(data stored in ACNUC7820 zone)

EMBL: AB065553

ID   AB065553; SV 1; linear; genomic DNA; STD; HUM; 3147 BP.
XX
AC   AB065553;
XX
DT   24-JUL-2002 (Rel. 72, Created)
DT   01-MAR-2003 (Rel. 74, Last updated, Version 2)
XX
DE   Homo sapiens gene for seven transmembrane helix receptor, complete cds,
DE   isolate:CBRC7TM_116.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3147
RA   Suwa M.;
RT   ;
RL   Submitted (11-JUL-2001) to the INSDC.
RL   Makiko Suwa, Computational Biology Research Center (CBRC), National
RL   Institute of Advanced Industrial Science and Technology (AIST); 2-41-6 Aomi
RL   Koto-ku, Tokyo 135-0064, Japan (E-mail:m-suwa@aist.go.jp,
RL   URL:http://www.cbrc.jp/, Tel:81-3-3599-8080, Fax:81-3-3599-8081)
XX
RN   [2]
RA   Suwa M., Sato T., Okouchi I., Arita M., Futami K., Matsumoto S.,
RA   Tsutsumi S., Aburatani H., Asai K., Akiyama Y.;
RT   "Genome-wide discovery and analysis of human seven transmembrane helix
RT   receptor genes.";
RL   Unpublished.
XX
DR   MD5; 6605c377d2a7b74ac20f711139792488.
XX
CC   This sequence is a seven transmembrane helix receptor candidate
CC   predicted from the whole human genome sequences using our
CC   automated system that contains programs of gene
CC   finding(GeneDecoder), sequence search, motif-domain assignment and
CC   transmembrane helix prediction.
CC   And the sequence is submitted by the collaborative project between
CC   [Computational Biology Research Center (CBRC), National Institute
CC   of Advanced Industrial Science and Technology (AIST)] and [Genome
CC   Science Division, Research Center for Advanced Science and
CC   Technology (RCAST), University of Tokyo].
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3147
FT                   /organism="Homo sapiens"
FT                   /chromosome="11"
FT                   /isolate="CBRC7TM_116"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        join(201..324,2163..2947)
FT                   /codon_start=1
FT                   /product="seven transmembrane helix receptor"
FT                   /db_xref="GOA:Q8NH45"
FT                   /db_xref="H-InvDB:HIT000383238.8"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q8NH45"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAC05794.1"
FT                   /translation="MSSSPNLDVSNEITEGLYTPCDIGSNMILSPPGYWERYHSAEDPE
FT                   LQSVLALLSLSLSLNLVTVLRNLLSILAVSSDSPLHTPMYFFLSNLCWADIGLTSATVP
FT                   KVILDMQSHSRVISHVGCLTQMSFLVLFACIEGMLLTVMAYGCFVAICRPLHYPVIVNP
FT                   HLCVFFVLVSFFLNLLDSQLHSWIVLQFTIIKNVEISNFFCDPSQLLNLACSDSVINSI
FT                   FIYFDSTMFGFLPISGILLSYYKIVPSILRMSSSDGKYKAFSTYGSHLGVVCWFYGTVI
FT                   GMYLASAVSPPPRNGVVASVM"
XX
SQ   Sequence 3147 BP; 806 A; 715 C; 672 G; 954 T; 0 other;
     atattaggaa gagtatcaca gggctgtgga aaccccctgc ggtagtggga gtaatatcat        60
     cctctctccc tctgaatata ggaagatttt cacagggggg tgtacacccc ctgcgatatt       120
     gggagtaaga tcatcctctc cacccaggaa atgactaaca aggtcacggg ggttgtacac       180
     cccctgcgat attgggagta atgtcgtcct ccccaaacct ggatgttagc aacgagatca       240
     cagaggggct gtacacaccc tgcgacattg gaagtaatat gatcctgtcc ccacctggat       300
     actgggaaag ataccacagc gcgggtatac gtttcctacg ctgttgggag taatatcatt       360
     cttttccttt ctggatatta ggaagaatat cacaggggtg ctgtacaatt acttcgatat       420
     tgggagtaat atcatcctct attttcctgg atattgggca caaaaacaca aaagggtgta       480
     caacccatgc gatattggaa gtaatagcat actctccttc cctggatgtt agaaaacaat       540
     atcatcaggg ctgaacaccc cccgctataa tgggagtcct gtgtactctt tcacaggcca       600
