLSWMD
FT                   GIAGQIGAADKPRDVSSVEVLMNYHQGLKTELEARVPELAACQELGRSLLLNKSAMADE
FT                   IQAQLDKLGSRKEEVSEKWDRHWEWLQQMLEVHQFAQEAVVADAWLTAQEPLLQSRELG
FT                   SSVDEVEQLIRRHEAFRKAAAAWEERFSSLRRLTTIEKLKAEQSKQPPTPLLGRKFFGD
FT                   PTELAAKAAPLLRPGGYDRGLEPLARRASDTLSAEVRTRVGYVRQELKPERLQPRIDRL
FT                   PETSGKVEPAAPTAAALDTTDTPGTPAATEQVRPRSERQELADRAEELPRRRRSERQES
FT                   VDQPEETARRRRPERQESADHEGPHSLTLGRYEQMERRRERRERRIERQESSEQETPTR
FT                   GELVKGKATLADIVEQLQEKEAGPGIPAGVPSLPQPRELPPGRLPNGLEPPERTPRPDR
FT                   PRARDRPKPRRRPRPREGGEGGGSRRSRSAPAQGGSAPAPPPPPTHTVQHEGFLLRKRE
FT                   LDANRKSSNRSWVSLYCVLSKGELGFYKDSKGPASGGTHGGEPLLSLHKATSEVASDYK
FT                   KKKHVFKLQTQDGSEFLLQAKDEEEMNGWLEAVANSVAEHAEIARWGQTLPTTSSTDEG
FT                   NPKREGGERRASGRRK"
FT   3'UTR           3817..4728
FT   regulatory      4704..4709
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 4728 BP; 978 A; 1367 C; 1644 G; 739 T; 0 other;
     gagtggaggg gcgagtgcct gcccgcctgc cgcagggacg ctcctccaac gccgccgccg        60
     ccgcagctgg atggctggat ccatgagaag atgctgatgg ctcgtgatgg cacccgggaa       120
     gacagccaca agctgcacaa gagatggctc cggcaccagg cgttcatggc tgagctggct       180
     cagaataagg agtggctgga gaagatagaa agggagggcc agcaactgat gcaggagaaa       240
     ccggagctgg cagcctctgt gcgcaagaaa ttaggtgaga tccggcagtg ctgggcggag       300
     ctggagagca ccacacaggc caaggcgcgc cagctcttcg aggccagcaa ggcggaccag       360
     ctagtgcaga gcttcgcgga gctggacaag cggctgcttc acatggaaag ccagctgcaa       420
     gacgtagacc ccggtgggga cctggccact gtcaacagcc agctcaagaa gttacagtcc       480
     atggagtctc aggtggagga gtggtgccga gaggtgggcg agcttcaggc gcagacggcg       540
     gcgcttccgc tggagcaggc gagcaaggag ttggtggggg agcggcagag tgcggtgggc       600
     gagcgcctgg tgcgcctgct ggagcctttg caggagcgac gccgcttgtt gctggcatcc       660
     aaggagctgc atcaggtggc ccacgacctg gacgatgaac tggcttgggt tcaagagcgg       720
     ctgccactgg ccatgcagac agagcgaggc actggcttgc aggctgtcca gcagcacatc       780
     aaaaagaacc agggcctgcg gcgggagatc caggctcacg ggccgcgctt ggaggaggtg       840
     ctggagcgcg cgggcgtgct ggcctcgctg cgcagcccag aggccgaagc ggtgcgccgt       900
     ggccaagagc agctgcagag cgcctggacc gggctgcggg aagcggccga acggcggcag       960
     cagacgctgg acgccgcctt ccaggtggaa cagtactact ttgacgtggc tgaggtggag      1020
     gcatggctgg gcgagcagga gctgctcatg atgagtgagg acaagggcaa ggatgaacag      1080
     agcaccctgc agctgctcaa gaagcattta caactggaac agggcgtgga gaactatgag      1140
     gaaagcatcg cccagctgtc acgccagtgc cgggcgctac tggaaatggg acacccagac      1200
     agtgagcaaa tcagccgccg acagtcccaa gtggatcgcc tctatgtggc gctcaaggag      1260
     ctgggcgagg aacgcagggt gagcctggaa cagcagtact ggctctacca gctcagccgc      1320
     caggtggatg agctggaaca ctggatagcc gagaaggagg tggtagctgg ctccccagag      1380
     ctgggccagg acttcgaaca cgtgtcggtg ctacaggaga aattctcaga gtttgccagt      1440
     gagacaggaa ccgcagggcg ggagcggctg gcggcggtca accagatggt ggacgagctg      1500
     attgagtgtg gtcacacagc agcggccacc atggctgagt ggaaggacgg gctgaacgag      1560
     gcctgggctg agctgctgga actcatgggc acccgggccc agctgctcgc tgcctctcgg      1620
     gagctgcata agttcttcag cgatgcccgg gagcttcaag ggcagattga ggagaagcgg      1680
     aggaggctgc cccgcctgac ggcaccacct gaacccagac ccagtgccag ctccatgcag      1740
     cggaccctgc gagcctttga gcacgacctg cagctcctcg tgtcccaggt acggcagctg      1800
     caggaagggg cggcccagct gcggacggtg tacgctggcg agcacgccga ggccatcgcc      1860
     agccgcgagc aggaggtgtt gcagggctgg aaggagctgc tagcagcctg tgaagatgct      1920
     cgtctgcacg tcagctccac ggccgacgcc ctgcgcttcc acagccaggc ccgcgacctg      1980
     ctctcctgga tggacggcat cgcgggccag atcggggcag ctgacaaacc cagggatgtg      2040
