(data stored in ACNUC7820 zone)

EMBL: AB065604

ID   AB065604; SV 1; linear; genomic DNA; STD; HUM; 2869 BP.
XX
AC   AB065604;
XX
DT   24-JUL-2002 (Rel. 72, Created)
DT   01-MAR-2003 (Rel. 74, Last updated, Version 2)
XX
DE   Homo sapiens gene for seven transmembrane helix receptor, complete cds,
DE   isolate:CBRC7TM_167.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2869
RA   Suwa M.;
RT   ;
RL   Submitted (11-JUL-2001) to the INSDC.
RL   Makiko Suwa, Computational Biology Research Center (CBRC), National
RL   Institute of Advanced Industrial Science and Technology (AIST); 2-41-6 Aomi
RL   Koto-ku, Tokyo 135-0064, Japan (E-mail:m-suwa@aist.go.jp,
RL   URL:http://www.cbrc.jp/, Tel:81-3-3599-8080, Fax:81-3-3599-8081)
XX
RN   [2]
RA   Suwa M., Sato T., Okouchi I., Arita M., Futami K., Matsumoto S.,
RA   Tsutsumi S., Aburatani H., Asai K., Akiyama Y.;
RT   "Genome-wide discovery and analysis of human seven transmembrane helix
RT   receptor genes.";
RL   Unpublished.
XX
DR   MD5; 4b5596b1a20c6eae8b05078f79dd3f65.
DR   Ensembl-Gn; ENSG00000284723; homo_sapiens.
DR   Ensembl-Tr; ENST00000310194; homo_sapiens.
XX
CC   This sequence is a seven transmembrane helix receptor candidate
CC   predicted from the whole human genome sequences using our
CC   automated system that contains programs of gene
CC   finding(GeneDecoder), sequence search, motif-domain assignment and
CC   transmembrane helix prediction.
CC   And the sequence is submitted by the collaborative project between
CC   [Computational Biology Research Center (CBRC), National Institute
CC   of Advanced Industrial Science and Technology (AIST)] and [Genome
CC   Science Division, Research Center for Advanced Science and
CC   Technology (RCAST), University of Tokyo].
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2869
FT                   /organism="Homo sapiens"
FT                   /chromosome="15"
FT                   /isolate="CBRC7TM_167"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        join(201..1088,2478..2669)
FT                   /codon_start=1
FT                   /product="seven transmembrane helix receptor"
FT                   /db_xref="GOA:Q8NH09"
FT                   /db_xref="H-InvDB:HIT000383271.8"
FT                   /db_xref="HGNC:HGNC:19628"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8NH09"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAC05832.1"
FT                   /translation="MALGNHSTITEFLLLGLSADPNIRALLFVLFLGIYLLTIMENLML
FT                   LLVIRADSCLHKPMYFFLSHLSFVDLCFSSVIVPKMLENLLSQRKTISVEGCLAQVFFV
FT                   FVTAGTEACLLSGMAYDRHAAIRRPLLYGQIMGKQLYMHLVWGSWGLGFLDALINVLLA
FT                   VNMVFCEAKIIHHYSYEMPSLLPLSCSDISRSLIVLLCSTLLHGLGNFLLVFLSYTRII
FT                   STILSISSTSGRSKAFSTCSAHLTAVTLYYGSGLLRHLMPNSGSPIELIFSVQYTVVTP
FT                   MLNSLIYSLKNKEVKGERSLRDSSHLPQLHKGQARWKRPAFTEGRREPGHPELSIPVTP
FT                   QPQGACACSALRAAPTALP"
XX
SQ   Sequence 2869 BP; 758 A; 699 C; 615 G; 797 T; 0 other;
     attacactgt tacaatttct tgttttcaca tccatgttct tcagtggacc atttaaagag        60
     caaagactac acctcaatca cctttatgtt ccatgtgacc gatatgaaaa gagaatcagt       120
     accatgagaa aactgtctgg agtaatcttg acttggctgc tatgatttta cgagttattt       180
     ctagggagta gcctttgtaa atggccttgg ggaatcacag caccatcacc gagttcctcc       240
     tccttgggct gtctgccgac cccaacatcc gggctctgct ctttgtgctg ttcctgggga       300
     tttacctcct gaccataatg gaaaacctga tgctgctgct cgtgatcagg gctgattctt       360
