(data stored in ACNUC15260 zone)

EMBL: AB065698

ID   AB065698; SV 1; linear; genomic DNA; STD; HUM; 1051 BP.
XX
AC   AB065698;
XX
DT   24-JUL-2002 (Rel. 72, Created)
DT   01-MAR-2003 (Rel. 74, Last updated, Version 2)
XX
DE   Homo sapiens gene for seven transmembrane helix receptor, complete cds,
DE   isolate:CBRC7TM_261.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1051
RA   Suwa M.;
RT   ;
RL   Submitted (11-JUL-2001) to the INSDC.
RL   Makiko Suwa, Computational Biology Research Center (CBRC), National
RL   Institute of Advanced Industrial Science and Technology (AIST); 2-41-6 Aomi
RL   Koto-ku, Tokyo 135-0064, Japan (E-mail:m-suwa@aist.go.jp,
RL   URL:http://www.cbrc.jp/, Tel:81-3-3599-8080, Fax:81-3-3599-8081)
XX
RN   [2]
RA   Suwa M., Sato T., Okouchi I., Arita M., Futami K., Matsumoto S.,
RA   Tsutsumi S., Aburatani H., Asai K., Akiyama Y.;
RT   "Genome-wide discovery and analysis of human seven transmembrane helix
RT   receptor genes.";
RL   Unpublished.
XX
DR   MD5; 55d6dc9abedcae179333e7b581d30f42.
XX
CC   This sequence is a seven transmembrane helix receptor candidate
CC   predicted from the whole human genome sequences using our
CC   automated system that contains programs of gene
CC   finding(GeneDecoder), sequence search, motif-domain assignment and
CC   transmembrane helix prediction.
CC   And the sequence is submitted by the collaborative project between
CC   [Computational Biology Research Center (CBRC), National Institute
CC   of Advanced Industrial Science and Technology (AIST)] and [Genome
CC   Science Division, Research Center for Advanced Science and
CC   Technology (RCAST), University of Tokyo].
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1051
FT                   /organism="Homo sapiens"
FT                   /chromosome="7"
FT                   /isolate="CBRC7TM_261"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        201..851
FT                   /codon_start=1
FT                   /product="seven transmembrane helix receptor"
FT                   /db_xref="GOA:Q8NGT4"
FT                   /db_xref="H-InvDB:HIT000383340.8"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q8NGT4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAC05921.1"
FT                   /translation="MYLVTVLRNLLSILAVSSDSPLHTPMYFFLSNLCWADIGFTSAMV
FT                   PKMIVDMQSHSRVISHEGCLTQMFFLVLFACIEGMILTVMAYDCFVAICRPLNYPVIVN
FT                   PHLCVFFILMSFFLSLLDSQLHSWIVLQFTIIKNVEISNFVCDPSQLLKLACSDSVINS
FT                   IFTYFHSTMFAFLPISAILLSYYKIVTSILRISSSDGKYKAFSTCDSHLAVVC"
XX
SQ   Sequence 1051 BP; 220 A; 290 C; 207 G; 334 T; 0 other;
     gacgttcctt gtgaattgct tgcatctagc attaacggct ggtttttatc ttttattttt        60
     ccaatcctct ttccttctca aggtgtccaa gacacacaga gccacggaat ctcacaggtg       120
     tctgagaatt cctcctcctg ggactctcag aggatccaga actgcagccg gtcctcgctt       180
     tgctgtccct gtccctgtcc atgtatctgg tcacggtgct gaggaacctc ctcagtatcc       240
     tggctgtcag ctctgactcc cccctccaca cccccatgta cttcttcctc tccaacctgt       300
     gctgggctga catcggtttc acctcggcca tggttcccaa gatgattgtg gacatgcagt       360
     cgcatagcag agtcatctct catgagggct gcctgacaca gatgtttttc ttggtccttt       420
     ttgcatgtat agaaggcatg atcctgactg tgatggccta tgactgcttt gtagccatct       480
     gtcgccctct gaattaccca gtcatcgtga atcctcacct ctgtgtcttc ttcattttga       540
     tgtccttttt ccttagcctg ttggattccc agctgcacag ttggattgtg ttacaattca       600
     caatcatcaa gaatgtggaa atctctaatt ttgtctgtga cccctctcaa cttctcaaac       660
     ttgcctgttc tgacagcgtc atcaatagca tattcacata tttccatagt actatgtttg       720
     cttttcttcc catttcagca atccttttat cttactataa aatcgtcacc tccattctca       780
     ggatttcatc ttcagatggg aagtataaag ccttctccac ctgtgactct cacctagcag       840
     ttgtttgctg attttatgga acagacattg ggatgtacct gacttcagct gtgtcaccac       900
     ctcccaggaa tggtgtagtg gcgtcaatga tgtacgctgt ggtcaccccc atgctgaacc       960
     ttttcatcta cagcctgaga aacagggaca tacaaagtgc cttgcggagg ctgcgcagca      1020
     gaacagtcga atctcatgat ctgttccatc c                                     1051
//

If you have problems or comments...

PBIL Back to PBIL home page