(data stored in ACNUC7820 zone)

EMBL: AB065878

ID   AB065878; SV 1; linear; genomic DNA; STD; HUM; 1051 BP.
XX
AC   AB065878;
XX
DT   24-JUL-2002 (Rel. 72, Created)
DT   01-MAR-2003 (Rel. 74, Last updated, Version 2)
XX
DE   Homo sapiens gene for seven transmembrane helix receptor, complete cds,
DE   isolate:CBRC7TM_441.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1051
RA   Suwa M.;
RT   ;
RL   Submitted (11-JUL-2001) to the INSDC.
RL   Makiko Suwa, Computational Biology Research Center (CBRC), National
RL   Institute of Advanced Industrial Science and Technology (AIST); 2-41-6 Aomi
RL   Koto-ku, Tokyo 135-0064, Japan (E-mail:m-suwa@aist.go.jp,
RL   URL:http://www.cbrc.jp/, Tel:81-3-3599-8080, Fax:81-3-3599-8081)
XX
RN   [2]
RA   Suwa M., Sato T., Okouchi I., Arita M., Futami K., Matsumoto S.,
RA   Tsutsumi S., Aburatani H., Asai K., Akiyama Y.;
RT   "Genome-wide discovery and analysis of human seven transmembrane helix
RT   receptor genes.";
RL   Unpublished.
XX
DR   MD5; 5cbe939d84a40364eebda2d55b9ca08c.
XX
CC   This sequence is a seven transmembrane helix receptor candidate
CC   predicted from the whole human genome sequences using our
CC   automated system that contains programs of gene
CC   finding(GeneDecoder), sequence search, motif-domain assignment and
CC   transmembrane helix prediction.
CC   And the sequence is submitted by the collaborative project between
CC   [Computational Biology Research Center (CBRC), National Institute
CC   of Advanced Industrial Science and Technology (AIST)] and [Genome
CC   Science Division, Research Center for Advanced Science and
CC   Technology (RCAST), University of Tokyo].
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1051
FT                   /organism="Homo sapiens"
FT                   /chromosome="14"
FT                   /isolate="CBRC7TM_441"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        201..851
FT                   /codon_start=1
FT                   /product="seven transmembrane helix receptor"
FT                   /db_xref="GOA:Q8NGD7"
FT                   /db_xref="H-InvDB:HIT000383484.8"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q8NGD7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAC06096.1"
FT                   /translation="MYLVTVLRNLLSILAVSSDSHLHTPMYFFLSNLCWADIGYTSATV
FT                   PKMIVDTQSHGRVISHAGCLTQMSFLVLFACIEDMLLTVMAYDCFVAICCPLHYPVIVN
FT                   PHLCVFFVLVSFFLSLLDSQLHSWIVLQFTIIKNVEISNFVCDPSQLLKLACSDSVINS
FT                   IFIYFDSTMFGFLPISGILLSYSKIVPSVLRMSSSDGKYKAFSTCGSHLAVVC"
XX
SQ   Sequence 1051 BP; 216 A; 297 C; 216 G; 322 T; 0 other;
     aattgcttgc atccaaaata tacacacagc attaagggct ggtttttatc ttttattttc        60
     ccaatcctct ttccttctca aggtgtccaa gacacacaga gccactgaat ctcacaggtg       120
     tctgagaatt cctcctcctg ggactctcag aggatccaga actgcagccg gtcctcgctt       180
     tgctctccct gtccctgtcc atgtatctgg tcacggtgct gaggaacctg ctcagcatcc       240
     tggctgtcag ctctgactcc cacctccaca cccccatgta cttcttcctc tccaacctgt       300
     gctgggctga catcggttac acctcggcca cggttcccaa gatgattgtg gacacgcagt       360
     cgcatggcag agtcatctct catgctggct gcctgacaca gatgtctttc ttggtccttt       420
     ttgcatgtat agaagacatg ctcctgactg tgatggccta tgactgcttt gtagccatct       480
     gttgccctct gcactaccca gtcatcgtga atcctcacct ctgtgtcttc ttcgttttgg       540
     tgtccttttt ccttagcctg ttggattccc agctgcacag ttggattgtg ttacaattca       600
     ccatcatcaa gaatgtggaa atctctaatt ttgtctgtga cccctctcaa cttctcaaac       660
     ttgcctgttc tgacagcgtc atcaatagca tattcatata ttttgatagt actatgtttg       720
     gttttcttcc catttcaggg atccttttgt cttactctaa aattgtcccc tccgttctaa       780
     ggatgtcatc gtcagatggg aagtataaag ccttctccac ctgtggctct cacctagcag       840
     ttgtttgctg atttgatgga acaggcattg gcatgtacct gacttcagct gtggcaccac       900
     cccccaggaa tggtgtcgtg gagtcaggga tgtacgctgt ggtcaccccc atgctgaacc       960
     ttttcatcta cagcctgaga aacaggcaca cacaaagtgc cctgcggagg ctgcgcagca      1020
     gaacagttga atctcatgat ctcttgcatc c                                     1051
//

If you have problems or comments...

PBIL Back to PBIL home page