(data stored in ACNUC16935 zone)

EMBL: AB099083

ID   AB099083; SV 1; linear; mRNA; STD; MAM; 567 BP.
XX
AC   AB099083;
XX
DT   01-FEB-2003 (Rel. 74, Created)
DT   16-NOV-2007 (Rel. 93, Last updated, Version 4)
XX
DE   Bos taurus mRNA for similar to polyubiquitin, partial cds, clone:
DE   ORCS13778.
XX
KW   .
XX
OS   Bos taurus (cattle)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae;
OC   Bovinae; Bos.
XX
RN   [1]
RP   1-567
RA   Tsujimoto G., Ishiwata H., Katsuma S., Kizaki K., Patel O.V., Nakano H.,
RA   Konno T., Ushizawa K., Takahashi T., Imai K., Hirasawa A., Shiojima S.,
RA   Ikawa H., Suzuki Y., Izaike Y., Todoroki J., Hashizume K.;
RT   ;
RL   Submitted (25-DEC-2002) to the INSDC.
RL   Gozoh Tsujimoto, National Research Institute for Child Health and
RL   Development, Department of Molecular, Cell Pharmacology; 3-35-31 Taishido,
RL   Setagaya, Tokyo 154-8567, Japan (E-mail:gtsujimoto@nch.go.jp,
RL   Tel:81-3-3149-2476, Fax:81-3-3149-1252)
XX
RN   [2]
RX   DOI; 10.1002/mrd.10292.
RX   PUBMED; 12658628.
RA   Ishiwata H., Katsuma S., Kizaki K., Patel O.V., Nakano H., Takahashi T.,
RA   Imai K., Hirasawa A., Shiojima S., Ikawa H., Suzuki Y., Tsujimoto G.,
RA   Izaike Y., Todoroki J., Hashizume K.;
RT   "Characterization of gene expression profiles in early bovine pregnancy
RT   using a custom cDNA microarray";
RL   Mol. Reprod. Dev. 65(1):9-18(2003).
XX
DR   MD5; 0c50e768aea7f282dbcc2fde38414641.
DR   Ensembl-Gn; ENSBTAG00000017246; bos_taurus.
DR   Ensembl-Tr; ENSBTAT00000022919; bos_taurus.
XX
CC   This work was performed to collaborate with Developmental Biology
CC   Department, National Institute of Agrobiological Sciences.
CC   Address: 2 Ikenodai, Tsukuba, Ibaraki, 305-8602 Japan.
CC   This work was funded by Organized Research Combination System
CC   (ORCS) project of Ministry of Education, Culture, Sports, Science
CC   and Technology.
CC   5' end partial sequence
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..567
FT                   /organism="Bos taurus"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /clone_lib="ORCS bovine utero-placenta cDNA"
FT                   /clone="ORCS13778"
FT                   /note="mixture of uterus and placenta"
FT                   /db_xref="taxon:9913"
FT   CDS_pept        <52..>564
FT                   /codon_start=1
FT                   /product="similar to polyubiquitin"
FT                   /db_xref="GOA:P0CG53"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="PDB:5TR4"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CG53"
FT                   /protein_id="BAC56573.1"
FT                   /translation="HLRIHSQVKMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGI
FT                   PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEP
FT                   SDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQ
FT                   IFVKTLTG"
XX
SQ   Sequence 567 BP; 139 A; 157 C; 158 G; 113 T; 0 other;
     gttgggttcc tgtgtcgtct tggaggtgac tcggcgtgat tgaatttgcg gcatcttcgc        60
     attcactcac aggtcaaaat gcagatcttc gtgaaaaccc tgaccggcaa gaccatcacc       120
     ctggaggtgg agcccagtga caccatcgag aacgtgaagg ccaagatcca ggataaggaa       180
     ggcattcccc ctgaccagca gaggctcatc tttgccggca agcagctgga agatggccgc       240
     actctttctg attacaacat ccagaaagag tcgaccctgc acctggtcct ccgtctgagg       300
     ggtggtatgc agattttcgt gaagaccctg accggcaaga ccatcaccct ggaagtggag       360
     cccagtgaca ccatcgagaa cgtgaaggcc aagatccagg ataaggaggg cattcccccc       420
     gaccagcaga ggctcatctt tgccggcaag cagctggaag atggccgcac tctttctgat       480
     tacaacatcc agaaagagtc gaccctgcac ctggtcctcc gtctgagggg tggtatgcag       540
     atcttcgtga agaccctgac gggagac                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page