(data stored in ACNUC16935 zone)

EMBL: AB098891

ID   AB098891; SV 1; linear; mRNA; STD; MAM; 607 BP.
XX
AC   AB098891;
XX
DT   01-FEB-2003 (Rel. 74, Created)
DT   16-NOV-2007 (Rel. 93, Last updated, Version 4)
XX
DE   Bos taurus mRNA for similar to ubiquitin-S27a fusion protein, partial cds,
DE   clone: ORCS10065.
XX
KW   .
XX
OS   Bos taurus (cattle)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia; Pecora; Bovidae;
OC   Bovinae; Bos.
XX
RN   [1]
RP   1-607
RA   Tsujimoto G., Ishiwata H., Katsuma S., Kizaki K., Patel O.V., Nakano H.,
RA   Konno T., Ushizawa K., Takahashi T., Imai K., Hirasawa A., Shiojima S.,
RA   Ikawa H., Suzuki Y., Izaike Y., Todoroki J., Hashizume K.;
RT   ;
RL   Submitted (25-DEC-2002) to the INSDC.
RL   Gozoh Tsujimoto, National Research Institute for Child Health and
RL   Development, Department of Molecular, Cell Pharmacology; 3-35-31 Taishido,
RL   Setagaya, Tokyo 154-8567, Japan (E-mail:gtsujimoto@nch.go.jp,
RL   Tel:81-3-3149-2476, Fax:81-3-3149-1252)
XX
RN   [2]
RX   DOI; 10.1002/mrd.10292.
RX   PUBMED; 12658628.
RA   Ishiwata H., Katsuma S., Kizaki K., Patel O.V., Nakano H., Takahashi T.,
RA   Imai K., Hirasawa A., Shiojima S., Ikawa H., Suzuki Y., Tsujimoto G.,
RA   Izaike Y., Todoroki J., Hashizume K.;
RT   "Characterization of gene expression profiles in early bovine pregnancy
RT   using a custom cDNA microarray";
RL   Mol. Reprod. Dev. 65(1):9-18(2003).
XX
DR   MD5; 6609a02517a0a0f411bc7981c41c0fce.
DR   Ensembl-Gn; ENSBTAG00000015473; bos_taurus.
DR   Ensembl-Tr; ENSBTAT00000033091; bos_taurus.
XX
CC   This work was performed to collaborate with Developmental Biology
CC   Department, National Institute of Agrobiological Sciences.
CC   Address: 2 Ikenodai, Tsukuba, Ibaraki, 305-8602 Japan.
CC   This work was funded by Organized Research Combination System
CC   (ORCS) project of Ministry of Education, Culture, Sports, Science
CC   and Technology.
CC   5' end partial sequence
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..607
FT                   /organism="Bos taurus"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /clone_lib="ORCS bovine utero-placenta cDNA"
FT                   /clone="ORCS10065"
FT                   /note="mixture of uterus and placenta"
FT                   /db_xref="taxon:9913"
FT   CDS_pept        <128..>562
FT                   /codon_start=1
FT                   /product="similar to ubiquitin-S27a fusion protein"
FT                   /db_xref="GOA:P62992"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR002906"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR038582"
FT                   /db_xref="PDB:4M0W"
FT                   /db_xref="PDB:4Y1H"
FT                   /db_xref="PDB:4Z9S"
FT                   /db_xref="PDB:5BZ0"
FT                   /db_xref="PDB:5FER"
FT                   /db_xref="PDB:5JQS"
FT                   /db_xref="PDB:5MN9"
FT                   /db_xref="PDB:5XU8"
FT                   /db_xref="PDB:5XVE"
FT                   /db_xref="PDB:6DJW"
FT                   /db_xref="PDB:6DJX"
FT                   /db_xref="PDB:6E2B"
FT                   /db_xref="UniProtKB/Swiss-Prot:P62992"
FT                   /protein_id="BAC56381.1"
FT                   /translation="MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLK
FT                   YYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYVANVV"
XX
SQ   Sequence 607 BP; 167 A; 140 C; 154 G; 144 T; 2 other;
     ggcacgaggg cggtgagtgt gtgcatgcgg ccgcgctctg gcccgataac ttgccatcgc        60
     cccttctgtg tctccgggtc tcatccgtct cctccttttc ctcaccctca ggtggaaccg       120
     ccgcaagatg cagattttcg tgaagaccct gacggggaag accatcactc tcgaggtcga       180
     gccctcggat acaatagaaa atgtaaaggc caagatccag gataaagaag gaattcctcc       240
     tgaccagcaa agactgatct ttgctggcaa gcaactggaa gatggacgta ctttgtctga       300
     ctacaacatt caaaaggagt ccactcttca tctagtgttg agacttcgtg gtggcgctaa       360
     gaaaagaaag aagaagtctt acaccactcc caagaagaac aagcataaga gaaagaaggt       420
     taaattggct gttctgaaat actacaaggt ggatgagaat ggcaaaatca gtcgccttcg       480
     ccgggagtgt ccctcagatg aatgtggtgc tggagttttt atggccagtc actttgacag       540
     acattatgtg gcnaatgttg tctgacctat gtttcaacaa ccagaagaca aggtatgtnt       600
     atggtta                                                                 607
//

If you have problems or comments...

PBIL Back to PBIL home page