(data stored in ACNUC15260 zone)

EMBL: AB065721

ID   AB065721; SV 1; linear; genomic DNA; STD; HUM; 1330 BP.
XX
AC   AB065721;
XX
DT   24-JUL-2002 (Rel. 72, Created)
DT   01-MAR-2003 (Rel. 74, Last updated, Version 2)
XX
DE   Homo sapiens gene for seven transmembrane helix receptor, complete cds,
DE   isolate:CBRC7TM_284.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1330
RA   Suwa M.;
RT   ;
RL   Submitted (11-JUL-2001) to the INSDC.
RL   Makiko Suwa, Computational Biology Research Center (CBRC), National
RL   Institute of Advanced Industrial Science and Technology (AIST); 2-41-6 Aomi
RL   Koto-ku, Tokyo 135-0064, Japan (E-mail:m-suwa@aist.go.jp,
RL   URL:http://www.cbrc.jp/, Tel:81-3-3599-8080, Fax:81-3-3599-8081)
XX
RN   [2]
RA   Suwa M., Sato T., Okouchi I., Arita M., Futami K., Matsumoto S.,
RA   Tsutsumi S., Aburatani H., Asai K., Akiyama Y.;
RT   "Genome-wide discovery and analysis of human seven transmembrane helix
RT   receptor genes.";
RL   Unpublished.
XX
DR   MD5; 856d57650d28274cbf4bb44ff6b9fe24.
DR   Ensembl-Gn; ENSG00000171496; homo_sapiens.
DR   Ensembl-Tr; ENST00000304865; homo_sapiens.
DR   Ensembl-Tr; ENST00000641027; homo_sapiens.
XX
CC   This sequence is a seven transmembrane helix receptor candidate
CC   predicted from the whole human genome sequences using our
CC   automated system that contains programs of gene
CC   finding(GeneDecoder), sequence search, motif-domain assignment and
CC   transmembrane helix prediction.
CC   And the sequence is submitted by the collaborative project between
CC   [Computational Biology Research Center (CBRC), National Institute
CC   of Advanced Industrial Science and Technology (AIST)] and [Genome
CC   Science Division, Research Center for Advanced Science and
CC   Technology (RCAST), University of Tokyo].
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1330
FT                   /organism="Homo sapiens"
FT                   /chromosome="9"
FT                   /isolate="CBRC7TM_284"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        201..1130
FT                   /codon_start=1
FT                   /product="seven transmembrane helix receptor"
FT                   /db_xref="GOA:Q8NGR8"
FT                   /db_xref="H-InvDB:HIT000383354.8"
FT                   /db_xref="HGNC:HGNC:15110"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8NGR8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAC05942.1"
FT                   /translation="MERINHTSSVSEFILLGLSSRPEDQKTLFVLFLIVYLVTITGNLL
FT                   IILAIRFNPHLQTPMYFFLSFLSLTDICFTTSVVPKMLMNFLSEKKTISYAGCLTQMYF
FT                   LYALGNSDSCLLAVMAFDRYVAVCDPFHYVTTMSHHHCVLLVAFSCSFPHLHSLLHTLL
FT                   LNRLTFCDSNVIHHFLCDLSPVLKLSCSSIFVNEIVQMTEAPIVLVTRFLCIAFSYIRI
FT                   LTTVLKIPSTSGKRKAFSTCGFYLTVVTLFYGSIFCVYLQPPSTYAVKDHVATIVYTVL
FT                   SSMLNPFIYSLRNKDLKQGLRKLMSKRS"
XX
SQ   Sequence 1330 BP; 321 A; 366 C; 253 G; 390 T; 0 other;
     tgcccttatg gagcccatag atttgggaag ggaggacccc atcaaggacc atgaggtgaa        60
     caagccatcc cacaattagc acagtagcta attgtgacca aacagaagaa acaaagactt       120
     gctaggttct catgattggt gttatgaaat cagagcatgt taaatgacaa aacttcttgt       180
     ttataactga gcccaagtca atggaaagaa tcaaccacac cagcagtgtc tccgagttta       240
     tcctcctggg actctcctcc cggcctgagg accaaaagac actctttgtt ctcttcctca       300
     tcgtgtacct ggtcaccata acagggaacc tgctcatcat cctggccatt cgcttcaacc       360
     cccatcttca gacccctatg tatttcttct tgagttttct gtctctcact gatatttgct       420
     ttacaacaag cgttgtcccc aagatgctga tgaacttcct gtcagaaaag aagaccatct       480
     cctatgctgg gtgtctgaca cagatgtatt ttctctatgc cttgggcaac agtgacagct       540
     gccttctggc agtcatggcc tttgaccgct atgtggccgt ctgtgaccct ttccactatg       600
     tcaccaccat gagccaccac cactgtgtcc tgctggtggc cttctcctgc tcatttcctc       660
     acctccactc actcctgcac acacttctgc tgaatcgtct caccttctgt gactccaatg       720
     ttatccacca ctttctctgt gacctcagcc ctgtgctgaa attgtcctgc tcttccatat       780
     ttgtcaatga aattgtgcag atgacagaag cacctattgt tttggtgact cgttttctct       840
     gcattgcttt ctcttatata cgaatcctca ctacagttct caagattccc tctacttctg       900
     ggaaacgcaa agccttctcc acctgtggtt tttacctcac cgtggtgacg ctcttttatg       960
     gaagcatctt ctgtgtctat ttacagcccc catccaccta cgctgtcaag gaccacgtgg      1020
     caacaattgt ttacacagtt ttgtcatcca tgctcaatcc ttttatctac agcctgagaa      1080
     acaaagacct gaaacagggc ctgaggaagc ttatgagcaa gagatcctag gaagcaccct      1140
     cttgaaaaac tcgtaagtgg aatctgctca acttggacgt gttttctact ggtttctggt      1200
     gaacagtcaa agctgttgga agctagcact tctgacccat gtgagacaag gctattgtgg      1260
     gcacttacat ccattgatga tgacccaaca attcggcctg tatctcttaa atcacaatcg      1320
     tttcctgtct                                                             1330
//

If you have problems or comments...

PBIL Back to PBIL home page