(data stored in ACNUC16935 zone)

EMBL: AB098957

ID   AB098957; SV 1; linear; mRNA; STD; MAM; 502 BP.
XX
AC   AB098957;
XX
DT   01-FEB-2003 (Rel. 74, Created)
DT   16-NOV-2007 (Rel. 93, Last updated, Version 3)
XX
DE   Bos taurus mRNA for similar to ubiquitin/ribosomal fusion protein, partial
DE   cds, clone: ORCS10973.
XX
KW   .
XX
OS   Bos taurus (cattle)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia; Pecora; Bovidae;
OC   Bovinae; Bos.
XX
RN   [1]
RP   1-502
RA   Tsujimoto G., Ishiwata H., Katsuma S., Kizaki K., Patel O.V., Nakano H.,
RA   Konno T., Ushizawa K., Takahashi T., Imai K., Hirasawa A., Shiojima S.,
RA   Ikawa H., Suzuki Y., Izaike Y., Todoroki J., Hashizume K.;
RT   ;
RL   Submitted (25-DEC-2002) to the INSDC.
RL   Gozoh Tsujimoto, National Research Institute for Child Health and
RL   Development, Department of Molecular, Cell Pharmacology; 3-35-31 Taishido,
RL   Setagaya, Tokyo 154-8567, Japan (E-mail:gtsujimoto@nch.go.jp,
RL   Tel:81-3-3149-2476, Fax:81-3-3149-1252)
XX
RN   [2]
RX   DOI; 10.1002/mrd.10292.
RX   PUBMED; 12658628.
RA   Ishiwata H., Katsuma S., Kizaki K., Patel O.V., Nakano H., Takahashi T.,
RA   Imai K., Hirasawa A., Shiojima S., Ikawa H., Suzuki Y., Tsujimoto G.,
RA   Izaike Y., Todoroki J., Hashizume K.;
RT   "Characterization of gene expression profiles in early bovine pregnancy
RT   using a custom cDNA microarray";
RL   Mol. Reprod. Dev. 65(1):9-18(2003).
XX
DR   MD5; e1503ee6fb8620f8235a07af3516d382.
DR   Ensembl-Gn; ENSBTAG00000007737; bos_taurus.
DR   Ensembl-Tr; ENSBTAT00000010176; bos_taurus.
XX
CC   This work was performed to collaborate with Developmental Biology
CC   Department, National Institute of Agrobiological Sciences.
CC   Address: 2 Ikenodai, Tsukuba, Ibaraki, 305-8602 Japan.
CC   This work was funded by Organized Research Combination System
CC   (ORCS) project of Ministry of Education, Culture, Sports, Science
CC   and Technology.
CC   5' end partial sequence
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..502
FT                   /organism="Bos taurus"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /clone_lib="ORCS bovine utero-placenta cDNA"
FT                   /clone="ORCS10973"
FT                   /note="mixture of uterus and placenta"
FT                   /db_xref="taxon:9913"
FT   CDS_pept        <62..>397
FT                   /codon_start=1
FT                   /product="similar to ubiquitin/ribosomal fusion protein"
FT                   /db_xref="GOA:P63048"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR001975"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR038587"
FT                   /db_xref="PDB:4LJO"
FT                   /db_xref="PDB:4LJP"
FT                   /db_xref="PDB:4S22"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63048"
FT                   /protein_id="BAC56447.1"
FT                   /translation="VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI
FT                   QKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMILPQVLRPPAPPCCQLPQEEVWHTNN
FT                   LRPKKKVK"
XX
SQ   Sequence 502 BP; 122 A; 159 C; 124 G; 97 T; 0 other;
     gcaggcgcag agatgcagat ctttgtgaag accctgacgg gcaagaccat cacccttgag        60
     tgtcgagccc agtgacacca ttgagaatgt caaagccaaa atccaagaca aggagggcat       120
     cccacctgac cagcagcggc tgatcttcgc tggcaaacag ctggaggatg gccgcactct       180
     gtcagattac aatatccaga aagagtccac cctgcacttg gtgcttcgtc tgcgaggcgg       240
     catcatcgag ccttccctcc gccagctcgc tcagaaatac aactgcgaca agatgatctt       300
     gccgcaagtg ttacgcccgc ctgcaccccc gtgctgtcaa ctgccgcaag aagaagtgtg       360
     gcacaccaac aacctgcgcc ccaagaagaa ggtcaaataa agctcttcca cctgcttctc       420
     ctttgcccgc agggcggcct cctgcccaag ccccgtggtc ctgggcctca ataaagtttc       480
     cctttcgttg actgtgagca gt                                                502
//

If you have problems or comments...

PBIL Back to PBIL home page