(data stored in ACNUC7820 zone)

EMBL: AB065927

ID   AB065927; SV 1; linear; genomic DNA; STD; HUM; 1375 BP.
XX
AC   AB065927;
XX
DT   24-JUL-2002 (Rel. 72, Created)
DT   01-MAR-2003 (Rel. 74, Last updated, Version 2)
XX
DE   Homo sapiens gene for seven transmembrane helix receptor, complete cds,
DE   isolate:CBRC7TM_490.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1375
RA   Suwa M.;
RT   ;
RL   Submitted (11-JUL-2001) to the INSDC.
RL   Makiko Suwa, Computational Biology Research Center (CBRC), National
RL   Institute of Advanced Industrial Science and Technology (AIST); 2-41-6 Aomi
RL   Koto-ku, Tokyo 135-0064, Japan (E-mail:m-suwa@aist.go.jp,
RL   URL:http://www.cbrc.jp/, Tel:81-3-3599-8080, Fax:81-3-3599-8081)
XX
RN   [2]
RA   Suwa M., Sato T., Okouchi I., Arita M., Futami K., Matsumoto S.,
RA   Tsutsumi S., Aburatani H., Asai K., Akiyama Y.;
RT   "Genome-wide discovery and analysis of human seven transmembrane helix
RT   receptor genes.";
RL   Unpublished.
XX
DR   MD5; a549c4c8d857656f1d847668c21bc03a.
DR   Ensembl-Gn; ENSG00000170923; homo_sapiens.
DR   Ensembl-Tr; ENST00000641081; homo_sapiens.
XX
CC   This sequence is a seven transmembrane helix receptor candidate
CC   predicted from the whole human genome sequences using our
CC   automated system that contains programs of gene
CC   finding(GeneDecoder), sequence search, motif-domain assignment and
CC   transmembrane helix prediction.
CC   And the sequence is submitted by the collaborative project between
CC   [Computational Biology Research Center (CBRC), National Institute
CC   of Advanced Industrial Science and Technology (AIST)] and [Genome
CC   Science Division, Research Center for Advanced Science and
CC   Technology (RCAST), University of Tokyo].
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1375
FT                   /organism="Homo sapiens"
FT                   /chromosome="19"
FT                   /isolate="CBRC7TM_490"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        201..1175
FT                   /codon_start=1
FT                   /product="seven transmembrane helix receptor"
FT                   /db_xref="GOA:Q8NG99"
FT                   /db_xref="HGNC:HGNC:8466"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8NG99"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="BAC06142.1"
FT                   /translation="MEARNQTAISKFLLLGLIEDPELQPVLFSLFLSMYLVTILGNLLI
FT                   LLAVISDSHLHTPMYFFLSNLSFLDICLSTTTIPKMLVNIQAQNRSITYSGCLTQICFV
FT                   LFFAGLENCLLAAMAYDRYVAICHPLRYTVIMNPRLCGLLILLSLLTSVVNALLLSLMV
FT                   LRLSFCTDLEIPLFFCELAQVIQLTCSDTLINNILIYFAACIFGGVPLSGIILSYTQIT
FT                   SCVLRMPSASGKHKAVSTCGSHLSIVLLFYGAGLGVYISSVVTDSPRKTAVASVMYSVF
FT                   PQMVNPFIYSLRNKDMKGTLRKFIGRIPSLLWCAICFGFRFLE"
XX
SQ   Sequence 1375 BP; 292 A; 358 C; 296 G; 429 T; 0 other;
     tctcaaaatt cagcatctat caaaaacatc tacaaggctt gtgaaagaat aaactgtcgg        60
     ttctcatccc cagagtttat cagcaagaag tctggggagg ggagcaagat tttgcgtttc       120
     tgtcatgttc tcgagtgatg ccgatgcagc tgctgcttac agattttatt atcttttcca       180
     tcagattcat catcaacagc atggaagcga gaaaccaaac agctatttca aaattccttc       240
     tcctgggact gatagaggat ccggaactgc agcccgtcct tttcagcctg ttcctgtcca       300
     tgtacttggt caccatcctg gggaacctgc tcatcctctt ggctgtcatc tctgactctc       360
     acctccacac ccccatgtac ttcttcctct ccaatctctc ctttttggac atttgtttaa       420
     gcacaaccac gatcccaaag atgctggtga acatccaagc tcagaatcgg agcatcacgt       480
     actcaggctg cctcacccag atctgctttg tcttgttttt tgctggcttg gaaaattgtc       540
     tccttgcagc aatggcctat gaccgctatg tggccatttg tcaccccctt agatacacag       600
     tcatcatgaa cccccgcctc tgtggcctgc tgattcttct ctctctgttg actagtgttg       660
     tgaatgccct tcttctcagc ctgatggtgt tgaggctgtc cttctgcaca gacctggaaa       720
     tcccgctctt cttctgtgaa ctggctcagg tcatccaact cacctgttca gacaccctca       780
     tcaataacat cctgatatat tttgcagctt gcatatttgg tggtgttcct ctgtctggaa       840
     tcattttgtc ttacactcag atcacctcct gtgttttgag aatgccatca gcaagtggaa       900
     agcacaaagc agtttccacc tgtgggtctc acctctccat tgttctcttg ttctatgggg       960
     caggtttggg ggtgtacatt agttctgtgg ttactgactc acctaggaag actgcagtgg      1020
     cttcagtgat gtattctgtg ttccctcaaa tggtgaaccc ctttatctat agtctgagga      1080
     ataaggacat gaaaggaacc ttgaggaagt tcatagggag gataccttct cttctgtggt      1140
     gtgccatttg ctttggattc aggtttctag agtaagtcaa agtgacagga ttcctggtga      1200
     gctagaatgc ctgactcttt gttttgtttt gtttttttct ctgagatgga gtctttctct      1260
     gtctcccagg ctggagtgca atggcacgac ctcggctcac tgcaacttcc gcctccgggt      1320
     tcaagccatc ctcctgcctc agcctcctga gtagtgggga ttacaggcgc ctgcc           1375
//

If you have problems or comments...

PBIL Back to PBIL home page