     gtctccataa gcccatgtat ttcttcctga gtcacctctc ttttgttgat ctctgcttct       420
     cttcagtcat tgtgcccaag atgctggaga acctcctgtc acagaggaaa accatttcag       480
     tagagggctg cctggctcag gtcttctttg tgtttgtcac tgcagggact gaagcctgcc       540
     ttctctcagg gatggcctat gaccgccatg ctgccatccg ccgcccacta ctttatggac       600
     agatcatggg taaacagctg tatatgcacc ttgtgtgggg ctcatgggga ctgggctttc       660
     tggacgcact catcaatgtc ctcctagctg taaacatggt cttttgtgaa gccaaaatca       720
     ttcaccacta cagctatgag atgccatccc tcctccctct gtcctgctct gatatctcca       780
     gaagcctcat cgttttgctc tgctccactc tcctacatgg gctgggaaac ttccttttgg       840
     tcttcttatc ctacacccgt ataatctcta ccatcctaag catcagctct acctcgggca       900
     gaagcaaggc cttctccacc tgctctgccc acctcactgc agtgacactt tactatggct       960
     caggtttgct ccgccatctc atgccaaact caggttcccc catagagttg atcttctctg      1020
     tgcagtatac tgtagtcact cccatgctga attccctcat ctatagcctg aaaaataagg      1080
     aagtgaaggt agctctgaaa agaactttgg aaaaatattt gcaatatacc agacgttgag      1140
     ttaaaaaaca aacattgttg gccgagcact gtggctcatg cctgcagcag gaggattgct      1200
     tgagctcagg agttcgagat tagcttggcc aacatggtga aaccctgtct ccaaaaaaaa      1260
     aaaaaaatag gccgggcatg gtggtgtgca cctgtaattc cagttacttg gaaggctgag      1320
     ggaggaggat cacttgagcg tgggaggtca aggctgcagt gagctgagat tgcaccactg      1380
     cactccagcc tgggcaacag agcaagaccc tgtctcaaaa aaaaaagatt ttggaaaatt      1440
     taggtcaagc tgcatacaac atgacactgg ataagtttat agtagtaagt attcctggct      1500
     accctcagtg tctgatactg caagctgtaa attagaagtg catgagagaa tggtacaaag      1560
     ttattacaag taggaaggtt aactttaatc cctcttagtg acaaagcaaa ttattaaatt      1620
     attacctcaa taaagttttg ttatgaacat attgattcat ttttctcatt ctaaaacatt      1680
     catcttgggc tttgcattta gtaaaatcat tagcgtcgca aatctatcat ttttaattta      1740
     ctttggtgaa cacactaaaa gtcatggcat ttaataagaa cacagtgtca tggatgcgtg      1800
     ggagagaaaa gtcactagat aagacttgat gggaagaaag agaaagattt ccaaccgtgt      1860
     ggccatagaa gacataaaca cctaagagaa cttcagagag ggaatcaaca tactgaggca      1920
     gaacttggac tcagataaaa ttcccaagaa cttcactgtg tgtgcagctt ggtggccagc      1980
     tctccggtgc aaaagattgc aaggaggctc tgtggctcta gaaacttcat tcctcacatg      2040
     gtcttcattc actgtatacg ggatttatat tttttccaat tagctgatct tatcagtgtg      2100
     tcttttcctt gtagagtgca ggctatgtac cctagacaaa taatcttgtt ttgacctcat      2160
     ctcaagtgaa tcctgaaact atctttgtct catctttcat tgtttagtgt caggtggttt      2220
     gccggttcta agggcactga aaaactctca cgtaataaac attttttcct ataaaacaaa      2280
     tgcttctgat ttgtttaagc tatattttac aattgcctaa cttactgtag ttaactgaaa      2340
     aggtgcaaaa actatctaca aattattgaa tttattgaat attaacttgc acttttctca      2400
     agcttctttc acaaactctc ttcgttctaa ttgtcagttt taaaagcttt tcatgaaaaa      2460
     aacgtatctg ttacaagggg gaaagaagcc tccgggacag cagtcatttg cctcagctgc      2520
     acaaaggcca ggccagatgg aagagaccag ccttcaccga aggccgcagg gagcccggac      2580
     acccggagct gagcattccg gtcacgcctc aaccccaagg ggcctgcgca tgctccgcgc      2640
     tgcgcgcggc gcccacggcc ctgccctgat acgcaggagc cccgggatag agaaacccag      2700
     atgaaaacac aagcccagtg agatgttggc ctcctcatct gctaccctcg ccgtcacctc      2760
     tgcgcaccaa gccttctgtc ccggagaaga agccgtattt ggtctccctc gatgggcgag      2820
     accggggcca cgcgggcacc gtgatcccgc cactgcatcc cggggaccc                  2869
//

If you have problems or comments...

PBIL Back to PBIL home page