(data stored in ACNUC3759 zone)

EMBL: AB102789

ID   AB102789; SV 1; linear; mRNA; STD; ROD; 1443 BP.
XX
AC   AB102789;
XX
DT   22-APR-2008 (Rel. 95, Created)
DT   22-APR-2008 (Rel. 95, Last updated, Version 1)
XX
DE   Rattus norvegicus Gata2 mRNA for GATA-binding protein 2, complete cds,
DE   strain:F344/DuCrj.
XX
KW   .
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-1443
RA   Tsuji A.B.;
RT   ;
RL   Submitted (06-FEB-2003) to the INSDC.
RL   Contact:Atsushi B Tsuji National Institute of Radiological Sciences,
RL   Frontier Research Center; 4-9-1 Anagawa, Inage-ku, Chiba, Chiba 263-8555,
RL   Japan
XX
RN   [2]
RA   Tsuji A.B., Sugyo A., Imai T., Harada Y.;
RT   "High resolution mapping of a radiation susceptibility gene on rat
RT   chromosome 4 using LEC congenic lines";
RL   Unpublished.
XX
DR   MD5; 69910f14af4d4f11866cbb9a6c7f0bc7.
DR   Ensembl-Gn; ENSRNOG00000012347; rattus_norvegicus.
DR   Ensembl-Tr; ENSRNOT00000017240; rattus_norvegicus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1443
FT                   /organism="Rattus norvegicus"
FT                   /chromosome="4"
FT                   /strain="F344/DuCrj"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10116"
FT   CDS_pept        1..1443
FT                   /codon_start=1
FT                   /transl_table=1
FT                   /gene="Gata2"
FT                   /product="GATA-binding protein 2"
FT                   /db_xref="GOA:B2DBE1"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="InterPro:IPR016374"
FT                   /db_xref="InterPro:IPR029522"
FT                   /db_xref="InterPro:IPR039355"
FT                   /db_xref="UniProtKB/TrEMBL:B2DBE1"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="BAG30820.1"
FT                   /translation="MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEV
FT                   DVFFNHLDSQGNPYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAA
FT                   LSAAAAHHHSPWTVSPFSKTPLHPSAAGAPGGPLSVYPGAAGGSGGGSGSSVASLTPTA
FT                   AHSGSHLFGFPPTPPKEVSPDPSTTGAASPASPSAGGSVARGEDKDGVKYQVSLSESMK
FT                   MEGGSPLRPGLAPMGTQPATHHPIPTYPSYVPASAHEYGSGLFHPGGFLGGPASSFTPK
FT                   QRSKARSCSEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLS
FT                   AARRAGTCCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRK
FT                   MSSKSKKSKKGAECFEELSKCMQEKSSPFSAAALAGHMAPVGHLPPFSHSGHILPTPTP
FT                   IHPSSSLSFGHPHPSSMVTAMG"
XX
SQ   Sequence 1443 BP; 300 A; 508 C; 388 G; 247 T; 0 other;
     atggaggtgg cgcctgagca gcctcgctgg atggcgcacc ccgccgtatt gaatgcgcag        60
     caccccgact cgcaccatcc gggcctggca cacaactaca tggagccggc acagctgctg       120
     cctccggacg aggtggatgt cttcttcaac cacctcgact cgcagggcaa cccctactac       180
     gccaacccag cccacgcgcg cgcgcgcgtt tcctacagtc cagcgcatgc ccgtctcaca       240
     ggaggccaga tgtgccgacc acacttgttg cacagcccag gcttgccatg gctggacggg       300
     ggcaaagcag ctctctctgc cgctgctgcc catcaccaca gcccctggac cgtcagcccg       360
     ttctccaaga ccccgctgca cccctcagct gctggagcac ctggagggcc tctgtctgtg       420
     tacccagggg ctgcgggtgg gagcggtgga ggcagcggga gctccgtagc ctccctcacc       480
     cccactgcag cccactcagg ctcccatctc ttcggcttcc cacccacgcc acccaaagaa       540
     gtgtctccag accccagcac cacaggagct gcttccccag cctcaccttc agcagggggt       600
     agtgtagccc ggggtgagga caaggatggc gtcaagtatc aagtgtcact gtctgagagc       660
     atgaagatgg aaggtggcag tcccctgcgc ccgggcctag ctcccatggg cacccagcct       720
     gcaacacacc acccaatacc cacctatccc tcctatgtgc ctgcctcagc tcatgaatat       780
     ggcagcgggc tcttccatcc cggaggcttc ctgggtggcc cagcctccag cttcacccct       840
     aagcagcgaa gcaaggctcg ctcctgctca gaaggccggg agtgtgtcaa ctgcggggcc       900
     acagccaccc ctctctggcg acgggatggc acgggccact acctgtgcaa tgcctgtggg       960
     ctctaccaca agatgaatgg acagaatcgg ccgctcatca agcccaagag gagactgtct      1020
     gctgccagga gagcgggcac ctgttgtgca aattgtcaga cgacaaccac caccttatgg      1080
     cgccggaacg ccaacgggga ccctgtgtgc aacgcctgtg gcctctacta caagctgcac      1140
     aatgttaaca ggccactgac catgaagaag gaagggatcc agacccggaa tcggaagatg      1200
     tccagcaaat ccaagaagag caagaaagga gccgaatgct ttgaggagct atccaagtgc      1260
     atgcaggaga agtcatcccc cttcagtgcg gctgccctgg ctggacacat ggcacctgtg      1320
     ggacacctcc caccttttag tcactctgga cacatcctac ctacgccaac gcctatccac      1380
     ccctcctcca gtctctcctt tggtcacccc cacccgtcca gcatggtgac tgccatgggc      1440
     tag                                                                    1443
//

If you have problems or comments...

PBIL Back to PBIL home page