(data stored in ACNUC21562 zone)

EMBL: AB083627

ID   AB083627; SV 1; linear; genomic DNA; STD; HUM; 966 BP.
XX
AC   AB083627;
XX
DT   16-APR-2002 (Rel. 71, Created)
DT   27-FEB-2006 (Rel. 86, Last updated, Version 3)
XX
DE   Homo sapiens GPCR gene for putative G-protein coupled receptor, complete
DE   CDS, clone:hGPCR45.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-966
RA   Takeda S., Kadowaki S., Haga T., Takaesu H., Mitaku S.;
RT   ;
RL   Submitted (10-APR-2002) to the INSDC.
RL   Shigeki Takeda, Gunma University, Department of Biological and Chemical,
RL   Engineering, Faculty of Engineering; 1-5-1, Kiryu, Gunma 376-8515, Japan
RL   (E-mail:stakeda@bce.gunma-u.ac.jp, Tel:+81-277-30-1434,
RL   Fax:+81-277-30-1434)
XX
RN   [2]
RX   DOI; 10.1016/S0014-5793(02)02775-8.
RX   PUBMED; 12044878.
RA   Takeda S., Kadowaki S., Haga T., Takaesu H., Mitaku S.;
RT   "Identification of G protein-coupled receptor genes from the human genome
RT   sequence";
RL   FEBS Lett. 520(1-3):97-101(2002).
XX
DR   MD5; 2245675f09884ba91a3a9e0dcd3110a0.
DR   Ensembl-Gn; ENSG00000172938; homo_sapiens.
DR   Ensembl-Tr; ENST00000309106; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..966
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="hGPCR45"
FT                   /db_xref="taxon:9606"
FT   CDS_pept        1..966
FT                   /codon_start=1
FT                   /gene="GPCR"
FT                   /product="putative G-protein coupled receptor"
FT                   /note="predicted with SOSUI analysis"
FT                   /db_xref="GOA:Q8TDS7"
FT                   /db_xref="H-InvDB:HIT000383590.6"
FT                   /db_xref="HGNC:HGNC:29626"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="InterPro:IPR026232"
FT                   /db_xref="InterPro:IPR026234"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8TDS7"
FT                   /protein_id="BAB89340.1"
FT                   /translation="MNQTLNSSGTVESALNYSRGSTVHTAYLVLSSLAMFTCLCGMAGN
FT                   SMVIWLLGFRMHRNPFCIYILNLAAADLLFLFSMASTLSLETQPLVNTTDKVHELMKRL
FT                   MYFAYTVGLSLLTAISTQRCLSVLFPIWFKCHRPRHLSAWVCGLLWTLCLLMNGLTSSF
FT                   CSKFLKFNEDRCFRVDMVQAALIMGVLTPVMTLSSLTLFVWVRRSSQQWRRQPTRLFVV
FT                   VLASVLVFLICSLPLSIYWFVLYWLSLPPEMQVLCFSLSRLSSSVSSSANPVIYFLVGS
FT                   RRSHRLPTRSLGTVLQQALREEPELEGGETPTVGTNEMGA"
XX
SQ   Sequence 966 BP; 168 A; 303 C; 274 G; 221 T; 0 other;
     atgaaccaga ctttgaatag cagtgggacc gtggagtcag ccctaaacta ttccagaggg        60
     agcacagtgc acacggccta cctggtgctg agctccctgg ccatgttcac ctgcctgtgc       120
     gggatggcag gcaacagcat ggtgatctgg ctgctgggct ttcgaatgca caggaacccc       180
     ttctgcatct atatcctcaa cctggcggca gccgacctcc tcttcctctt cagcatggct       240
     tccacgctca gcctggaaac ccagcccctg gtcaatacca ctgacaaggt ccacgagctg       300
     atgaagagac tgatgtactt tgcctacaca gtgggcctga gcctgctgac ggccatcagc       360
     acccagcgct gtctctctgt cctcttccct atctggttca agtgtcaccg gcccaggcac       420
     ctgtcagcct gggtgtgtgg cctgctgtgg acactctgtc tcctgatgaa cgggttgacc       480
     tcttccttct gcagcaagtt cttgaaattc aatgaagatc ggtgcttcag ggtggacatg       540
     gtccaggccg ccctcatcat gggggtctta accccagtga tgactctgtc cagcctgacc       600
     ctctttgtct gggtgcggag gagctcccag cagtggcggc ggcagcccac acggctgttc       660
     gtggtggtcc tggcctctgt cctggtgttc ctcatctgtt ccctgcctct gagcatctac       720
     tggtttgtgc tctactggtt gagcctgccg cccgagatgc aggtcctgtg cttcagcttg       780
     tcacgcctct cctcgtccgt aagcagcagc gccaaccccg tcatctactt cctggtgggc       840
     agccggagga gccacaggct gcccaccagg tccctgggga ctgtgctcca acaggcgctt       900
     cgcgaggagc ccgagctgga aggtggggag acgcccaccg tgggcaccaa tgagatgggg       960
     gcttga                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page