     tttggaacaa tatcacaagg ggtgtttaca aacaggggtg gtgtacaccc cctgtgatat       660
     tgggagtaac atcattctct ccacctccgg atattaagaa caatatcccg gcgggaggtg       720
     gtacaccccc cagtgatatt gcgaataatg taatcctctc cttccctgta tattaagaac       780
     aatatcgcag gggggtgtac atcttctgtg atattggaag caatatcatc ctcttccccg       840
     ctggatatta gaaaaaaata tcactcacag tgtacaccca ctgtgatatg aggagtaata       900
     tcttcctagg gtattacgaa taatttcaca gtctgtacac acatggtgta cactccctgt       960
     gatattagga gtaatatcta cctagtagat acaaataaca tcgcagggtg tacacccact      1020
     ttgatattag ctgtaatatt tttctaagtt gttacaaata agatcacagg gtgtacatac      1080
     atggtgtaca ctcactgtga tatcaggagt cgtatctctg taatgtatta tgaataatat      1140
     cacaggttgt acacccactg tattattagg agtaatatct ctgtaggata ttacaattaa      1200
     tatcacaggg tgtagagaca ccgtgatatt aggagcaata tctttctagg atattacaaa      1260
     taatatcagg gtgtacaccc actctgctgt catagctagg gttacccgcc accacgccca      1320
     gctaaatttt ttttattttc actggagacg gggtttcacc acgttggcca ggctggtctg      1380
     gaactcctga cctcaggtga tccatcagcc tcggctgccc aaagtgctgg gattacaggt      1440
     gtgggccatg gtgctgggcc aagagttata tattcaattc atttggaaac acagctccca      1500
     tttttgagtg tgcatgtact tttatgaaga aatgatgtca gaaaaccaaa ggatgataat      1560
     aaatatgaaa agtaacaggc atgtgaaaag gtcttccgat tgagaactct aaggttcgat      1620
     ttcgttttca gataatgggg tcttagctct tgcttcgtcc ttttacatat tctacatcaa      1680
     tggaagttgt agcacggtgt cagaataaag tagagtgtat ttcacggctt cttaatttct      1740
     ttcaattaga ctgagatctt tttctaaaag agagaaggac attttcattg cattatattt      1800
     ttcctgaaaa gagtaggctg tattttactg agatcaggga tttgttatat ataacgtttt      1860
     ggtcttctaa tattcttccg tggattttct ctaaagtagt atgtacagaa agccttgtat      1920
     agcaaaaaag caaatcacgt aataattctg agatttttgg aattgtcaca actgagaaac      1980
     attgctggcg atgtatggtc cggaagtgtg aagatgttcc ttgtaaattg cttgcatcca      2040
     gcattaaggg ctggttttta tcttttattt ttccaatcct ctttccttct caaggtgtcc      2100
     aagacacaca gagccacgga atctcacagg tgtctgagaa ttcctcctcc tgggactctc      2160
     agaggatcca gaactgcagt cggtcctcgc tttgctgtcc ctgtccctgt ccctgaatct      2220
     ggtcacggtg ctgaggaacc tgctcagcat cctggctgtc agctctgact cccccctcca      2280
     cacccccatg tacttcttcc tctccaacct gtgctgggct gacatcggtc tcacctcggc      2340
     cacggttccc aaggtgattc tggatatgca gtcgcatagc agagtcatct ctcatgtggg      2400
     ctgcctgaca cagatgtctt tcttggtcct ttttgcatgt atagaaggca tgctcctgac      2460
     tgtgatggcc tatggctgct ttgtagccat ctgtcgccct ctgcactacc cagtcatagt      2520
     gaatcctcac ctctgtgtct tcttcgtttt ggtgtccttt ttccttaacc tgttggattc      2580
     ccagctgcac agttggattg tgttacaatt caccatcatc aagaatgtgg aaatctctaa      2640
     ttttttctgt gacccctctc agcttctcaa ccttgcctgt tctgacagcg tcatcaatag      2700
     catattcata tatttcgata gtactatgtt tggttttctt cccatttcag ggatcctttt      2760
     gtcttactat aaaattgtcc cctccattct aaggatgtca tcgtcagatg ggaagtataa      2820
     agccttctcc acctatggct ctcacctagg agttgtttgc tggttttatg gaacagtcat      2880
     tggcatgtac ctggcttcag ccgtgtcacc accccccagg aatggtgtgg tggcatcagt      2940
     gatgtaggct gtggtcaccc ccatgctgaa ccttttcatc tacagcctga gaaacaggga      3000
     catacaaagt gccctgcgga ggctgcgcag cagaacagtc gaatctcatg atctgttcca      3060
     tcctttttct tgtgtgcgtg agaaagggca accacattaa atctctgcat ctgcaaatcc      3120
     tgccccttag tcacattatt tttgtgg                                          3147
//

If you have problems or comments...

PBIL Back to PBIL home page