(data stored in ACNUC21562 zone)

EMBL: AB065786

ID   AB065786; SV 1; linear; genomic DNA; STD; HUM; 2029 BP.
XX
AC   AB065786;
XX
DT   24-JUL-2002 (Rel. 72, Created)
DT   01-MAR-2003 (Rel. 74, Last updated, Version 2)
XX
DE   Homo sapiens gene for seven transmembrane helix receptor, complete cds,
DE   isolate:CBRC7TM_349.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2029
RA   Suwa M.;
RT   ;
RL   Submitted (11-JUL-2001) to the INSDC.
RL   Makiko Suwa, Computational Biology Research Center (CBRC), National
RL   Institute of Advanced Industrial Science and Technology (AIST); 2-41-6 Aomi
RL   Koto-ku, Tokyo 135-0064, Japan (E-mail:m-suwa@aist.go.jp,
RL   URL:http://www.cbrc.jp/, Tel:81-3-3599-8080, Fax:81-3-3599-8081)
XX
RN   [2]
RA   Suwa M., Sato T., Okouchi I., Arita M., Futami K., Matsumoto S.,
RA   Tsutsumi S., Aburatani H., Asai K., Akiyama Y.;
RT   "Genome-wide discovery and analysis of human seven transmembrane helix
RT   receptor genes.";
RL   Unpublished.
XX
DR   MD5; ec13163ab8997c0cfeff989ff5d9af1f.
DR   Ensembl-Gn; ENSG00000172938; homo_sapiens.
DR   Ensembl-Tr; ENST00000309106; homo_sapiens.
XX
CC   This sequence is a seven transmembrane helix receptor candidate
CC   predicted from the whole human genome sequences using our
CC   automated system that contains programs of gene
CC   finding(GeneDecoder), sequence search, motif-domain assignment and
CC   transmembrane helix prediction.
CC   And the sequence is submitted by the collaborative project between
CC   [Computational Biology Research Center (CBRC), National Institute
CC   of Advanced Industrial Science and Technology (AIST)] and [Genome
CC   Science Division, Research Center for Advanced Science and
CC   Technology (RCAST), University of Tokyo].
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2029
FT                   /organism="Homo sapiens"
FT                   /chromosome="11"
FT                   /isolate="CBRC7TM_349"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        join(201..276,862..1829)
FT                   /codon_start=1
FT                   /product="seven transmembrane helix receptor"
FT                   /db_xref="GOA:Q8TDS7"
FT                   /db_xref="H-InvDB:HIT000383406.8"
FT                   /db_xref="HGNC:HGNC:29626"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="InterPro:IPR026232"
FT                   /db_xref="InterPro:IPR026234"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8TDS7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAC06005.1"
FT                   /translation="MAHYNLNVPGSSDPPALASQVGGTTGMNQTLNSSGTVESALNYSR
FT                   GSTVHTAYLVLSSLAMFTCLCGMAGNSMVIWLLGFRMHRNPFCIYILNLAAADLLFLFS
FT                   MASTLSLETQPLVNTTDKVHELMKRLMYFAYTVGLSLLTAISTQRCLSVLFPIWFKCHR
FT                   PRHLSAWVCGLLWTLCLLMNGLTSSFCSKFLKFNEDRCFRVDMVQAALIMGVLTPVMTL
FT                   SSLTLFVWVRRSSQQWRRQPTRLFVVVLASVLVFLICSLPLSIYWFVLYWLSLPPEMQV
FT                   LCFSLSRLSSSVSSSANPVIYFLVGSRRSHRLPTRSLGTVLQQALREEPELEGGETPTV
FT                   GTNEMGA"
XX
SQ   Sequence 2029 BP; 453 A; 546 C; 533 G; 497 T; 0 other;
     caggaggaaa aaggcagcta agatgggatg gggaaggaaa cttgaataaa tggagggttt        60
     ttaatgggct gatgctcatg gtgtgtctta aactaaggag tgtagttaat tctacacttt       120
     gccctgaggt ctaatttttt ttttttttta agagacagca tctcgctctg tcttccaggc       180
     tggggtgcag tggcgggacc atggctcact acaacctcaa tgtgccaggc tcaagcgatc       240
     ctcccgcctt ggcctctcaa gtaggtggga ccacaggtgt gtgccaccat gcctggctaa       300
     ttaaaaaaaa aaattgtaga gatgagatct tgctatgtgg cccaggctgg tctcaaactc       360
     ctggcctcaa gcaaacccca aagtgctggg gttacaggca tgcaccacca cgcccagccc       420
     taaggtctat tgttttttta attaactcac agggtttgac aattacagga gaaaaaaaaa       480
     atgatttcaa atgtttctat caaatagttt ttctacatct attgataata atgatttttc       540
     tataatagat gtagaaaaag catttgataa aattcaatac ctctccatga tttaaaaaat       600
     aattcaaagc aagatagaag agaatttttt aacctgataa agggtattta taacagcttt       660
     gtagctataa aggtgaccct ggaggcagat ctgggctgag tgagtcacag gagtggggga       720
     aggttaagcc tcccggtcat ggtctgttac ataaagaacc tggaggggag agctctgaag       780
     ctggaaattc gaggggcacc caggggtccc ccgtggtccc agcaacacag aatttcacat       840
     tggtacatct tcctctcgta gggatgaacc agactttgaa tagcagtggg accgtggagt       900
     cagccctaaa ctattccaga gggagcacag tgcacacggc ctacctggtg ctgagctccc       960
     tggccatgtt cacctgcctg tgcgggatgg caggcaacag catggtgatc tggctgctgg      1020
     gctttcgaat gcacaggaac cccttctgca tctatatcct caacctggcg gcagccgacc      1080
     tcctcttcct cttcagcatg gcttccacgc tcagcctgga aacccagccc ctggtcaata      1140
     ccactgacaa ggtccacgag ctgatgaaga gactgatgta ctttgcctac acagtgggcc      1200
     tgagcctgct gacggccatc agcacccagc gctgtctctc tgtcctcttc cctatctggt      1260
     tcaagtgtca ccggcccagg cacctgtcag cctgggtgtg tggcctgctg tggacactct      1320
     gtctcctgat gaacgggttg acctcttcct tctgcagcaa gttcttgaaa ttcaatgaag      1380
     atcggtgctt cagggtggac atggtccagg ccgccctcat catgggggtc ttaaccccag      1440
     tgatgactct gtccagcctg accctctttg tctgggtgcg gaggagctcc cagcagtggc      1500
     ggcggcagcc cacacggctg ttcgtggtgg tcctggcctc tgtcctggtg ttcctcatct      1560
     gttccctgcc tctgagcatc tactggtttg tgctctactg gttgagcctg ccgcccgaga      1620
     tgcaggtcct gtgcttcagc ttgtcacgcc tctcctcgtc cgtaagcagc agcgccaacc      1680
     ccgtcatcta cttcctggtg ggcagccgga ggagccacag gctgcccacc aggtccctgg      1740
     ggactgtgct ccaacaggcg cttcgcgagg agcccgagct ggaaggtggg gagacgccca      1800
     ccgtgggcac caatgagatg ggggcttgag agccgcccac aggtgcttcc cacctgtgcg      1860
     agcccatgcc ctggagattc ccgagccgtg agctgcctcc cacctcgtcc ctgccaagtg      1920
     tctggcccgc cttcttgggg gagccccaag gactttgcag ctgcatgtgg gggtcacttc      1980
     cctgcatgtc aaaactcccc acaacacctg tgtcctggat ctcacaatg                  2029
//

If you have problems or comments...

PBIL Back to PBIL home page