(data stored in ACNUC7820 zone)

EMBL: AB065455

ID   AB065455; SV 1; linear; genomic DNA; STD; HUM; 1051 BP.
XX
AC   AB065455;
XX
DT   24-JUL-2002 (Rel. 72, Created)
DT   01-MAR-2003 (Rel. 74, Last updated, Version 2)
XX
DE   Homo sapiens gene for seven transmembrane helix receptor, complete cds,
DE   isolate:CBRC7TM_18.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1051
RA   Suwa M.;
RT   ;
RL   Submitted (11-JUL-2001) to the INSDC.
RL   Makiko Suwa, Computational Biology Research Center (CBRC), National
RL   Institute of Advanced Industrial Science and Technology (AIST); 2-41-6 Aomi
RL   Koto-ku, Tokyo 135-0064, Japan (E-mail:m-suwa@aist.go.jp,
RL   URL:http://www.cbrc.jp/, Tel:81-3-3599-8080, Fax:81-3-3599-8081)
XX
RN   [2]
RA   Suwa M., Sato T., Okouchi I., Arita M., Futami K., Matsumoto S.,
RA   Tsutsumi S., Aburatani H., Asai K., Akiyama Y.;
RT   "Genome-wide discovery and analysis of human seven transmembrane helix
RT   receptor genes.";
RL   Unpublished.
XX
DR   MD5; dda328b0361d3335fe58ff172b1f1547.
XX
CC   This sequence is a seven transmembrane helix receptor candidate
CC   predicted from the whole human genome sequences using our
CC   automated system that contains programs of gene
CC   finding(GeneDecoder), sequence search, motif-domain assignment and
CC   transmembrane helix prediction.
CC   And the sequence is submitted by the collaborative project between
CC   [Computational Biology Research Center (CBRC), National Institute
CC   of Advanced Industrial Science and Technology (AIST)] and [Genome
CC   Science Division, Research Center for Advanced Science and
CC   Technology (RCAST), University of Tokyo].
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1051
FT                   /organism="Homo sapiens"
FT                   /chromosome="3"
FT                   /isolate="CBRC7TM_18"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        201..851
FT                   /codon_start=1
FT                   /product="seven transmembrane helix receptor"
FT                   /db_xref="GOA:Q8NHB9"
FT                   /db_xref="H-InvDB:HIT000383167.8"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q8NHB9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAC05716.1"
FT                   /translation="MYLVTVLRNLLSIPAVSSDSPLHTPTYFFLSILCWADIGFTSATV
FT                   SKTIVDMQSHSRVISHAGCLTQMSFLVLFACIEGMLLTVMAYDCFVGICRPLHYPVIVN
FT                   PHLCVFFVLVSFFLSLLDSQLHSWIVLQFTIIKNVEISNFVCDPSQLLKLACSDSVINS
FT                   IFIYFGSTMFGFLPISGILLSYYKIVPSILRISSSDGKYKAFSTYGSHLAVFC"
XX
SQ   Sequence 1051 BP; 207 A; 289 C; 223 G; 332 T; 0 other;
     gatgttcctt gtgaatttct tgcatccagc attaagggct ggtttttatc ttttattttt        60
     ccaatcctct ttccttctca aggtgtccaa gacacacaga gccacggaat ctcacaggtg       120
     tctgagaatt cctcctcctg ggactctcag aggatccaga actgcagccg gtcctcgctt       180
     tgctgtccct gtccctgtcc atgtatctgg tcacggtgct gaggaacctg ctgagcatcc       240
     cggctgtcag ctctgactcc ccgctccaca cccccacgta cttcttcctc tccatcctgt       300
     gctgggctga catcggtttc acctcggcca cggtttccaa gacgattgtg gacatgcagt       360
     cacatagcag agtcatctct catgcgggct gcctgacaca gatgtctttc ttggtccttt       420
     ttgcatgtat agaaggcatg ctcctgactg tgatggccta tgactgcttt gtaggcatct       480
     gtcgccctct gcactaccca gtcatcgtga atcctcatct ctgtgtcttc tttgttttgg       540
     tgtccttttt ccttagcctg ttggattccc agctgcacag ttggattgtg ttacaattca       600
     ccatcatcaa gaatgtggaa atctctaatt ttgtctgtga cccctctcaa cttctcaaac       660
     ttgcctgttc tgacagcgtc atcaatagca tcttcatata ttttggtagt actatgtttg       720
     gttttcttcc catttcaggg atccttttgt cttactataa aatcgtcccc tccattctaa       780
     ggatttcatc gtcagatggg aagtataaag ccttctccac ctatggctct cacctagcag       840
     ttttttgctg atttgatgga acaggcattg gcgtgtacct gacttcagct gtggcaccac       900
     ccctcaggaa tggtgtggtg gtgtcagtga tgtaagctgt ggtcaccccc atgctgaacc       960
     ttttcatcta cagcctgaga aacagggaca tacaaagtgc cctgcggagg ctgcgcagca      1020
     gaacagtcga atctcatgat ctgttccatc c                                     1051
//

If you have problems or comments...

PBIL Back to PBIL home page