(data stored in ACNUC15260 zone)

EMBL: AB065663

ID   AB065663; SV 1; linear; genomic DNA; STD; HUM; 1339 BP.
XX
AC   AB065663;
XX
DT   24-JUL-2002 (Rel. 72, Created)
DT   01-MAR-2003 (Rel. 74, Last updated, Version 2)
XX
DE   Homo sapiens gene for seven transmembrane helix receptor, complete cds,
DE   isolate:CBRC7TM_226.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1339
RA   Suwa M.;
RT   ;
RL   Submitted (11-JUL-2001) to the INSDC.
RL   Makiko Suwa, Computational Biology Research Center (CBRC), National
RL   Institute of Advanced Industrial Science and Technology (AIST); 2-41-6 Aomi
RL   Koto-ku, Tokyo 135-0064, Japan (E-mail:m-suwa@aist.go.jp,
RL   URL:http://www.cbrc.jp/, Tel:81-3-3599-8080, Fax:81-3-3599-8081)
XX
RN   [2]
RA   Suwa M., Sato T., Okouchi I., Arita M., Futami K., Matsumoto S.,
RA   Tsutsumi S., Aburatani H., Asai K., Akiyama Y.;
RT   "Genome-wide discovery and analysis of human seven transmembrane helix
RT   receptor genes.";
RL   Unpublished.
XX
DR   MD5; b3df4d7a2c303b29e98d6e80e64f7055.
DR   Ensembl-Gn; ENSG00000182083; homo_sapiens.
DR   Ensembl-Tr; ENST00000402971; homo_sapiens.
XX
CC   This sequence is a seven transmembrane helix receptor candidate
CC   predicted from the whole human genome sequences using our
CC   automated system that contains programs of gene
CC   finding(GeneDecoder), sequence search, motif-domain assignment and
CC   transmembrane helix prediction.
CC   And the sequence is submitted by the collaborative project between
CC   [Computational Biology Research Center (CBRC), National Institute
CC   of Advanced Industrial Science and Technology (AIST)] and [Genome
CC   Science Division, Research Center for Advanced Science and
CC   Technology (RCAST), University of Tokyo].
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1339
FT                   /organism="Homo sapiens"
FT                   /chromosome="2"
FT                   /isolate="CBRC7TM_226"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        201..1139
FT                   /codon_start=1
FT                   /product="seven transmembrane helix receptor"
FT                   /db_xref="GOA:Q6IFH4"
FT                   /db_xref="HGNC:HGNC:15041"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6IFH4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAC05889.1"
FT                   /translation="MSGENVTKVSTFILVGLPTAPGLQYLLFLLFLLTYLFVLVENLAI
FT                   ILIVWSSTSLHRPMYYFLSSMSFLEIWYVSDITPKMLEGFLLQQKRISFVGCMTQLYFF
FT                   SSLVCTECVLLASMAYDRYVAICHPLRYHVLVTPGLCLQLVGFSFVSGFTISMIKVCFI
FT                   SSVTFCGSNVLNHFFCDISPILKLACTDFSTAELVDFILAFIILVFPLLATILSYWHIT
FT                   LAVLRIPSATGCWRAFSTCASHLTVVTVFYTALLFMYVRPQAIDSQSSNKLISAVYTVV
FT                   TPIINPLIYCLRNKEFKDALKKALGLGQTSH"
XX
SQ   Sequence 1339 BP; 271 A; 424 C; 276 G; 368 T; 0 other;
     cagaagtttt ctactttaaa actcagaaga tcagcagatc actgctctct cctggtgctc        60
     tggggagcca cgtggcctct ctttgcacca aaactcccca tccaagtcca gctccactct       120
     ctctctgcct cagctgccct gcagcccttt cctcttgctc tttgatgttt tgtaggcctg       180
     cagctcccaa gcacagaggc atgagtgggg agaatgtcac caaggtcagc accttcatcc       240
     tggtgggcct ccccacggcc ccagggctgc agtacctgct cttcctcctc ttcctgctca       300
     cctacctctt tgtcctggtg gagaacctgg ccatcatcct catcgtctgg agcagcacct       360
     ccctccacag gcccatgtac tactttctga gctccatgtc tttcctggag atctggtacg       420
     tgtctgacat cacccccaag atgctggagg gcttcctcct ccagcagaaa cgcatctctt       480
     tcgtcgggtg catgacgcag ctctacttct tcagctccct ggtgtgcacc gagtgtgtgc       540
     ttctggcctc catggcctac gaccgctacg tggccatctg ccacccgctg cgctaccacg       600
     tccttgtgac cccggggctg tgcctccagc tggtgggctt ctcctttgtg agtggcttca       660
     ccatctccat gatcaaggtc tgttttatct ccagcgtcac gttctgtggc tccaacgtct       720
     tgaaccactt cttctgtgac atttccccca tcctcaagct ggcctgcacg gacttctcca       780
     ctgcagagct ggtggatttc atcctggcct tcatcatcct ggtgtttccg ctcctggcca       840
     ccatactgtc atattggcac atcaccctgg ctgtcctgcg catcccctcg gccaccggct       900
     gctggagagc cttctctacc tgcgcctctc acctcaccgt ggtcaccgtc ttctatacag       960
     ccttgctttt catgtatgtc cggccccaag ccattgattc ccagagctcc aacaagctca      1020
     tctctgccgt gtacactgtt gtcacgccaa taattaaccc tttgatttac tgcctgagga      1080
     acaaggaatt taaggacgcc ttgaaaaagg ccttgggctt gggtcaaact tcacactaag      1140
     acaactaaat gtcctagagt aaaatctgta gtgatgaaac aacattgtat gtggcacttt      1200
     gtgctcttta aattaatttt taagttaaat ttaacaaacc tacagaacta agtgaaattt      1260
     aacaaaccta cacaactgtg cacaagtaac aagccttcgt ctgcatatgt tttcacaaaa      1320
     ggactgtgct catggaacc                                                   1339
//

If you have problems or comments...

PBIL Back to PBIL home page