(data stored in ACNUC7820 zone)

EMBL: AB065524

ID   AB065524; SV 1; linear; genomic DNA; STD; HUM; 1051 BP.
XX
AC   AB065524;
XX
DT   24-JUL-2002 (Rel. 72, Created)
DT   01-MAR-2003 (Rel. 74, Last updated, Version 2)
XX
DE   Homo sapiens gene for seven transmembrane helix receptor, complete cds,
DE   isolate:CBRC7TM_87.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1051
RA   Suwa M.;
RT   ;
RL   Submitted (11-JUL-2001) to the INSDC.
RL   Makiko Suwa, Computational Biology Research Center (CBRC), National
RL   Institute of Advanced Industrial Science and Technology (AIST); 2-41-6 Aomi
RL   Koto-ku, Tokyo 135-0064, Japan (E-mail:m-suwa@aist.go.jp,
RL   URL:http://www.cbrc.jp/, Tel:81-3-3599-8080, Fax:81-3-3599-8081)
XX
RN   [2]
RA   Suwa M., Sato T., Okouchi I., Arita M., Futami K., Matsumoto S.,
RA   Tsutsumi S., Aburatani H., Asai K., Akiyama Y.;
RT   "Genome-wide discovery and analysis of human seven transmembrane helix
RT   receptor genes.";
RL   Unpublished.
XX
DR   MD5; f2cb113dc0355be6b99157beb4c087a2.
XX
CC   This sequence is a seven transmembrane helix receptor candidate
CC   predicted from the whole human genome sequences using our
CC   automated system that contains programs of gene
CC   finding(GeneDecoder), sequence search, motif-domain assignment and
CC   transmembrane helix prediction.
CC   And the sequence is submitted by the collaborative project between
CC   [Computational Biology Research Center (CBRC), National Institute
CC   of Advanced Industrial Science and Technology (AIST)] and [Genome
CC   Science Division, Research Center for Advanced Science and
CC   Technology (RCAST), University of Tokyo].
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1051
FT                   /organism="Homo sapiens"
FT                   /chromosome="11"
FT                   /isolate="CBRC7TM_87"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        201..851
FT                   /codon_start=1
FT                   /product="seven transmembrane helix receptor"
FT                   /db_xref="GOA:Q8NH65"
FT                   /db_xref="H-InvDB:HIT000383218.8"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q8NH65"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAC05772.1"
FT                   /translation="MYLVTVLRNLLIILAVSSDPHLHTPMCFFLSNLCWADIGFTLATV
FT                   PKMIVDMQSHTRVISYEGCLTRISFLVLFACIEDMLLTVMAYDCFVAICRPLHYPVIVN
FT                   PHLCVFFLLVYFFLSLLDSQLHSWIVLQFTIIKNVEISNFVCDPSQLLKLACSDSVINS
FT                   IFMYFHSTMFGFLPISGILLSYYKIVPSILRISSSDGKYKAFSTCGSHLAVVC"
XX
SQ   Sequence 1051 BP; 219 A; 289 C; 210 G; 333 T; 0 other;
     cttgtgaatt gcttgcatcc aaaatataca cacagtatta agggctggtt tttatctttt        60
     atttttccaa tcctcttttc ttcccaaggt gtccaagtca cacagagcca cagaatctca       120
     caggtgtctg agaattcctc ctcctgggac tctcagagga tccagaactg cagcccatcc       180
     tggctggtct gtccctgtcc atgtatctgg tcacggtgct gaggaacctg ctcatcatcc       240
     tggctgtcag ctctgacccc cacctccaca cccccatgtg cttcttcctc tccaacctgt       300
     gctgggctga catcggtttc accttggcca cggttcctaa gatgattgtg gacatgcagt       360
     ctcataccag agtcatctct tatgagggct gcctgacacg gatatctttc ttggtccttt       420
     ttgcatgtat agaagacatg ctcctgactg tgatggccta tgactgcttt gtagccatct       480
     gtcgccctct gcactaccca gtcatcgtga atcctcacct ctgtgtcttc ttccttttgg       540
     tatacttttt ccttagcttg ttggattccc agctgcacag ttggattgtg ttacaattca       600
     ccatcatcaa gaatgtggaa atctctaatt ttgtctgtga cccctctcaa cttctcaaac       660
     ttgcctgttc tgacagcgtc atcaatagca tattcatgta tttccatagt actatgtttg       720
     gttttcttcc catttcaggg atccttttgt cttactataa aatcgtcccc tccattctaa       780
     ggatttcatc atcagatggg aagtataaag ccttctccac ctgtggctct cacttggcag       840
     ttgtttgctg attttatgga acaggcattg gcgtgtacct gacttcagct gtgtcaccac       900
     cccccaggaa tggtgtggta gcgtcagtga tgtacgctgt ggtcaccccc atgctgaacc       960
     ttttcatcta cagcctgaga aacagggaca tacaaagtgc cctgcggagg ctgctcagca      1020
     gaacagtcga atctcatgat ctgttccatc c                                     1051
//

If you have problems or comments...

PBIL Back to PBIL home page