     tcatcggtgg aggtgcttat gaactaccac cagggcctga agacagagtt ggaggcgcgc      2100
     gtgcctgagc tggcagcctg ccaggagctg gggcggtctc tattactcaa caaaagcgcc      2160
     atggctgatg agatccaggc ccagctggac aagctgggaa gccggaagga ggaggtgtcg      2220
     gagaagtggg accgtcactg ggagtggctg cagcagatgc tggaggtaca ccagtttgct      2280
     caggaggccg tggtggctga cgcctggctg acagctcagg aaccgctcct gcagagccgg      2340
     gagctgggca gcagtgtgga tgaggtggag cagctcatcc ggcgacacga ggccttccga      2400
     aaagcagctg cggcctggga ggagaggttc agctctctgc ggcgcttgac cacgatcgag      2460
     aaactcaagg cagaacagag taagcagcca cccaccccct tactggggcg caagttcttt      2520
     ggggacccca cagagctggc ggccaaggca gcgcctttgc tgcgtccagg gggctatgac      2580
     aggggcctgg agcctttggc ccgcagggcc tcggacacgc tgtcagcgga agtgcggacc      2640
     cgggttgggt atgtgcgcca ggagctcaag cccgagcgtc tccagccgcg cattgaccgg      2700
     ctgccagaga cctcggggaa ggtagaaccc gcggccccga cagccgcagc gttggacacg      2760
     acggacaccc ctgggactcc ggcggcgacg gagcaggtcc ggccccggtc ggagcgccag      2820
     gagttagcgg atcgtgcgga ggagctgcca cggagacgaa gatcagaacg ccaggagtcc      2880
     gtggatcaac cagaggagac agcgcggagg cggcggcctg agcgccagga gtccgcggac      2940
     cacgaggggc cgcacagcct tactctaggt cgctacgagc agatggagag acggcgggag      3000
     cggagggagc ggcggataga acgacaggag tctagcgaac aggagactcc caccagggga      3060
     gagctggtca aagggaaggc cactctggct gatattgtgg agcaacttca ggagaaagag      3120
     gcaggcccag ggatccctgc tggggtgccg tcgctgcctc agcctcgcga gcttccccct      3180
     ggtcgcctgc ccaacgggct tgagccgccc gagcggacac ctcggcccga tcggccgcgg      3240
     gcacgggacc ggcccaagcc gcgccggcgg ccacggcctc gagagggtgg tgagggcggg      3300
     ggaagccggc gctcgcgctc cgcccctgcc cagggaggtt ccgcccccgc gccgccacct      3360
     ccgcccactc acacagtgca gcacgagggc ttcctgctgc gcaagcgcga gctcgacgct      3420
     aaccgcaagt cgtccaaccg gtcatgggtg agcctgtact gtgtgctcag caagggggag      3480
     ctgggcttct acaaggactc caaaggccca gcatcagggg gcacgcatgg cggggaacca      3540
     ctgctcagcc tgcacaaagc caccagcgag gtggctagtg actacaagaa aaagaagcat      3600
     gtcttcaagc ttcagaccca ggatggcagt gagttcttgc tccaggctaa agatgaggag      3660
     gagatgaacg gctggctgga ggctgtggct aactccgtgg cagaacacgc cgagatcgcc      3720
     cgatggggtc agacactacc taccacgtca tccacagatg agggcaaccc caagcgtgag      3780
     ggcggggagc gtagggccag cgggcgccgg aagtgattcc aggtaccctt tcccccacct      3840
     tggagtctga caagtctcct tgcccctcct ctctgcactg tggacacaaa gacaacttct      3900
     catccgcaag ggccggaatg actgcggatg tgccactgtg ggcctgaaat agaagggact      3960
     tctgcactcc aagaggtggt ggtaggggat tgctgtccct atagccatat ctcggtccct      4020
     tcccgctcgc caaccccacc ccaggtgctg gggctccatt ctttttatgc aataactgag      4080
     cttggtgggg ccgggcaggg agccagttga gccaagctcc ctgcccaatc gtcagatcct      4140
     gccccaagaa tctggagtgg cgagggatct aggaggtggt gatttgttgg cctcctctcc      4200
     gccctaagga tggacaacgg gggcgctggt gaggtcccct ggaccatcca gggtgctagg      4260
     gggtggggag gggacacact ccctccctgc ctttacctca cttccaatgc tgccttgatc      4320
     tgtctgggaa gagggaggac aggggccctt agcccctgta ctccgccatc tcagagccat      4380
     gcggttaatt cctgacttag tttatttttg caaaaacgta gacccccccc cttccttccc      4440
     ccgccccgca tccgcgaagg cttttaatag gaggggagtc aaagttcaaa actgtcttcc      4500
     tctctcctcc ccgattctag ctgtaaatgc cacttcccga gggggagggg gtgggaaagc      4560
     cctccccctg catgcttctg gctggagcac ctccctggga cggagggaat cagggttaca      4620
     ggcaacccca gtggctgctt ggagacgctg ccaaggcagg ggggtgcggg gcggtgtggc      4680
     aggcgcacac tgtatgtacc tataataaac cctttggctt tgacagtc                   4728
//

If you have problems or comments...

PBIL Back to PBIL home page