(data stored in ACNUC7820 zone)

EMBL: AB065749

ID   AB065749; SV 1; linear; genomic DNA; STD; HUM; 1051 BP.
XX
AC   AB065749;
XX
DT   24-JUL-2002 (Rel. 72, Created)
DT   01-MAR-2003 (Rel. 74, Last updated, Version 2)
XX
DE   Homo sapiens gene for seven transmembrane helix receptor, complete cds,
DE   isolate:CBRC7TM_312.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1051
RA   Suwa M.;
RT   ;
RL   Submitted (11-JUL-2001) to the INSDC.
RL   Makiko Suwa, Computational Biology Research Center (CBRC), National
RL   Institute of Advanced Industrial Science and Technology (AIST); 2-41-6 Aomi
RL   Koto-ku, Tokyo 135-0064, Japan (E-mail:m-suwa@aist.go.jp,
RL   URL:http://www.cbrc.jp/, Tel:81-3-3599-8080, Fax:81-3-3599-8081)
XX
RN   [2]
RA   Suwa M., Sato T., Okouchi I., Arita M., Futami K., Matsumoto S.,
RA   Tsutsumi S., Aburatani H., Asai K., Akiyama Y.;
RT   "Genome-wide discovery and analysis of human seven transmembrane helix
RT   receptor genes.";
RL   Unpublished.
XX
DR   MD5; bc81b50e761a3003b7847bbfc8914f5b.
XX
CC   This sequence is a seven transmembrane helix receptor candidate
CC   predicted from the whole human genome sequences using our
CC   automated system that contains programs of gene
CC   finding(GeneDecoder), sequence search, motif-domain assignment and
CC   transmembrane helix prediction.
CC   And the sequence is submitted by the collaborative project between
CC   [Computational Biology Research Center (CBRC), National Institute
CC   of Advanced Industrial Science and Technology (AIST)] and [Genome
CC   Science Division, Research Center for Advanced Science and
CC   Technology (RCAST), University of Tokyo].
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1051
FT                   /organism="Homo sapiens"
FT                   /chromosome="11"
FT                   /isolate="CBRC7TM_312"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        201..851
FT                   /codon_start=1
FT                   /product="seven transmembrane helix receptor"
FT                   /db_xref="GOA:Q8NGP1"
FT                   /db_xref="H-InvDB:HIT000383373.8"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q8NGP1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAC05969.1"
FT                   /translation="MHLVMVLRNLLNILAVSSDSPLHTPTYFFLSNLCWADTGFTSATV
FT                   PNMIVDMQSHSRVISHADCLTQISFLLLFACIEGMLLTVMTYDCFVAICCPLHYPVIVN
FT                   PHLCVFFVLVSFFLSLLDSQLHSWIVLQFTIIKNVEISNSVCDPSQLLKLACSDSVINS
FT                   IFMHFHNTMFGFLPISGILVSYYKIVPSILRISSSDGKYKAFSTCGSHLAVVC"
XX
SQ   Sequence 1051 BP; 211 A; 300 C; 210 G; 330 T; 0 other;
     gatgttcctt gtgaattgct tgcatccagc attaagggct ggtttttatc ttttattttt        60
     ccaatcctct ttccttctca aggtgtccaa gacacacaga gccacggaat ctcacaagtg       120
     tctgagaatt cctcctcctg ggactctcag aggatccaga actgcagccg ctcctcgctt       180
     tgctgtccct gtccctgtcc atgcatctgg tcatggtgct gaggaacctg ctcaacatcc       240
     tggctgtcag ctctgactcc cccctccaca cccccacgta cttcttcctc tccaacctgt       300
     gctgggctga caccggtttc acctcggcca cggttcccaa tatgattgtg gacatgcagt       360
     cgcatagcag agtcatctct catgcggact gcctgacaca gatttccttc ttgctccttt       420
     ttgcatgtat agaaggcatg ctcctgactg tgatgaccta tgactgcttt gtagccatct       480
     gttgccctct gcactaccca gtcatcgtga atcctcacct ctgtgtcttc ttcgttttgg       540
     tgtccttttt ccttagcctg ttggattccc agctgcacag ttggattgtg ttacaattca       600
     ccatcatcaa gaatgtggaa atctctaatt ctgtctgtga cccctctcaa cttctcaaac       660
     ttgcttgttc tgacagcgtc atcaatagca tattcatgca tttccataat actatgtttg       720
     gttttcttcc catttcaggg atccttgtgt cttactataa aatcgtcccc tccattctta       780
     ggatttcatc gtcagatggg aagtataaag ccttctccac ctgtggctct cacctagcag       840
     ttgtttgctg attttatgga acaggcattg gcgtgtactt gacttcagct ctgtcaccac       900
     cccccaggaa tggtgtgatg gcgtcagtga tgtacgctgt ggtcaccccc atgctgaacc       960
     ttttcatcta cagcctgaga aacagggaca tacaaagtgc cctgtggagg ctgctcagca      1020
     gaacagtcga atctcatgat ctgttccatc c                                     1051
//

If you have problems or comments...

PBIL Back to PBIL home page